Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D09944gsingletonON1111114891e-64
Skud_4.6665.480ON33652623.9
Smik_4.6665.480ON33656605.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D09944g
         (111 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D09944g Chr4 complement(840971..841306) [336 bp, 111 aa] {O...   192   1e-64
Skud_4.666 Chr4 (1180611..1181621) [1011 bp, 336 aa] {ON} YDR392...    28   3.9  
Smik_4.666 Chr4 (1179502..1180512) [1011 bp, 336 aa] {ON} YDR392...    28   5.6  

>ZYRO0D09944g Chr4 complement(840971..841306) [336 bp, 111 aa] {ON}
           no similarity
          Length = 111

 Score =  192 bits (489), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 97/111 (87%)

Query: 1   MVLESKAVSKKSQESIAEKGNGELRGNLKERPRVTYSGPGVVYPLEIPHMEICHRLKLWI 60
           MVLESKAVSKKSQESIAEKGNGELRGNLKERPRVTYSGPGVVYPLEIPHMEICHRLKLWI
Sbjct: 1   MVLESKAVSKKSQESIAEKGNGELRGNLKERPRVTYSGPGVVYPLEIPHMEICHRLKLWI 60

Query: 61  PLIRKHVNRLAFAVCEISGRXXXXXXXXXXXXXXHRRCTFRILVSCPIGAI 111
           PLIRKHVNRLAFAVCEISGR              HRRCTFRILVSCPIGAI
Sbjct: 61  PLIRKHVNRLAFAVCEISGRFSFPSYYCYSFCSFHRRCTFRILVSCPIGAI 111

>Skud_4.666 Chr4 (1180611..1181621) [1011 bp, 336 aa] {ON} YDR392W
           (REAL)
          Length = 336

 Score = 28.5 bits (62), Expect = 3.9,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 6   KAVSKKSQESIAEKGNGELRGNLKERPRVTYSGP-GVVYPLEIPHMEICHRL 56
           +A   KSQ+S  +  N E   +   R +  + GP  VV PL+  H+E   R+
Sbjct: 259 RAQKDKSQQSNQDNSNFEFTSSTLHRKKRLFDGPENVVNPLKPKHIEEAWRV 310

>Smik_4.666 Chr4 (1179502..1180512) [1011 bp, 336 aa] {ON} YDR392W
           (REAL)
          Length = 336

 Score = 27.7 bits (60), Expect = 5.6,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 2   VLESKAVSKKSQESIAEKGNGELRGNLKERPRVTYSGP-GVVYPLEIPHMEICHRL 56
           VL+S+    KSQ+S  +  N E   +   R +  + GP  VV PL+  H+E   R+
Sbjct: 257 VLQSQ--KDKSQQSSQDNSNFEFTSSTLHRKKRLFDGPENVVNPLKPRHIEEAWRV 310

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.140    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,007,067
Number of extensions: 298030
Number of successful extensions: 735
Number of sequences better than 10.0: 4
Number of HSP's gapped: 735
Number of HSP's successfully gapped: 4
Length of query: 111
Length of database: 53,481,399
Length adjustment: 81
Effective length of query: 30
Effective length of database: 44,193,453
Effective search space: 1325803590
Effective search space used: 1325803590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 59 (27.3 bits)