Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D09966g3.493ON1781785931e-78
TDEL0D056103.493ON1751784272e-53
Kpol_1017.63.493ON1871783823e-46
TBLA0C044903.493ON1861203613e-43
TPHA0D032803.493ON1841423536e-42
YPR149W (NCE102)3.493ON1731783456e-41
Skud_16.4443.493ON1731783449e-41
CAGL0L08448g3.493ON1731783422e-40
SAKL0F02750g3.493ON1701783404e-40
Smik_16.4023.493ON1731783342e-39
Suva_7.4193.493ON1741783334e-39
TBLA0D029603.493ON1891213344e-39
CAGL0I10494g3.493ON1721793282e-38
KAFR0C019703.493ON1791793196e-37
NDAI0G009303.493ON1761783152e-36
Suva_16.4783.493ON1661783125e-36
KNAG0B008003.493ON1821413041e-34
KNAG0A079503.493ON1821193032e-34
Skud_7.4423.493ON1741782988e-34
KLTH0F14850g3.493ON1711782979e-34
Smik_6.2273.493ON1741782961e-33
YGR131W (FHN1)3.493ON1741202935e-33
KLLA0D16280g3.493ON1691782892e-32
KAFR0G037003.493ON1861202892e-32
NCAS0E008003.493ON1741782856e-32
AFR312W3.493ON1681202831e-31
NDAI0B058803.493ON1821832832e-31
Kwal_55.212383.493ON1701782812e-31
NCAS0F035603.493ON1831212711e-29
Ecym_12363.493ON1691782282e-23
TBLA0B006702.61ON282113663.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D09966g
         (178 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   233   1e-78
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   169   2e-53
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   151   3e-46
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   143   3e-43
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   140   6e-42
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   137   6e-41
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   137   9e-41
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   136   2e-40
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   135   4e-40
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   133   2e-39
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   132   4e-39
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   133   4e-39
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   130   2e-38
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   127   6e-37
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   125   2e-36
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   124   5e-36
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   121   1e-34
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   121   2e-34
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   119   8e-34
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   119   9e-34
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   118   1e-33
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   117   5e-33
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   115   2e-32
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   115   2e-32
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   114   6e-32
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   113   1e-31
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   113   2e-31
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   112   2e-31
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   108   1e-29
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...    92   2e-23
TBLA0B00670 Chr2 (141759..142607) [849 bp, 282 aa] {ON} Anc_2.61...    30   3.0  

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  233 bits (593), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 123/178 (69%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           NIFVPFAFPVILFILD                GIRTHSCTNRHYLDSNKITQGSTSRCRE
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 121 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 178
                            KMVM                      RTQQANVGVPTISQV
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  169 bits (427), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 103/178 (57%), Gaps = 3/178 (1%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           MLA+ DN LR VNF F VILLGLVG+LI SE  GH+SRVNFCMFAAAFGIV DSFYGILA
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSED-GHSSRVNFCMFAAAFGIVTDSFYGILA 59

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           NI+  FA+PVILF LD                GIRTHSC N+ YLDSN ITQGST RCR 
Sbjct: 60  NIWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRL 119

Query: 121 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 178
                            KM+M                      R + A VGVPTISQV
Sbjct: 120 AQASVAFFYFSFFIFLAKMIM--SLIGIITNGPFSSRTTLTSRRRKSAQVGVPTISQV 175

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  151 bits (382), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 81/178 (45%), Positives = 100/178 (56%), Gaps = 3/178 (1%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML+L DNI+RA+NFCFFVI +GL+G L+ +EK GH+SRVN+CMF   F +V DSFYGILA
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEK-GHSSRVNYCMFVPPFAVVTDSFYGILA 59

Query: 61  NIFV-PFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCR 119
           NI+  PFA+P+ILF  D                GIRTHSC NR+Y+D+NKI QGST RCR
Sbjct: 60  NIWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCR 119

Query: 120 EXXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQ 177
           +                 K+VM                      R   AN+GVP  S 
Sbjct: 120 KAQASIAFFYFSFFIFFVKVVM-SAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASS 176

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  143 bits (361), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 67/120 (55%), Positives = 83/120 (69%), Gaps = 1/120 (0%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML+ T N+LR +NFCF VI+ G++GKLI+SEK  H+ RVN+CMFAA F +V DSFY I A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 61  NIF-VPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCR 119
           N +  PFA+P++L+  D                GIRTHSC N+HYL SNKITQGST RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  140 bits (353), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 85/142 (59%), Gaps = 2/142 (1%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML L DNILR VNFCFFVI LGLVG L+ ++   H+SRVN+C+F   F +V D+FYG LA
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQ-HSSRVNYCIFVPPFALVTDTFYGALA 59

Query: 61  NIF-VPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCR 119
           NI+  P A+P+ILF  D                G RTHSCTN+ YLDSN ITQGST RCR
Sbjct: 60  NIWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCR 119

Query: 120 EXXXXXXXXXXXXXXXXXKMVM 141
           +                 K++M
Sbjct: 120 KAQAATAFFYFSFFIFLAKLIM 141

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  137 bits (345), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 93/178 (52%), Gaps = 5/178 (2%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           MLAL DNILR +NF F VI +GL+  L+ ++ H H+SRVN+CMFA A+GI  DS YG+ A
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQ-HRHSSRVNYCMFACAYGIFTDSLYGVFA 59

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N   P A+P++LF LD                GIR HSC N  Y+DSNKITQGS +RCR+
Sbjct: 60  NFIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119

Query: 121 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 178
                            K +M                      R +   VGVPTISQV
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLM----SVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  137 bits (344), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 94/178 (52%), Gaps = 5/178 (2%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           MLA  DNILR +NF F VI++GL+  L+ ++   ++SRVNFCMFAAA+GI  DS YG+ A
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDR-NSSRVNFCMFAAAYGIFTDSLYGVFA 59

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N F P A+P++LF LD                GIR HSC NR Y+DSN ITQGS +RCR+
Sbjct: 60  NFFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQ 119

Query: 121 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 178
                            K +M                      R +   VGVPTISQV
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLM----SVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  136 bits (342), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 76/178 (42%), Positives = 92/178 (51%), Gaps = 5/178 (2%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           MLA+TDN+LR VNF F VI +GL+  LI +    H+SRVN+CMFAAA+GI  DS YG+ A
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDR-HSSRVNYCMFAAAYGIATDSLYGVFA 59

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N F   A+P+ILF LD                GIR HSC N HY ++NKI QGS  RCRE
Sbjct: 60  NFFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRE 119

Query: 121 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 178
                            KM+M                      R   A VGVP++SQV
Sbjct: 120 SQAAVAFFFFSMAIFLAKMIM----SLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  135 bits (340), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 94/178 (52%), Gaps = 8/178 (4%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML++ DN LR VNF F VI+LGL G LI ++   H+ RVNF +F AAF +V DSFY + A
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDE-HSPRVNFAIFTAAFALVTDSFYAVFA 59

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N+F  FA+P++L   D                GIRTHSCTN  YL SN ITQGST RCR+
Sbjct: 60  NLFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRK 119

Query: 121 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 178
                            K+V+                       +++ANVGVPTISQV
Sbjct: 120 AQATVAFLYFSFFIFLTKLVL-------SVINVFSSGAFGSGSGSRRANVGVPTISQV 170

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  133 bits (334), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 91/178 (51%), Gaps = 5/178 (2%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           MLAL DNILR +NF F VI + L+  L+ ++   H+SRVN+CMFA A+GI  DS YG+ A
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDK-HSSRVNYCMFACAYGIFTDSLYGVFA 59

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N   P A+P++LF LD                GIR HSC N  Y+DSNKITQGS +RCR+
Sbjct: 60  NFIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119

Query: 121 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 178
                            K +M                      R +   VGVPTISQV
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLM----SIFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  132 bits (333), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 97/178 (54%), Gaps = 4/178 (2%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML++ DNI+R +N  F +I +GLV  LI S+   H+SRVNFCMFAAA+G++ DSFYG LA
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTK-HSSRVNFCMFAAAYGLLTDSFYGCLA 59

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N++    +PVI+F+LD                GIR HSC+N+ YLD+NKITQGS SRC +
Sbjct: 60  NLWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQ 119

Query: 121 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 178
                            K+V+                      R Q   +G+PTISQV
Sbjct: 120 AKAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFGNSFGRRRARRQ---MGIPTISQV 174

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  133 bits (334), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 77/121 (63%), Gaps = 1/121 (0%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML L DN+ R  NFCFFVI  G++G L+ +E   H+SRVN+CMF  A+G+V+DSFYGILA
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 61  NIFV-PFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCR 119
           N+   PFAFP ILF  D                GIRTHSCTN+ Y   N I QGS  RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 120 E 120
           E
Sbjct: 121 E 121

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  130 bits (328), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 91/179 (50%), Gaps = 8/179 (4%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML++ DN+LR VN  F +I +GL   LI + K  H+SRVNFC+FAAA+GI  DS YGI A
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKR-HSSRVNFCLFAAAYGIATDSLYGIFA 59

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLD-SNKITQGSTSRCR 119
           N F P A+P++LF+LD                GIR HSC N+ YL+   KI QGS +RCR
Sbjct: 60  NFFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 119

Query: 120 EXXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 178
           +                 KM+M                      R     VGVP+ISQV
Sbjct: 120 QAQALVAFFYFSMAIFLAKMIM------SIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 172

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  127 bits (319), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 71/179 (39%), Positives = 87/179 (48%), Gaps = 1/179 (0%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML + DNILR +N  F +I + L   LI ++   HNSRVN+CMFA AFG+  DS YGI A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N F   A+P++LF LD                GIR HSC N+ YLDSNKI +GS  RCRE
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 121 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANV-GVPTISQV 178
                            KM+M                      +    +V GVP ISQV
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRFISRRKKHATDVGGVPNISQV 179

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  125 bits (315), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 71/178 (39%), Positives = 92/178 (51%), Gaps = 2/178 (1%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML++ DN+LR +N  F VI +GL   L+ +++ GHNSR+N+CMF   + ++ DSF+GILA
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQ-GHNSRINYCMFTCVYCLLTDSFFGILA 59

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N F   +FP ILF LD                GIR+HSC N+ YLD NKITQGS +RCRE
Sbjct: 60  NFFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119

Query: 121 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 178
                            K+ M                      R   A VGVP+ISQV
Sbjct: 120 SQALVAFFYFSMFIFLIKLAM-STISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  124 bits (312), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 91/178 (51%), Gaps = 12/178 (6%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           MLA  DNILR +NF F VI +GL+  L+ ++  G++SR+N+CMFA A+ IV DS YG+ A
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQS-GNSSRINYCMFAVAYAIVTDSLYGVFA 59

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N F P A+P+ILF LD                 IR HSC N+ YL SN ITQGS +RCRE
Sbjct: 60  NFFEPLAWPLILFSLD-------FLNFVFTFTAIRAHSCRNQTYLASNSITQGSGNRCRE 112

Query: 121 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 178
                            K +M                      R +   VGVPTISQV
Sbjct: 113 AQAAVAFLYFSCAIFLAKTLM----SVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  121 bits (304), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 63/141 (44%), Positives = 77/141 (54%), Gaps = 1/141 (0%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML + DN+LR +NFCF VI L  +  LI ++K  H SRVN+CMFAAA+GI  D  YG+LA
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKF-HISRVNYCMFAAAYGIATDGLYGLLA 59

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N + P A+P+ILF LD                GIR HSC N  Y + N I QGS +RCR 
Sbjct: 60  NFWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRI 119

Query: 121 XXXXXXXXXXXXXXXXXKMVM 141
                            KMVM
Sbjct: 120 SQAATAFFFFSMGIFIAKMVM 140

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  121 bits (303), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 58/119 (48%), Positives = 76/119 (63%), Gaps = 1/119 (0%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           MLAL D  LR VNF F VI +GL+  L+ ++ HGH+SR+N+CMF AA+GI  DSFYG++A
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQ-HGHSSRINYCMFTAAYGITTDSFYGVVA 59

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCR 119
           N + P ++P++L  LD                GIR HSC N  Y + NKI QGS +RCR
Sbjct: 60  NFWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCR 118

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  119 bits (298), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 67/178 (37%), Positives = 92/178 (51%), Gaps = 4/178 (2%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML+  DN++R V+  F +I +GL+G L+ ++ +G +SRVNFCMFAAA+G++ DSFYG LA
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNG-SSRVNFCMFAAAYGLITDSFYGFLA 59

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N +    +P IL +LD                GIR HSC N+ YL+ N ITQGS+SRC +
Sbjct: 60  NFWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQ 119

Query: 121 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 178
                            K+ +                      R Q   +GVPTISQV
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQ---MGVPTISQV 174

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  119 bits (297), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 89/178 (50%), Gaps = 7/178 (3%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML++ DN LRA+NF F VI+LGL G L  + K  +N +VNF +F AAFG++ DS Y I A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N     A+P+++ + D                 IRTHSCTN+ YLDSN +TQGST RCR+
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 121 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 178
                            K+ +                        +  NVGVPTISQV
Sbjct: 121 AQASVAFLYFSFFIFLAKLGL-------SLVNLISVGAFGAGSSRRTGNVGVPTISQV 171

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  118 bits (296), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 87/178 (48%), Gaps = 4/178 (2%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML+  DN++R +N  F +I +GL+  LI ++   H+SRVNFCMF AA+G+V DS YG LA
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAK-HSSRVNFCMFTAAYGLVTDSLYGFLA 59

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N +    +P IL  LD                GIR HSC N+ YL+ NKITQ S+SRC +
Sbjct: 60  NFWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQ 119

Query: 121 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 178
                            K+ +                      R Q   +GVPTISQV
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFNSGFGRRRARRQ---LGVPTISQV 174

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  117 bits (293), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 55/120 (45%), Positives = 74/120 (61%), Gaps = 1/120 (0%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML+  DN++R +N  F +I +GL+  LI ++   H+SRVNFCMFAA +G+V DS YG LA
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTK-HSSRVNFCMFAAVYGLVTDSLYGFLA 59

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N +    +P IL +LD                GIR HSC N+ YL+ NKI QGS+SRC +
Sbjct: 60  NFWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQ 119

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  115 bits (289), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/178 (37%), Positives = 86/178 (48%), Gaps = 9/178 (5%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML++ DN LR VNF F +I+LGLVG LI ++ H  +SRVNF +FAA FGIV DS Y ++A
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDH-SSSRVNFAIFAAVFGIVFDSLYALIA 59

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N     A+P+IL  LD                GIR  SCTN  +   NKI +GS  RCR+
Sbjct: 60  NFISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRK 119

Query: 121 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 178
                            K ++                        ++  VGVPTISQV
Sbjct: 120 AQASTVFLYFSFAIFLVKFIL--------SIVNAITSGAFGTSSNRKTQVGVPTISQV 169

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  115 bits (289), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 76/120 (63%), Gaps = 2/120 (1%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNS-RVNFCMFAAAFGIVADSFYGIL 59
           MLA+ DN LR VNFCF VI +  + +L+ + + GHNS RVN+CMFA AFGI+ DS YG+ 
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNT-RQGHNSARVNYCMFAVAFGILTDSIYGLF 59

Query: 60  ANIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCR 119
           AN F   A+P+ILF+ D                GIR H+C N  Y +SNKI +GS +RCR
Sbjct: 60  ANFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCR 119

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  114 bits (285), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 65/178 (36%), Positives = 86/178 (48%), Gaps = 4/178 (2%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML + DN+LR +N  F VI +GL   L+ ++ H +NSR+N+CMF  A+ +  DS YGI A
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTH-NNSRINYCMFTCAYCLTTDSIYGIFA 59

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N F   A P + F LD                GIR HSC + HY++SNKITQG  +RCRE
Sbjct: 60  NFFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRE 119

Query: 121 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 178
                            K++M                      R   A +GVP+ISQV
Sbjct: 120 SQALVAFFYFSMAIFLAKLIM---STINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  113 bits (283), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 56/120 (46%), Positives = 73/120 (60%), Gaps = 1/120 (0%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML++ DN LRAVNF F +I+LGL G LI  +++ H SRVNF +F A F +V DSFY I+A
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSH-SRVNFGLFTAVFALVTDSFYSIVA 59

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N    FA+P+I   LD                 I  HSC+NR +LD N I++ ST RCR+
Sbjct: 60  NFISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRK 119

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  113 bits (283), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/183 (35%), Positives = 91/183 (49%), Gaps = 6/183 (3%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML+  DNILR +N  F V+ +  +  L+ ++++ ++SR+NFCMFAAAFG++ DSF+G+  
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRN-NSSRINFCMFAAAFGLLTDSFFGVAF 59

Query: 61  NIFVPFA-FPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCR 119
           N+F   A +P++LFI D                 IR HSC N  Y++SN ITQGS +RCR
Sbjct: 60  NMFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCR 119

Query: 120 EXXXXXXXXXXXXXXXXXKMVMXXXXXXXX----XXXXXXXXXXXXXXRTQQANVGVPTI 175
                             KM+M                          R+    VGVPTI
Sbjct: 120 MSQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTI 179

Query: 176 SQV 178
           SQV
Sbjct: 180 SQV 182

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  112 bits (281), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 64/178 (35%), Positives = 89/178 (50%), Gaps = 8/178 (4%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML++ DN LRA NF F +I+LGL G L  + +  +N +VNF +FAAAFG++ D+ Y I A
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSL-AATRDNNNPQVNFAVFAAAFGLLFDTLYAIPA 59

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N     A+P+++ + D                 IR HSCTN  Y+D+NK+TQGS+ RCR+
Sbjct: 60  NFISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRK 119

Query: 121 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 178
                            K+ +                        + ANVGVPTISQV
Sbjct: 120 AQASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTSSG-------RKSANVGVPTISQV 170

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  108 bits (271), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 76/121 (62%), Gaps = 4/121 (3%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML+  DN LR  N  F V+ +  +  L+ ++ HG +SRVN+CMFAAAFG++ DSF+G+ A
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHG-SSRVNYCMFAAAFGLLTDSFFGMAA 59

Query: 61  NIFVPF--AFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRC 118
           N+ + F  ++P+ILF+ D                GIR HSC NR YL+SNKI QGS  RC
Sbjct: 60  NL-IDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRC 118

Query: 119 R 119
           R
Sbjct: 119 R 119

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score = 92.4 bits (228), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 77/178 (43%), Gaps = 9/178 (5%)

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60
           ML++ DN LRA NF F +I+L L G LI  +   H SRVNF +F A F ++ DS Y +LA
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSH-SRVNFGLFTAIFALLFDSLYSVLA 59

Query: 61  NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           N     A+P++L   D                 I  HSC+N  +L  N I++G   RCR+
Sbjct: 60  NFISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRK 119

Query: 121 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 178
                            K V+                        ++   GVPTISQV
Sbjct: 120 VQASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGSG--------RKTGGGVPTISQV 169

>TBLA0B00670 Chr2 (141759..142607) [849 bp, 282 aa] {ON} Anc_2.61
           YDL218W
          Length = 282

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 43/113 (38%), Gaps = 3/113 (2%)

Query: 9   LRAVNFCFFVILLGLVGKLIQSEKHGHNS-RVNFCMFAAAFGIVADSFYGILANIFVPFA 67
           LR   FC  V+++ L+   + SE H H S R NF +   A G     F  +L  I     
Sbjct: 13  LRFWEFCSSVLVMSLLAAAM-SESHFHGSKRFNFSLAQGAIGTCYSLFVILLPPIVPGLV 71

Query: 68  FPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 120
           F    F  +                 +  HSC N+ +  +     GS +R +E
Sbjct: 72  FAGFYFCWEVIMNLLWLCCFIVVAKVVGEHSCHNK-FTKTYNPKYGSQTRYQE 123

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.331    0.142    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,609,710
Number of extensions: 275012
Number of successful extensions: 763
Number of sequences better than 10.0: 34
Number of HSP's gapped: 690
Number of HSP's successfully gapped: 34
Length of query: 178
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 76
Effective length of database: 41,785,467
Effective search space: 3175695492
Effective search space used: 3175695492
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 62 (28.5 bits)