Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D09966g3.493ON1781789091e-126
TDEL0D056103.493ON1751786104e-81
YPR149W (NCE102)3.493ON1731785671e-74
Skud_16.4443.493ON1731785643e-74
Smik_16.4023.493ON1731785583e-73
Kpol_1017.63.493ON1871785551e-72
CAGL0I10494g3.493ON1721795471e-71
TBLA0C044903.493ON1861755394e-70
YGR131W (FHN1)3.493ON1741785366e-70
CAGL0L08448g3.493ON1731785351e-69
NDAI0G009303.493ON1761785314e-69
KAFR0C019703.493ON1791795272e-68
TBLA0D029603.493ON1891895152e-66
Suva_16.4783.493ON1661785104e-66
SAKL0F02750g3.493ON1701785099e-66
TPHA0D032803.493ON1841855047e-65
NDAI0B058803.493ON1821835038e-65
Suva_7.4193.493ON1741785021e-64
NCAS0E008003.493ON1741784942e-63
KLLA0D16280g3.493ON1691784898e-63
Skud_7.4423.493ON1741784716e-60
KNAG0B008003.493ON1821834716e-60
KLTH0F14850g3.493ON1711784672e-59
Smik_6.2273.493ON1741784663e-59
KNAG0A079503.493ON1821834647e-59
Kwal_55.212383.493ON1701784463e-56
NCAS0F035603.493ON1831854334e-54
KAFR0G037003.493ON1861784188e-52
AFR312W3.493ON1681233534e-42
Ecym_12363.493ON1691783342e-39
Kwal_23.4058singletonON2161451034e-05
Suva_4.272.61ON322153830.020
Kpol_530.476.102ON13540730.18
KNAG0L023302.61ON305143740.26
Smik_4.212.61ON316153720.46
YDL218W2.61ON317153720.54
SAKL0D00110gsingletonON562155682.0
TBLA0B006702.61ON282113672.1
SAKL0F16764gsingletonON284155672.2
Skud_4.352.61ON317153672.3
Kwal_14.18626.102ON13551633.9
KLTH0H06886g6.102ON13550634.7
Ecym_30846.102ON13579625.1
KLTH0B07326g2.61ON307161636.3
TDEL0G036906.102ON13741626.4
ZYRO0C05126g6.102ON14141617.4
Kpol_478.196.102ON13740617.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D09966g
         (178 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   354   e-126
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   239   4e-81
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   223   1e-74
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   221   3e-74
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   219   3e-73
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   218   1e-72
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   215   1e-71
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   212   4e-70
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   211   6e-70
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   210   1e-69
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   209   4e-69
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   207   2e-68
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   202   2e-66
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   201   4e-66
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   200   9e-66
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   198   7e-65
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   198   8e-65
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   197   1e-64
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   194   2e-63
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   192   8e-63
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   186   6e-60
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   186   6e-60
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   184   2e-59
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   184   3e-59
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   183   7e-59
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   176   3e-56
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   171   4e-54
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   165   8e-52
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   140   4e-42
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   133   2e-39
Kwal_23.4058 s23 complement(551392..552042) [651 bp, 216 aa] {ON...    44   4e-05
Suva_4.27 Chr4 (54848..55816) [969 bp, 322 aa] {ON} YDL218W (REAL)     37   0.020
Kpol_530.47 s530 complement(108566..108973) [408 bp, 135 aa] {ON...    33   0.18 
KNAG0L02330 Chr12 complement(413866..414783) [918 bp, 305 aa] {O...    33   0.26 
Smik_4.21 Chr4 (44522..45472) [951 bp, 316 aa] {ON} YDL218W (REAL)     32   0.46 
YDL218W Chr4 (66493..67446) [954 bp, 317 aa] {ON} Putative prote...    32   0.54 
SAKL0D00110g Chr4 (1481..3169) [1689 bp, 562 aa] {ON} some simil...    31   2.0  
TBLA0B00670 Chr2 (141759..142607) [849 bp, 282 aa] {ON} Anc_2.61...    30   2.1  
SAKL0F16764g Chr6 (1384018..1384872) [855 bp, 284 aa] {ON} some ...    30   2.2  
Skud_4.35 Chr4 (62864..63817) [954 bp, 317 aa] {ON} YDL218W (REAL)     30   2.3  
Kwal_14.1862 s14 complement(499199..499606) [408 bp, 135 aa] {ON...    29   3.9  
KLTH0H06886g Chr8 complement(605628..606035) [408 bp, 135 aa] {O...    29   4.7  
Ecym_3084 Chr3 complement(157797..158204) [408 bp, 135 aa] {ON} ...    28   5.1  
KLTH0B07326g Chr2 complement(591369..592292) [924 bp, 307 aa] {O...    29   6.3  
TDEL0G03690 Chr7 complement(679342..679755) [414 bp, 137 aa] {ON...    28   6.4  
ZYRO0C05126g Chr3 complement(401542..401967) [426 bp, 141 aa] {O...    28   7.4  
Kpol_478.19 s478 complement(64243..64656) [414 bp, 137 aa] {ON} ...    28   7.6  

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  354 bits (909), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 178/178 (100%), Positives = 178/178 (100%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178
           AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  239 bits (610), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 131/178 (73%), Positives = 148/178 (83%), Gaps = 3/178 (1%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           MLA+ DN LR VNF F VILLGLVG+LI SE  GH+SRVNFCMFAAAFGIV DSFYGILA
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSED-GHSSRVNFCMFAAAFGIVTDSFYGILA 59

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           NI+  FA+PVILF LDFLNF FTF+AATALAVGIRTHSC N+ YLDSN ITQGST RCR 
Sbjct: 60  NIWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRL 119

Query: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178
           AQA VAFFYF+FFIFL KM+MS + +++NG F S +  +SRRR++ Q  VGVPTISQV
Sbjct: 120 AQASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRKSAQ--VGVPTISQV 175

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  223 bits (567), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 135/178 (75%), Gaps = 5/178 (2%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           MLAL DNILR +NF F VI +GL+  L+ ++ H H+SRVN+CMFA A+GI  DS YG+ A
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQ-HRHSSRVNYCMFACAYGIFTDSLYGVFA 59

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N   P A+P++LF LDFLNFVFTFTA T LAVGIR HSC N  Y+DSNKITQGS +RCR+
Sbjct: 60  NFIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119

Query: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178
           AQA VAF YF+  IFL K +MS  +++SNGAFGS S FS RRR  Q   VGVPTISQV
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS-FSKRRRTGQ---VGVPTISQV 173

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  221 bits (564), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 136/178 (76%), Gaps = 5/178 (2%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           MLA  DNILR +NF F VI++GL+  L+ ++   ++SRVNFCMFAAA+GI  DS YG+ A
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDR-NSSRVNFCMFAAAYGIFTDSLYGVFA 59

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N F P A+P++LF LDFLNFVFTFTA T LAVGIR HSC NR Y+DSN ITQGS +RCR+
Sbjct: 60  NFFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQ 119

Query: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178
           AQA VAF YF+  IFL K +MS  +++SNGAFGS S FS RRR  Q   VGVPTISQV
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS-FSKRRRTGQ---VGVPTISQV 173

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  219 bits (558), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 112/178 (62%), Positives = 133/178 (74%), Gaps = 5/178 (2%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           MLAL DNILR +NF F VI + L+  L+ ++   H+SRVN+CMFA A+GI  DS YG+ A
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDK-HSSRVNYCMFACAYGIFTDSLYGVFA 59

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N   P A+P++LF LDFLNFVFTFTA T LAVGIR HSC N  Y+DSNKITQGS +RCR+
Sbjct: 60  NFIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119

Query: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178
           AQA VAF YF+  IFL K +MS  +++SNGAFGS S FS RRR  Q   VGVPTISQV
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSGS-FSKRRRTGQ---VGVPTISQV 173

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  218 bits (555), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 117/178 (65%), Positives = 142/178 (79%), Gaps = 3/178 (1%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML+L DNI+RA+NFCFFVI +GL+G L+ +EK GH+SRVN+CMF   F +V DSFYGILA
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEK-GHSSRVNYCMFVPPFAVVTDSFYGILA 59

Query: 61  NIFV-PFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCR 119
           NI+  PFA+P+ILF  DFLNF FTFTA T L+VGIRTHSC NR+Y+D+NKI QGST RCR
Sbjct: 60  NIWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCR 119

Query: 120 EAQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQ 177
           +AQA +AFFYF+FFIF  K+VMS ++LLSNGA G S+  S  RRR   AN+GVP  S 
Sbjct: 120 KAQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTP-SIGRRRHHTANIGVPGASS 176

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  215 bits (547), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 107/179 (59%), Positives = 133/179 (74%), Gaps = 8/179 (4%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML++ DN+LR VN  F +I +GL   LI + K  H+SRVNFC+FAAA+GI  DS YGI A
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKR-HSSRVNFCLFAAAYGIATDSLYGIFA 59

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLD-SNKITQGSTSRCR 119
           N F P A+P++LF+LDFLNFVFTFTA T LAVGIR HSC N+ YL+   KI QGS +RCR
Sbjct: 60  NFFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 119

Query: 120 EAQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178
           +AQA+VAFFYF+  IFL KM+MS +S++SNGAFG      ++ RR     VGVP+ISQV
Sbjct: 120 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFG------AKLRRKHHTEVGVPSISQV 172

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  212 bits (539), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 130/175 (74%), Gaps = 6/175 (3%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML+ T N+LR +NFCF VI+ G++GKLI+SEK  H+ RVN+CMFAA F +V DSFY I A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 61  NIFV-PFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCR 119
           N +  PFA+P++L+  DFLNF FTFTA T L+VGIRTHSC N+HYL SNKITQGST RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 120 EAQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAF-----GSSSGFSSRRRRTQQAN 169
            AQA +AF+YF+FFI+L ++V S L +  NG F     G +S  +SRRR   Q N
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWENGLFKPEERGGASFRNSRRRLATQQN 175

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  211 bits (536), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 133/178 (74%), Gaps = 4/178 (2%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML+  DN++R +N  F +I +GL+  LI ++   H+SRVNFCMFAA +G+V DS YG LA
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTK-HSSRVNFCMFAAVYGLVTDSLYGFLA 59

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N +    +P IL +LDFLNF+FTF AATALAVGIR HSC N+ YL+ NKI QGS+SRC +
Sbjct: 60  NFWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQ 119

Query: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178
           +QA VAFFYF+ F+FL K+ ++ + ++ NG FGS++GFS RR R Q   +G+PTISQV
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQ---MGIPTISQV 174

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  210 bits (535), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 106/178 (59%), Positives = 128/178 (71%), Gaps = 5/178 (2%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           MLA+TDN+LR VNF F VI +GL+  LI +    H+SRVN+CMFAAA+GI  DS YG+ A
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDR-HSSRVNYCMFAAAYGIATDSLYGVFA 59

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N F   A+P+ILF LDFLNF F  TA   LAVGIR HSC N HY ++NKI QGS  RCRE
Sbjct: 60  NFFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRE 119

Query: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178
           +QA VAFF+F+  IFL KM+MS L++ SNGAFG+       RRR   A VGVP++SQV
Sbjct: 120 SQAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGT----KFIRRRRNNAEVGVPSVSQV 173

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  209 bits (531), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 105/178 (58%), Positives = 134/178 (75%), Gaps = 2/178 (1%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML++ DN+LR +N  F VI +GL   L+ +++ GHNSR+N+CMF   + ++ DSF+GILA
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQ-GHNSRINYCMFTCVYCLLTDSFFGILA 59

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N F   +FP ILF LDFLNF FTF A T LA GIR+HSC N+ YLD NKITQGS +RCRE
Sbjct: 60  NFFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119

Query: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178
           +QA+VAFFYF+ FIFL K+ MS +S++ NGAF S++  S RRRR   A VGVP+ISQV
Sbjct: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGAF-SNTFTSRRRRRNGAAEVGVPSISQV 176

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  207 bits (527), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 107/179 (59%), Positives = 129/179 (72%), Gaps = 1/179 (0%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML + DNILR +N  F +I + L   LI ++   HNSRVN+CMFA AFG+  DS YGI A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N F   A+P++LF LDFLNF FTF+AATALAVGIR HSC N+ YLDSNKI +GS  RCRE
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGS-SSGFSSRRRRTQQANVGVPTISQV 178
           AQA+VAF YF+  IF+ KM+MS ++L  NGAF S SS F SRR++      GVP ISQV
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRFISRRKKHATDVGGVPNISQV 179

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  202 bits (515), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 127/189 (67%), Gaps = 11/189 (5%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML L DN+ R  NFCFFVI  G++G L+ +E   H+SRVN+CMF  A+G+V+DSFYGILA
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 61  NIFV-PFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCR 119
           N+   PFAFP ILF  DFLNFVFTFTA T LAVGIRTHSCTN+ Y   N I QGS  RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 120 EAQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSS----------GFSSRRRRTQQAN 169
           EAQA +AFFYF+ F+FL K++++ ++  + G  G +           G   R R   Q N
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTGGELGQTGYGGGYGGRSFGRRPRTRAPPQMN 180

Query: 170 VGVPTISQV 178
            G  +ISQV
Sbjct: 181 KGGISISQV 189

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  201 bits (510), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 108/178 (60%), Positives = 129/178 (72%), Gaps = 12/178 (6%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           MLA  DNILR +NF F VI +GL+  L+ ++  G++SR+N+CMFA A+ IV DS YG+ A
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQS-GNSSRINYCMFAVAYAIVTDSLYGVFA 59

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N F P A+P+ILF LDFLNFVFTFTA       IR HSC N+ YL SN ITQGS +RCRE
Sbjct: 60  NFFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCRE 112

Query: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178
           AQA VAF YF+  IFL K +MS  +++SNGAFGS S FS RRR  Q   VGVPTISQV
Sbjct: 113 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS-FSKRRRTGQ---VGVPTISQV 166

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  200 bits (509), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 129/178 (72%), Gaps = 8/178 (4%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML++ DN LR VNF F VI+LGL G LI ++   H+ RVNF +F AAF +V DSFY + A
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDE-HSPRVNFAIFTAAFALVTDSFYAVFA 59

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N+F  FA+P++L   DFLNFVFTF+AATALAVGIRTHSCTN  YL SN ITQGST RCR+
Sbjct: 60  NLFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRK 119

Query: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178
           AQA VAF YF+FFIFL K+V+S +    N     + G  S  RR   ANVGVPTISQV
Sbjct: 120 AQATVAFLYFSFFIFLTKLVLSVI----NVFSSGAFGSGSGSRR---ANVGVPTISQV 170

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  198 bits (504), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 112/185 (60%), Positives = 132/185 (71%), Gaps = 8/185 (4%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML L DNILR VNFCFFVI LGLVG L+ ++   H+SRVN+C+F   F +V D+FYG LA
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQ-HSSRVNYCIFVPPFALVTDTFYGALA 59

Query: 61  NIF-VPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCR 119
           NI+  P A+P+ILF  DFLNF FTFTA T LAVG RTHSCTN+ YLDSN ITQGST RCR
Sbjct: 60  NIWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCR 119

Query: 120 EAQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSS------GFSSRRRRTQQANVGVP 173
           +AQA  AFFYF+FFIFL K++MS ++L +NGA GS S      G            +GVP
Sbjct: 120 KAQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVP 179

Query: 174 TISQV 178
            ISQV
Sbjct: 180 NISQV 184

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  198 bits (503), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 102/183 (55%), Positives = 136/183 (74%), Gaps = 6/183 (3%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML+  DNILR +N  F V+ +  +  L+ ++++ ++SR+NFCMFAAAFG++ DSF+G+  
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRN-NSSRINFCMFAAAFGLLTDSFFGVAF 59

Query: 61  NIFVPFA-FPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCR 119
           N+F   A +P++LFI DFLNFVFTFTA T LAV IR HSC N  Y++SN ITQGS +RCR
Sbjct: 60  NMFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCR 119

Query: 120 EAQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSR-RRRTQQA---NVGVPTI 175
            +QA VAFFYF+ FIFL KM+MS +++ SNG FGS +   SR +RRT ++    VGVPTI
Sbjct: 120 MSQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTI 179

Query: 176 SQV 178
           SQV
Sbjct: 180 SQV 182

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  197 bits (502), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 103/178 (57%), Positives = 135/178 (75%), Gaps = 4/178 (2%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML++ DNI+R +N  F +I +GLV  LI S+   H+SRVNFCMFAAA+G++ DSFYG LA
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTK-HSSRVNFCMFAAAYGLLTDSFYGCLA 59

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N++    +PVI+F+LDFLNF+FTF A TALAVGIR HSC+N+ YLD+NKITQGS SRC +
Sbjct: 60  NLWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQ 119

Query: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178
           A+A V FFYF+  +FL K+V+S  +++ NG FG  + F  RR R Q   +G+PTISQV
Sbjct: 120 AKAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFGNSFGRRRARRQ---MGIPTISQV 174

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  194 bits (494), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 96/178 (53%), Positives = 124/178 (69%), Gaps = 4/178 (2%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML + DN+LR +N  F VI +GL   L+ ++ H +NSR+N+CMF  A+ +  DS YGI A
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTH-NNSRINYCMFTCAYCLTTDSIYGIFA 59

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N F   A P + F LDFLNF FTF A T LA GIR HSC + HY++SNKITQG  +RCRE
Sbjct: 60  NFFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRE 119

Query: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178
           +QA+VAFFYF+  IFL K++MS ++++ NGAF    G   RRRR   A +GVP+ISQV
Sbjct: 120 SQALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIG---RRRRRNAAEIGVPSISQV 174

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  192 bits (489), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 101/178 (56%), Positives = 128/178 (71%), Gaps = 9/178 (5%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML++ DN LR VNF F +I+LGLVG LI ++ H  +SRVNF +FAA FGIV DS Y ++A
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDH-SSSRVNFAIFAAVFGIVFDSLYALIA 59

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N     A+P+IL  LDFLN+VFTF+AATALAVGIR  SCTN  +   NKI +GS  RCR+
Sbjct: 60  NFISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRK 119

Query: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178
           AQA   F YF+F IFL K ++S ++ +++GAFG+SS      R+TQ   VGVPTISQV
Sbjct: 120 AQASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSS-----NRKTQ---VGVPTISQV 169

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  186 bits (471), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 134/178 (75%), Gaps = 4/178 (2%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML+  DN++R V+  F +I +GL+G L+ ++ +G +SRVNFCMFAAA+G++ DSFYG LA
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNG-SSRVNFCMFAAAYGLITDSFYGFLA 59

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N +    +P IL +LDFLNF+FTF AATALAVGIR HSC N+ YL+ N ITQGS+SRC +
Sbjct: 60  NFWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQ 119

Query: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178
           +QA VAFFYF+ F+FL K+ +S   ++ NG FG ++G+  RR R Q   +GVPTISQV
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQ---MGVPTISQV 174

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  186 bits (471), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 120/183 (65%), Gaps = 6/183 (3%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML + DN+LR +NFCF VI L  +  LI ++K  H SRVN+CMFAAA+GI  D  YG+LA
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKF-HISRVNYCMFAAAYGIATDGLYGLLA 59

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N + P A+P+ILF LDFLNF FT TA   LAVGIR HSC N  Y + N I QGS +RCR 
Sbjct: 60  NFWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRI 119

Query: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSG-----FSSRRRRTQQANVGVPTI 175
           +QA  AFF+F+  IF+ KMVMS ++L SNGAF ++S                   GVP+I
Sbjct: 120 SQAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETSGVPSI 179

Query: 176 SQV 178
           SQV
Sbjct: 180 SQV 182

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  184 bits (467), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 132/178 (74%), Gaps = 7/178 (3%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML++ DN LRA+NF F VI+LGL G L  + K  +N +VNF +F AAFG++ DS Y I A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N     A+P+++ + DFLNFVFTF AATALAV IRTHSCTN+ YLDSN +TQGST RCR+
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178
           AQA VAF YF+FFIFL K+ +S ++L+S GAFG+ S      RRT   NVGVPTISQV
Sbjct: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSS-----RRT--GNVGVPTISQV 171

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  184 bits (466), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 127/178 (71%), Gaps = 4/178 (2%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML+  DN++R +N  F +I +GL+  LI S +  H+SRVNFCMF AA+G+V DS YG LA
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLI-STQAKHSSRVNFCMFTAAYGLVTDSLYGFLA 59

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N +    +P IL  LD LNF+FTF AATALAVGIR HSC N+ YL+ NKITQ S+SRC +
Sbjct: 60  NFWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQ 119

Query: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178
           +QA VAFFYF+ F+FL K+ ++    + NG FG +SGF  RR R Q   +GVPTISQV
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFNSGFGRRRARRQ---LGVPTISQV 174

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  183 bits (464), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 130/183 (71%), Gaps = 6/183 (3%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           MLAL D  LR VNF F VI +GL+  L+ ++ HGH+SR+N+CMF AA+GI  DSFYG++A
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQ-HGHSSRINYCMFTAAYGITTDSFYGVVA 59

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N + P ++P++L  LDFLNFVFT TA   LAVGIR HSC N  Y + NKI QGS +RCR+
Sbjct: 60  NFWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQ 119

Query: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGS--SSGFSSR---RRRTQQANVGVPTI 175
           AQA VAFF+F+  IFL K +MS +++ +NG FGS  SS   SR   R+RTQ    GVP I
Sbjct: 120 AQAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNI 179

Query: 176 SQV 178
           S V
Sbjct: 180 STV 182

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  176 bits (446), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 130/178 (73%), Gaps = 8/178 (4%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML++ DN LRA NF F +I+LGL G L  + +  +N +VNF +FAAAFG++ D+ Y I A
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSL-AATRDNNNPQVNFAVFAAAFGLLFDTLYAIPA 59

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N     A+P+++ + DFLNFVFTF AATALAV IR HSCTN  Y+D+NK+TQGS+ RCR+
Sbjct: 60  NFISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRK 119

Query: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178
           AQA VAF YFAFF+FL K+ +S +++ S GAF +SSG        + ANVGVPTISQV
Sbjct: 120 AQASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTSSG-------RKSANVGVPTISQV 170

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  171 bits (433), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 134/185 (72%), Gaps = 9/185 (4%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML+  DN LR  N  F V+ +  +  L+ ++ HG +SRVN+CMFAAAFG++ DSF+G+ A
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHG-SSRVNYCMFAAAFGLLTDSFFGMAA 59

Query: 61  NIFVPF--AFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRC 118
           N+ + F  ++P+ILF+ DFLNFVFTFTA T LAVGIR HSC NR YL+SNKI QGS  RC
Sbjct: 60  NL-IDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRC 118

Query: 119 REAQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRT-----QQANVGVP 173
           R +QA VAFFYFA F+FL KM+MS +S+ SNGAFGS S  S R+RR+          GVP
Sbjct: 119 RVSQAAVAFFYFAAFVFLAKMIMSAISMASNGAFGSGSFMSRRKRRSGAGVGGTTGGGVP 178

Query: 174 TISQV 178
           TIS+V
Sbjct: 179 TISEV 183

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  165 bits (418), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 99/178 (55%), Positives = 121/178 (67%), Gaps = 3/178 (1%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNS-RVNFCMFAAAFGIVADSFYGIL 59
           MLA+ DN LR VNFCF VI +  + +L+ + + GHNS RVN+CMFA AFGI+ DS YG+ 
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNT-RQGHNSARVNYCMFAVAFGILTDSIYGLF 59

Query: 60  ANIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCR 119
           AN F   A+P+ILF+ DFLNFVF FTA T LAVGIR H+C N  Y +SNKI +GS +RCR
Sbjct: 60  ANFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCR 119

Query: 120 EAQAVVAFFYFAFFIFLFKMVMSFLSLLSNGA-FGSSSGFSSRRRRTQQANVGVPTIS 176
            AQA VAFFYF+  IFL K V S +  +S G     SS     RR+ + A  GVPT S
Sbjct: 120 VAQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSGSSFGFGSRRKRRSAGTGVPTTS 177

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  140 bits (353), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 86/123 (69%), Gaps = 1/123 (0%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML++ DN LRAVNF F +I+LGL G LI  +++ H SRVNF +F A F +V DSFY I+A
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSH-SRVNFGLFTAVFALVTDSFYSIVA 59

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N    FA+P+I   LD LN +FTF AATAL   I  HSC+NR +LD N I++ ST RCR+
Sbjct: 60  NFISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRK 119

Query: 121 AQA 123
            QA
Sbjct: 120 VQA 122

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score =  133 bits (334), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 87/178 (48%), Positives = 112/178 (62%), Gaps = 9/178 (5%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML++ DN LRA NF F +I+L L G LI  +   H SRVNF +F A F ++ DS Y +LA
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSH-SRVNFGLFTAIFALLFDSLYSVLA 59

Query: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N     A+P++L   D LN +FTF AATAL   I  HSC+N  +L  N I++G   RCR+
Sbjct: 60  NFISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRK 119

Query: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178
            QA   F +F+FFIFL K V+S L+++S GAF S SG     R+T     GVPTISQV
Sbjct: 120 VQASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGSG-----RKTGG---GVPTISQV 169

>Kwal_23.4058 s23 complement(551392..552042) [651 bp, 216 aa] {ON}
           YDL218W - Hypothetical ORF [contig 255] FULL
          Length = 216

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 69/145 (47%), Gaps = 19/145 (13%)

Query: 9   LRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGI---VADSFYGILANIFVP 65
           +RA  F F +I LGL  +++     G+         AAA+G+   V  + Y IL  + +P
Sbjct: 32  VRAGQFIFSIITLGLTSRVVD---FGYRDS------AAAYGVAVSVISTLYLILI-VAIP 81

Query: 66  FAFP---VILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCREAQ 122
                  V +FI + +  +  F A  ALA     H   +     S  IT+  +  CR A+
Sbjct: 82  LKLNDCVVAVFISELVMMILWFAAFVALAA---QHGGIDCSTYKSYYITEDWSEPCRAAE 138

Query: 123 AVVAFFYFAFFIFLFKMVMSFLSLL 147
           A +A  +FAF ++ F  V+ +L+++
Sbjct: 139 AAIAMSFFAFLLYDFSSVLFWLNVM 163

>Suva_4.27 Chr4 (54848..55816) [969 bp, 322 aa] {ON} YDL218W (REAL)
          Length = 322

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 69/153 (45%), Gaps = 17/153 (11%)

Query: 8   ILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILANIFVPFA 67
           +LR   F   V+++ L+   I +     N + NF +   A G+++  FY I   I    A
Sbjct: 11  LLRFSQFVSSVLVMSLLAYAIHAYSDRGNKKTNFTL---ATGVIS-VFYLIALGILC-LA 65

Query: 68  FPVILFI-----LDFLNFVFTFTAATALAVGIRTHSCTNR----HYLD--SNKITQGSTS 116
            P +++I      + +  +    A   LA     HSC +R     Y D  S + T  +  
Sbjct: 66  LPTLIYIGMYFCAELIMCMLWLAAFVVLAKAQGQHSCKSRNSSGEYYDPYSGQYTTTNHR 125

Query: 117 R-CREAQAVVAFFYFAFFIFLFKMVMSFLSLLS 148
           R C  +QA +AF    F +FL  +V+  +++L+
Sbjct: 126 RACNSSQAAIAFAGLCFLLFLTSVVLLGVNILT 158

>Kpol_530.47 s530 complement(108566..108973) [408 bp, 135 aa] {ON}
           complement(108566..108973) [408 nt, 136 aa]
          Length = 135

 Score = 32.7 bits (73), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 26/40 (65%)

Query: 105 LDSNKITQGSTSRCREAQAVVAFFYFAFFIFLFKMVMSFL 144
           LD+ +I +  +   RE+   +AF+   FF++L+KM+MS +
Sbjct: 93  LDATEIFRTLSKHKRESFLKLAFYLLMFFVYLYKMIMSLI 132

>KNAG0L02330 Chr12 complement(413866..414783) [918 bp, 305 aa] {ON}
           Anc_2.61 YDL218W
          Length = 305

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 66/143 (46%), Gaps = 14/143 (9%)

Query: 8   ILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILANIFVPFA 67
           ILR + FC  V+++ L+   + S     + R NFC+     G    +FY I+  I + + 
Sbjct: 38  ILRFLQFCSAVLVMSLLAYSLNSYNFFGSKRANFCLSVGVIG----TFY-IMCVIVLVWL 92

Query: 68  FPVILFILDFL--NFVFTFTAATALAVGIR---THSCTNRHY-LDS--NKITQGSTSR-C 118
            P ++ +  +L    V          V  +   +HSC++  +  D    +IT  S  R C
Sbjct: 93  MPKVVLVGPYLIMEIVICLLWLCGFIVSAKVFGSHSCSSNGFSYDPFVGRITDHSHKRAC 152

Query: 119 REAQAVVAFFYFAFFIFLFKMVM 141
           + A++ +AF  F+F + +   ++
Sbjct: 153 QAAKSSIAFSGFSFVLGVITSIL 175

>Smik_4.21 Chr4 (44522..45472) [951 bp, 316 aa] {ON} YDL218W (REAL)
          Length = 316

 Score = 32.3 bits (72), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 69/153 (45%), Gaps = 17/153 (11%)

Query: 8   ILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILANIFVPFA 67
           +LR   F   V+++ L+   I +     N + NF +   A G+++  FY I   I    A
Sbjct: 11  LLRFSQFASSVLVMSLLAYAIHAYGDRGNKKTNFTL---ATGVIS-VFYLIALGILC-LA 65

Query: 68  FPVILFI-----LDFLNFVFTFTAATALAVGIRTHSC--TNRHYL----DSNKITQGSTS 116
            P +++I      + +  +    A   LA     HSC  TN + L     S + T  S  
Sbjct: 66  LPTLIYIGMYFCAELIVCMLWLAAFVVLAKAQGEHSCGSTNANGLYYNPYSGQYTANSHR 125

Query: 117 R-CREAQAVVAFFYFAFFIFLFKMVMSFLSLLS 148
           R C  +QA +AF    F +FL  +++  +++L+
Sbjct: 126 RACNSSQAAIAFSGLCFLLFLTSVILLGINVLT 158

>YDL218W Chr4 (66493..67446) [954 bp, 317 aa] {ON} Putative protein
           of unknown function; YDL218W transcription is regulated
           by Azf1p and induced by starvation and aerobic
           conditions; expression also induced in cells treated
           with the mycotoxin patulin
          Length = 317

 Score = 32.3 bits (72), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 70/153 (45%), Gaps = 17/153 (11%)

Query: 8   ILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILANIFVPFA 67
           +LR   F   V+++ L+   I +  +  N + NF +   A G+++  FY I   I    A
Sbjct: 11  LLRFSQFASSVLVMSLLAYAIHAYGNRGNKKTNFTL---ATGVIS-VFYLIALGILC-LA 65

Query: 68  FPVILFI-----LDFLNFVFTFTAATALAVGIRTHSCTNRH----YLD--SNKITQGSTS 116
            P +++I      + +  +    A   LA      SC+N +    Y +  S + T  S  
Sbjct: 66  LPTLIYIGMYFCAELIVCMLWLAAFVVLAKAQGERSCSNTNADGLYYNPYSGQYTADSHR 125

Query: 117 R-CREAQAVVAFFYFAFFIFLFKMVMSFLSLLS 148
           R C  +QA +AF    F +FL  +++  +++L+
Sbjct: 126 RACNSSQAAIAFSGLCFVLFLISVILLGINVLT 158

>SAKL0D00110g Chr4 (1481..3169) [1689 bp, 562 aa] {ON} some
           similarities with uniprot|Q07629 Saccharomyces
           cerevisiae YDL218W
          Length = 562

 Score = 30.8 bits (68), Expect = 2.0,   Method: Composition-based stats.
 Identities = 34/155 (21%), Positives = 67/155 (43%), Gaps = 10/155 (6%)

Query: 8   ILRAVNFCFFVILLGLVGKLIQSEKHGHN-SRVNFCMFAAAFGIVADSFYGILANIFVPF 66
           +LR V F   +  LG++  +   + + ++ + ++F + A+A  ++   +   +  + VP 
Sbjct: 257 VLRVVQFMPAIAALGMLAYVAHDKGYSYDEASIHFGLAASAISLL---YLLAIVMVRVPA 313

Query: 67  AF-PVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYL-DSNKITQGSTSR--CREAQ 122
           +   V + + +         A   LAV     +C N +Y+ D          R  C+  Q
Sbjct: 314 SINAVAVLVFEVAMSTIWLAALITLAVSTGRENCKNAYYISDRQDFYWNYDWRVNCKAGQ 373

Query: 123 AVVAFFYFAFFIFLFKMVMSFLSLLS--NGAFGSS 155
           A      FAF +F    V+  L+++S     FGS+
Sbjct: 374 ASAGMAGFAFVLFACSSVLCELNVISPIRAVFGST 408

>TBLA0B00670 Chr2 (141759..142607) [849 bp, 282 aa] {ON} Anc_2.61
           YDL218W
          Length = 282

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 47/113 (41%), Gaps = 3/113 (2%)

Query: 9   LRAVNFCFFVILLGLVGKLIQSEKHGHNS-RVNFCMFAAAFGIVADSFYGILANIFVPFA 67
           LR   FC  V+++ L+   + SE H H S R NF +   A G     F  +L  I     
Sbjct: 13  LRFWEFCSSVLVMSLLAAAM-SESHFHGSKRFNFSLAQGAIGTCYSLFVILLPPIVPGLV 71

Query: 68  FPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           F    F  + +  +        +A  +  HSC N+ +  +     GS +R +E
Sbjct: 72  FAGFYFCWEVIMNLLWLCCFIVVAKVVGEHSCHNK-FTKTYNPKYGSQTRYQE 123

>SAKL0F16764g Chr6 (1384018..1384872) [855 bp, 284 aa] {ON} some
           similarities with uniprot|Q7LGR3 Saccharomyces
           cerevisiae YDL218W Putative protein of unknown function
          Length = 284

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 70/155 (45%), Gaps = 10/155 (6%)

Query: 8   ILRAVNFCFFVILLGLVGKLIQSEKHGHNS-RVNFCMFAAAFGIVADSFYGILANIFVPF 66
           +LR V F   +  LGL+  + Q   + +    ++F + A+A  ++   +  ++  + VP 
Sbjct: 49  VLRVVQFMPVITALGLLACVTQDTGYLYGEVSIHFGLAASAISLL---YLLVIIMVRVPA 105

Query: 67  AFPVILFILDFLNF-VFTFTAATALAVGIRTHSCTNRHYLDSNK---ITQGSTSRCREAQ 122
               ++ ++  +   +   TA   L V     +C   HY  S++    +    S CR  Q
Sbjct: 106 NISAVVVLVFEVVMAIMWLTALIVLGVDTGRANCKWAHYTYSSEYFYWSYDWRSPCRAGQ 165

Query: 123 AVVAFFYFAFFIFLFKMVMSFLSLLS--NGAFGSS 155
           A +    FAF +F    V+  L+++S    AFGS+
Sbjct: 166 ASIGMAGFAFVLFACSSVVCGLNVISPIRAAFGST 200

>Skud_4.35 Chr4 (62864..63817) [954 bp, 317 aa] {ON} YDL218W (REAL)
          Length = 317

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 70/153 (45%), Gaps = 17/153 (11%)

Query: 8   ILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILANIFVPFA 67
           ILR + F   V+++ L+   I +  +  N + NF +   A G+++  FY I   I    A
Sbjct: 11  ILRFLQFASSVLVMSLLAYAIHAYGNRGNKKTNFTL---ATGVIS-VFYLIALGILC-LA 65

Query: 68  FPVILFILDF----LNFVFTFTAA---TALAVGIRTHSCTNRHYLDSNKITQGSTSR--- 117
            P +++I  +    L     + AA    A A G R+   TN   L  N  +   T+    
Sbjct: 66  LPTLIYIGMYFCAELIMCMLWLAAFVVLAKAQGERSCGNTNAQGLYYNPYSGEYTADRHR 125

Query: 118 --CREAQAVVAFFYFAFFIFLFKMVMSFLSLLS 148
             C  +QA +AF    F +FL  +++  +++L+
Sbjct: 126 RACNASQAAIAFSGLCFVLFLTSVILLGVNVLT 158

>Kwal_14.1862 s14 complement(499199..499606) [408 bp, 135 aa] {ON}
           YGL054C (ERV14) - 14 KDa protein found on ER-derived
           vesicles [contig 235] FULL
          Length = 135

 Score = 28.9 bits (63), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 28/51 (54%), Gaps = 5/51 (9%)

Query: 100 TNRHY-----LDSNKITQGSTSRCREAQAVVAFFYFAFFIFLFKMVMSFLS 145
            N+HY     LD+ +I +      +E+   + F+   FF +L++M+M+ ++
Sbjct: 82  VNKHYKKLQLLDATEIFRTLGKHKKESFLKLGFYLLMFFFYLYRMIMALIA 132

>KLTH0H06886g Chr8 complement(605628..606035) [408 bp, 135 aa] {ON}
           similar to uniprot|P53173 Saccharomyces cerevisiae
           YGL054C ERV14 Protein localized to COPII-coated vesicles
           involved in vesicle formation and incorporation of
           specific secretory cargo required for the delivery of
           bud- site selection protein Axl2p to cell surface
           related to Drosophila cornichon
          Length = 135

 Score = 28.9 bits (63), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 28/50 (56%), Gaps = 5/50 (10%)

Query: 101 NRHY-----LDSNKITQGSTSRCREAQAVVAFFYFAFFIFLFKMVMSFLS 145
           N+HY     LD+ +I +      +E+   + F+   FF +L++M+M+ ++
Sbjct: 83  NKHYKKMQLLDATEIFRTLGKHKKESFLKLGFYLLMFFFYLYRMIMALIA 132

>Ecym_3084 Chr3 complement(157797..158204) [408 bp, 135 aa] {ON}
           similar to Ashbya gossypii AAR149W
          Length = 135

 Score = 28.5 bits (62), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 67  AFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCREAQAVVA 126
           AF  +LF+L+   FVF          G + ++      LD+ +I +      RE+   + 
Sbjct: 56  AFNSLLFLLNGYWFVFLLNVPVLFFNGRKIYN--KLQLLDATEIFRTLGKHKRESFLKLG 113

Query: 127 FFYFAFFIFLFKMVMSFLS 145
           F+   FF +L+++VM  ++
Sbjct: 114 FYLVMFFFYLYRLVMELIA 132

>KLTH0B07326g Chr2 complement(591369..592292) [924 bp, 307 aa] {ON}
           weakly similar to uniprot|Q7LGR3 Saccharomyces
           cerevisiae YDL218W
          Length = 307

 Score = 28.9 bits (63), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 63/161 (39%), Gaps = 22/161 (13%)

Query: 9   LRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGI-------VADSFYGILAN 61
           LRA+ F   VI LGL+  +++   +  + + NF +  AA  +       +       L  
Sbjct: 5   LRALQFISSVIALGLLAYVLKGYSYHGSHKTNFGLAVAAISVFYLMLLSLLGVLLHKLLL 64

Query: 62  IFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHY---------------LD 106
             +   F +I+ IL    FV       + A G++T S  N +Y                 
Sbjct: 65  PGLYLLFEIIITILWLCAFVVLAKTHGSRACGLQTTSTYNPNYGSTSSFMSSGGRYDPYT 124

Query: 107 SNKITQGSTSRCREAQAVVAFFYFAFFIFLFKMVMSFLSLL 147
           S   T      CR A+A +AF      +F+   ++  L+++
Sbjct: 125 SQYTTDSHMRPCRSAKASIAFAGLCTVLFMISTLIIGLNVI 165

>TDEL0G03690 Chr7 complement(679342..679755) [414 bp, 137 aa] {ON}
           Anc_6.102 YBR210W
          Length = 137

 Score = 28.5 bits (62), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 24/41 (58%)

Query: 105 LDSNKITQGSTSRCREAQAVVAFFYFAFFIFLFKMVMSFLS 145
           LD+ +I +      RE+   + F+   FF +L++M+M+ +S
Sbjct: 92  LDATEIFRTLGKHKRESFLKLGFYLLMFFFYLYRMIMALIS 132

>ZYRO0C05126g Chr3 complement(401542..401967) [426 bp, 141 aa] {ON}
           highly similar to uniprot|P53173 Saccharomyces
           cerevisiae YGL054C ERV14 Protein localized to
           COPII-coated vesicles involved in vesicle formation and
           incorporation of specific secretory cargo required for
           the delivery of bud-site selection protein Axl2p to cell
           surface related to Drosophila cornichon
          Length = 141

 Score = 28.1 bits (61), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 25/41 (60%)

Query: 105 LDSNKITQGSTSRCREAQAVVAFFYFAFFIFLFKMVMSFLS 145
           LD+ +I +      RE+   +AF+   FF +L++M+M+ ++
Sbjct: 93  LDATEIFRTLGKHKRESFLKLAFYLLMFFFYLYRMIMALIA 133

>Kpol_478.19 s478 complement(64243..64656) [414 bp, 137 aa] {ON}
           complement(64243..64656) [414 nt, 138 aa]
          Length = 137

 Score = 28.1 bits (61), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 24/40 (60%)

Query: 105 LDSNKITQGSTSRCREAQAVVAFFYFAFFIFLFKMVMSFL 144
           LD+ +I +    R RE+   +AF+   FF +L++M+ + +
Sbjct: 93  LDATEIFRSLGKRKRESFLKLAFYLLMFFYYLYRMIAALI 132

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.334    0.142    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,417,897
Number of extensions: 537590
Number of successful extensions: 3027
Number of sequences better than 10.0: 68
Number of HSP's gapped: 2984
Number of HSP's successfully gapped: 69
Length of query: 178
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 76
Effective length of database: 41,785,467
Effective search space: 3175695492
Effective search space used: 3175695492
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 62 (28.5 bits)