Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D09922gsingletonON92292247160.0
ZYRO0D13332gsingletonON88987335060.0
Kwal_55.19561singletonON88288327790.0
SAKL0D09350gna 1ON88785326880.0
Kpol_455.13na 2ON89289325780.0
Suva_16.526na 2ON87783824750.0
Skud_16.498na 2ON87783724310.0
TPHA0C05020singletonON89682924270.0
YPR194C (OPT2)na 2ON87783824060.0
Ecym_2739na 1ON86787222470.0
ADL399CsingletonON88584121410.0
ACL205CsingletonON89082820550.0
Smik_16.458na 2ON85584520380.0
AGL027WsingletonON87788519750.0
KLLA0D15378gsingletonON86985216790.0
KLLA0E00419gna 3ON7948139251e-110
SAKL0G15224gsingletonON8057659071e-108
ABR156Wna 3ON7967688841e-104
Kwal_55.19788na 3ON8107318801e-104
KLTH0E01496gna 3ON8147228761e-103
KNAG0G02310singletonON7907568701e-103
Ecym_7185na 3ON8008328691e-102
SAKL0F14674gna 3ON8057838571e-101
Skud_10.5na 4ON7997518454e-99
KLLA0E00397gsingletonON7937518445e-99
YJL212C (OPT1)na 4ON7997948342e-97
Smik_10.20na 4ON7997898323e-97
Suva_6.290na 4ON8018188244e-96
KLTH0D06754gna 5ON8277288142e-94
TDEL0C00130singletonON7928018112e-94
ZYRO0D00330gna 3ON7987328094e-94
SAKL0A09394gna 5ON7978088001e-92
Kwal_26.7996na 5ON7827347822e-90
ZYRO0G22484gsingletonON8217245663e-60
ZYRO0C18568gsingletonON8218245292e-55
ZYRO0D17974gsingletonON7767364502e-45
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D09922g
         (922 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D09922g Chr4 (837954..840722) [2769 bp, 922 aa] {ON} simila...  1821   0.0  
ZYRO0D13332g Chr4 complement(1121064..1123733) [2670 bp, 889 aa]...  1355   0.0  
Kwal_55.19561 s55 complement(25934..28582) [2649 bp, 882 aa] {ON...  1075   0.0  
SAKL0D09350g Chr4 (775699..778362) [2664 bp, 887 aa] {ON} simila...  1040   0.0  
Kpol_455.13 s455 (24582..27260) [2679 bp, 892 aa] {ON} (24582..2...   997   0.0  
Suva_16.526 Chr16 complement(906594..909227) [2634 bp, 877 aa] {...   957   0.0  
Skud_16.498 Chr16 complement(866362..868995) [2634 bp, 877 aa] {...   941   0.0  
TPHA0C05020 Chr3 (1085361..1088051) [2691 bp, 896 aa] {ON}            939   0.0  
YPR194C Chr16 complement(924304..926937) [2634 bp, 877 aa] {ON} ...   931   0.0  
Ecym_2739 Chr2 complement(1430077..1432680) [2604 bp, 867 aa] {O...   870   0.0  
ADL399C Chr4 complement(3872..6529) [2658 bp, 885 aa] {ON} Non-s...   829   0.0  
ACL205C Chr3 complement(1169..3841) [2673 bp, 890 aa] {ON} Non-s...   796   0.0  
Smik_16.458 Chr16 complement(787205..789133,789181..789306,78932...   789   0.0  
AGL027W Chr7 (657958..660591) [2634 bp, 877 aa] {ON} Non-synteni...   765   0.0  
KLLA0D15378g Chr4 complement(1303787..1306396) [2610 bp, 869 aa]...   651   0.0  
KLLA0E00419g Chr5 (28957..31341) [2385 bp, 794 aa] {ON} similar ...   360   e-110
SAKL0G15224g Chr7 complement(1311409..1313826) [2418 bp, 805 aa]...   353   e-108
ABR156W Chr2 (692938..695328) [2391 bp, 796 aa] {ON} Non-synteni...   345   e-104
Kwal_55.19788 s55 complement(125184..127616) [2433 bp, 810 aa] {...   343   e-104
KLTH0E01496g Chr5 complement(146000..148444) [2445 bp, 814 aa] {...   342   e-103
KNAG0G02310 Chr7 complement(530112..532484) [2373 bp, 790 aa] {O...   339   e-103
Ecym_7185 Chr7 (379870..382272) [2403 bp, 800 aa] {ON} similar t...   339   e-102
SAKL0F14674g Chr6 complement(1170374..1172791) [2418 bp, 805 aa]...   334   e-101
Skud_10.5 Chr10 complement(7830..10229) [2400 bp, 799 aa] {ON}  ...   330   4e-99
KLLA0E00397g Chr5 (23256..25637) [2382 bp, 793 aa] {ON} highly s...   329   5e-99
YJL212C Chr10 complement(33850..36249) [2400 bp, 799 aa] {ON}  O...   325   2e-97
Smik_10.20 Chr10 complement(32201..34600) [2400 bp, 799 aa] {ON}...   325   3e-97
Suva_6.290 Chr6 (513382..515787) [2406 bp, 801 aa] {ON} YJL212C ...   322   4e-96
KLTH0D06754g Chr4 complement(588021..590504) [2484 bp, 827 aa] {...   318   2e-94
TDEL0C00130 Chr3 complement(9763..12141) [2379 bp, 792 aa] {ON}       317   2e-94
ZYRO0D00330g Chr4 complement(22470..24866) [2397 bp, 798 aa] {ON...   316   4e-94
SAKL0A09394g Chr1 complement(817374..819767) [2394 bp, 797 aa] {...   312   1e-92
Kwal_26.7996 s26 complement(604470..606818) [2349 bp, 782 aa] {O...   305   2e-90
ZYRO0G22484g Chr7 (1848658..1851123) [2466 bp, 821 aa] {ON} simi...   222   3e-60
ZYRO0C18568g Chr3 (1457201..1459666) [2466 bp, 821 aa] {ON} simi...   208   2e-55
ZYRO0D17974g Chr4 complement(1492455..1494785) [2331 bp, 776 aa]...   177   2e-45

>ZYRO0D09922g Chr4 (837954..840722) [2769 bp, 922 aa] {ON} similar
           to uniprot|Q06593 Saccharomyces cerevisiae YPR194C OPT2
           Oligopeptide transporter member of the OPT family with
           potential orthologs in S. pombe and C. albicans
          Length = 922

 Score = 1821 bits (4716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 888/922 (96%), Positives = 888/922 (96%)

Query: 1   MLNKFWHTKGPSVQXXXXXXXXYQDVFEGVEMNGENKPEVKHEVRETNSSIESEKVDGDF 60
           MLNKFWHTKGPSVQ        YQDVFEGVEMNGENKPEVKHEVRETNSSIESEKVDGDF
Sbjct: 1   MLNKFWHTKGPSVQEGEEKEEEYQDVFEGVEMNGENKPEVKHEVRETNSSIESEKVDGDF 60

Query: 61  GNTTNYYSDKPEIGVVETIISPSGKVSDEQWTVLLKKAGFDNPDNITDIPADLKYVASQI 120
           GNTTNYYSDKPEIGVVETIISPSGKVSDEQWTVLLKKAGFDNPDNITDIPADLKYVASQI
Sbjct: 61  GNTTNYYSDKPEIGVVETIISPSGKVSDEQWTVLLKKAGFDNPDNITDIPADLKYVASQI 120

Query: 121 VNMSLEEAAEVLKLGAEYHADDPNLSSDEYNDFVKLSELNPVTLHPFEEDALELKAVAGL 180
           VNMSLEEAAEVLKLGAEYHADDPNLSSDEYNDFVKLSELNPVTLHPFEEDALELKAVAGL
Sbjct: 121 VNMSLEEAAEVLKLGAEYHADDPNLSSDEYNDFVKLSELNPVTLHPFEEDALELKAVAGL 180

Query: 181 LHFHSPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSM 240
           LHFHSPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSM
Sbjct: 181 LHFHSPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSM 240

Query: 241 VQLLLFPMGSLWAKIMPYWSFPIWKGKRIHLNIPQPWSQKEQMFSTVLFSIAVSSFYMDS 300
           VQLLLFPMGSLWAKIMPYWSFPIWKGKRIHLNIPQPWSQKEQMFSTVLFSIAVSSFYMDS
Sbjct: 241 VQLLLFPMGSLWAKIMPYWSFPIWKGKRIHLNIPQPWSQKEQMFSTVLFSIAVSSFYMDS 300

Query: 301 VILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPSHAIWPSQLQTMALNKA 360
           VILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPSHAIWPSQLQTMALNKA
Sbjct: 301 VILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPSHAIWPSQLQTMALNKA 360

Query: 361 LFSKKTEKGGRGLTSQTFFYICVAFTFFYEWLPTYLFQILSTFNWMTWIKPDNFNLAMVT 420
           LFSKKTEKGGRGLTSQTFFYICVAFTFFYEWLPTYLFQILSTFNWMTWIKPDNFNLAMVT
Sbjct: 361 LFSKKTEKGGRGLTSQTFFYICVAFTFFYEWLPTYLFQILSTFNWMTWIKPDNFNLAMVT 420

Query: 421 GSMGGVGINPIASFDWNVINYYSALVTPLFSYANQMAGGLIAAICVLAIYYSNQFDCQYL 480
           GSMGGVGINPIASFDWNVINYYSALVTPLFSYANQMAGGLIAAICVLAIYYSNQFDCQYL
Sbjct: 421 GSMGGVGINPIASFDWNVINYYSALVTPLFSYANQMAGGLIAAICVLAIYYSNQFDCQYL 480

Query: 481 PMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPPYYSAGNLFCYGVFIASYPLLFA 540
           PMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPPYYSAGNLFCYGVFIASYPLLFA
Sbjct: 481 PMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPPYYSAGNLFCYGVFIASYPLLFA 540

Query: 541 YSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSHALEEFHDPHSRMMRRYNEVPD 600
           YSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSHALEEFHDPHSRMMRRYNEVPD
Sbjct: 541 YSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSHALEEFHDPHSRMMRRYNEVPD 600

Query: 601 WWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNAVFLIPITILEATTALQLGLNVL 660
           WWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNAVFLIPITILEATTALQLGLNVL
Sbjct: 601 WWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNAVFLIPITILEATTALQLGLNVL 660

Query: 661 IEIIMGYALPGNPQALMLIKAFGYNIDGQADSYVGNLKLGHYSKIPPMALFRGQMFMVLI 720
           IEIIMGYALPGNPQALMLIKAFGYNIDGQADSYVGNLKLGHYSKIPPMALFRGQMFMVLI
Sbjct: 661 IEIIMGYALPGNPQALMLIKAFGYNIDGQADSYVGNLKLGHYSKIPPMALFRGQMFMVLI 720

Query: 721 QTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAITYYNASVLWGAIGPKRIFEGVYPILK 780
           QTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAITYYNASVLWGAIGPKRIFEGVYPILK
Sbjct: 721 QTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAITYYNASVLWGAIGPKRIFEGVYPILK 780

Query: 781 WCWXXXXXXXXXXXXXXXXXPRFYPLWFNPLLVVGGMLNMAPPYNLTYMTPGAIANFFSQ 840
           WCW                 PRFYPLWFNPLLVVGGMLNMAPPYNLTYMTPGAIANFFSQ
Sbjct: 781 WCWLIGAIIGIGLGLWKLLIPRFYPLWFNPLLVVGGMLNMAPPYNLTYMTPGAIANFFSQ 840

Query: 841 FYMRKYHLRIWQKYNYVLVAGFQTGLVXXXXXXXXXVQYKEKPISWWGNDVINNGLDAAG 900
           FYMRKYHLRIWQKYNYVLVAGFQTGLV         VQYKEKPISWWGNDVINNGLDAAG
Sbjct: 841 FYMRKYHLRIWQKYNYVLVAGFQTGLVISSIIIFFSVQYKEKPISWWGNDVINNGLDAAG 900

Query: 901 PPKKNVSLTPRGYFGPEYGHFP 922
           PPKKNVSLTPRGYFGPEYGHFP
Sbjct: 901 PPKKNVSLTPRGYFGPEYGHFP 922

>ZYRO0D13332g Chr4 complement(1121064..1123733) [2670 bp, 889 aa]
           {ON} similar to uniprot|Q06593 Saccharomyces cerevisiae
           YPR194C OPT2 Oligopeptide transporter member of the OPT
           family with potential orthologs in S. pombe and C.
           albicans
          Length = 889

 Score = 1355 bits (3506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/873 (71%), Positives = 733/873 (83%), Gaps = 3/873 (0%)

Query: 53  SEKVDGDF---GNTTNYYSDKPEIGVVETIISPSGKVSDEQWTVLLKKAGFDNPDNITDI 109
           S  +D DF        Y+ DK    + ETI   S  V+D+Q   LL+K G+D+ ++ITDI
Sbjct: 17  SSSIDKDFKPNNGVVEYFDDKQNAEIFETIHPTSSGVNDDQMAALLRKLGYDHMESITDI 76

Query: 110 PADLKYVASQIVNMSLEEAAEVLKLGAEYHADDPNLSSDEYNDFVKLSELNPVTLHPFEE 169
           PAD++YVA +I  MSLE+A  V+K  A YH DDPN+  DE +++V+LSEL+P  L P E+
Sbjct: 77  PADIQYVAGKIATMSLEDAVAVMKESAVYHKDDPNIPQDELDEYVRLSELDPALLEPHEQ 136

Query: 170 DALELKAVAGLLHFHSPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFFAH 229
           D  +L A+AGLLH+HSPY++VRACV P+DD ++P+ETFRSY LAL+WAIIGSGFNEFFAH
Sbjct: 137 DYYDLMAMAGLLHWHSPYRSVRACVDPRDDPDAPIETFRSYTLALIWAIIGSGFNEFFAH 196

Query: 230 RLMVITISSSMVQLLLFPMGSLWAKIMPYWSFPIWKGKRIHLNIPQPWSQKEQMFSTVLF 289
           RL+ ITI+S+MVQ+LLFPMG+LWAK MPYWSFPIWKGKRIH+N PQPW+QKEQMFST+LF
Sbjct: 197 RLLTITINSAMVQMLLFPMGNLWAKFMPYWSFPIWKGKRIHINYPQPWNQKEQMFSTILF 256

Query: 290 SIAVSSFYMDSVILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPSHAIWP 349
           +I  ++FY    ILT KM+Y E VSFGYQFF SI VQ+LG GFAGSLRRFVIYPS AIWP
Sbjct: 257 AICSTTFYTHYNILTQKMYYHEAVSFGYQFFLSIGVQYLGLGFAGSLRRFVIYPSKAIWP 316

Query: 350 SQLQTMALNKALFSKKTEKGGRGLTSQTFFYICVAFTFFYEWLPTYLFQILSTFNWMTWI 409
           SQLQTMALNKALFS++ EK  +GLT QTFF+IC  F FFY+W+PTYLFQ LSTFNWMTWI
Sbjct: 317 SQLQTMALNKALFSRREEKNSKGLTRQTFFFICTGFIFFYQWIPTYLFQALSTFNWMTWI 376

Query: 410 KPDNFNLAMVTGSMGGVGINPIASFDWNVINYYSALVTPLFSYANQMAGGLIAAICVLAI 469
           KPDNF+LAMVTGS+GGVG NPIASFDWNVIN Y  LVTPLFSY  QM G LIAAICVLA+
Sbjct: 377 KPDNFDLAMVTGSVGGVGFNPIASFDWNVINNYFCLVTPLFSYMCQMIGALIAAICVLAM 436

Query: 470 YYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPPYYSAGNLFCYG 529
           YYSNQ+DCQ+LPMFSNALFTNTG  +++ +I+N K EVDV KYQNYSPPYYSAGN+FCYG
Sbjct: 437 YYSNQYDCQFLPMFSNALFTNTGDSFEINAILNKKYEVDVKKYQNYSPPYYSAGNIFCYG 496

Query: 530 VFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSHALEEFHDPHS 589
            FIASYPLLFAY F+++WK++  AFK+WA AIW+LTKKHTWL +W++ +HALEEFHDPHS
Sbjct: 497 AFIASYPLLFAYYFISEWKIMYGAFKEWALAIWALTKKHTWLQAWKDDAHALEEFHDPHS 556

Query: 590 RMMRRYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNAVFLIPITILEA 649
           RMMRRY EVPDWWYY+VLI ++ +GI  +EGYHTNTP+WSLFM++GLNA FLIPITILEA
Sbjct: 557 RMMRRYKEVPDWWYYMVLICAVGVGIGTIEGYHTNTPVWSLFMSIGLNAAFLIPITILEA 616

Query: 650 TTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSYVGNLKLGHYSKIPPMA 709
           T+ALQ+GLNVLIE+IMGYALPGNP ALM+IKAFGYNIDGQADS+VGNLKLGHY+KIPP A
Sbjct: 617 TSALQMGLNVLIEVIMGYALPGNPHALMIIKAFGYNIDGQADSFVGNLKLGHYAKIPPKA 676

Query: 710 LFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAITYYNASVLWGAIGPK 769
           LFRGQM M+L+QT V LGVLNWS+SNIKDYC+P+Q SKFTCPDA+TYYN+SVLWGAIGPK
Sbjct: 677 LFRGQMLMILVQTFVCLGVLNWSMSNIKDYCKPHQASKFTCPDAVTYYNSSVLWGAIGPK 736

Query: 770 RIFEGVYPILKWCWXXXXXXXXXXXXXXXXXPRFYPLWFNPLLVVGGMLNMAPPYNLTYM 829
           RIFEGVYPI+KWCW                 PRFYP WFNP++V+GGMLNMAPPYNLTYM
Sbjct: 737 RIFEGVYPIMKWCWLIGALIGVGFGLYKLLLPRFYPTWFNPVIVIGGMLNMAPPYNLTYM 796

Query: 830 TPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQTGLVXXXXXXXXXVQYKEKPISWWGN 889
           TPGAIANFFSQFYMR+Y +R+W+KYNYVL AGF  GLV         VQYK KPI+WWGN
Sbjct: 797 TPGAIANFFSQFYMRRYRVRLWEKYNYVLSAGFSAGLVVSSIIIFFSVQYKNKPINWWGN 856

Query: 890 DVINNGLDAAGPPKKNVSLTPRGYFGPEYGHFP 922
           DVIN GLDAAGPPKKN++LTP+GYFGP+ GHFP
Sbjct: 857 DVINAGLDAAGPPKKNITLTPKGYFGPDPGHFP 889

>Kwal_55.19561 s55 complement(25934..28582) [2649 bp, 882 aa] {ON}
           YPR194C (OPT2) - oligopeptide transporter [contig 159]
           FULL
          Length = 882

 Score = 1075 bits (2779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/883 (57%), Positives = 655/883 (74%), Gaps = 8/883 (0%)

Query: 45  RETNSSIESEKVDGDFGNTTNYYSD---KPEIGVVETIISPSG--KVSDEQWTVLLKKAG 99
           +E + +I S++      +  N Y D     E  ++ T+ S       SDE+ + LLKK G
Sbjct: 3   KEKSETITSDRASSS-SDGQNSYVDGTWDKEKQIITTVESQGSIKDFSDEEISHLLKKLG 61

Query: 100 FDNPDNITDIPADLKYVASQIVNMSLEEAAEVLKLGAEYHADDPNLSSDEYNDFVKLSEL 159
           +D P++ +DIP +++Y+ S+I N+++E++ ++LK     + DDPN+ SDEY +  +L+  
Sbjct: 62  YDRPEDTSDIPPEIEYIGSKISNLTVEDSLQILKKAVVDYQDDPNIPSDEYAEIQRLASF 121

Query: 160 NPVTLHPFEEDALELKAVAGLLHFHSPYKAVRACVSPQDDYESPVETFRSYFLALVWAII 219
             + +H   E   ELKA+AGLL +HSPYK VRA V P+DD   PVETFRSYFLALVWAII
Sbjct: 122 EKLEVHNANE-IFELKALAGLLKYHSPYKEVRATVDPRDDPNIPVETFRSYFLALVWAII 180

Query: 220 GSGFNEFFAHRLMVITISSSMVQLLLFPMGSLWAKIMPYWSFPIWKGKRIHLNIPQPWSQ 279
           GSGFNEFF+HRL+ I++S+S++Q+ L P G  W K +P   FPIWKGKRI+LNI  PWS 
Sbjct: 181 GSGFNEFFSHRLVSISLSTSVIQMFLLPCGKFWEKYVPKVGFPIWKGKRINLNIDSPWSA 240

Query: 280 KEQMFSTVLFSIAVSSFYMDSVILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRF 339
           KEQMFST+LF+I + +FY    ILTLK++Y + V FGYQF+ S+ VQF+GFGFAG LR++
Sbjct: 241 KEQMFSTLLFAICMGTFYTHYNILTLKVYYNDDVDFGYQFWLSMGVQFMGFGFAGLLRKY 300

Query: 340 VIYPSHAIWPSQLQTMALNKALFSKKTEKGGRGLTSQTFFYICVAFTFFYEWLPTYLFQI 399
           V+YP+ AIWP  LQT+ALNKALF     K G+GL SQTFF++ VAF FFY W+PTYL   
Sbjct: 301 VVYPARAIWPGSLQTLALNKALFKDSGSKKGKGLASQTFFFLSVAFMFFYTWIPTYLMNF 360

Query: 400 LSTFNWMTWIKPDNFNLAMVTGSMGGVGINPIASFDWNVINYYSALVTPLFSYANQMAGG 459
           LS FNWMTWI PDNFNLAMVTGS+ G+G NPI+SFDWNVI++  AL TP FSY  Q+AGG
Sbjct: 361 LSMFNWMTWIAPDNFNLAMVTGSVSGLGFNPISSFDWNVIDFLGALTTPFFSYFTQLAGG 420

Query: 460 LIAAICVLAIYYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPPY 519
           +++A+ V+AIY+SN +DCQYLP+FSN+LFTNTG  + +T I+NS+ ++D  KYQ YSPPY
Sbjct: 421 ILSALIVIAIYWSNYYDCQYLPIFSNSLFTNTGERFKITKILNSEWKLDPQKYQEYSPPY 480

Query: 520 YSAGNLFCYGVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSH 579
           +SAGN+  YG FIA YPLL  Y+  ++  VL  A K W S I+SL KK TW  +W   ++
Sbjct: 481 FSAGNIVTYGTFIAIYPLLIVYALFSETNVLFGAVKGWFSDIFSLFKKDTWR-NWNAETN 539

Query: 580 ALEEFHDPHSRMMRRYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNAV 639
            L+EF D HSRMM++Y EVPDWWY+++ ++S++IGI  +E YHTNTP+W+L M++G N V
Sbjct: 540 KLDEFDDAHSRMMKQYKEVPDWWYFVIFLVSLIIGICFIERYHTNTPVWALLMSIGFNFV 599

Query: 640 FLIPITILEATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSYVGNLKL 699
           FLIP+T L++ T   LGLNVLIE+I+GYALPGNPQALM+IKAFGYNIDGQAD+YV NLK+
Sbjct: 600 FLIPLTTLQSVTTFSLGLNVLIEMIVGYALPGNPQALMIIKAFGYNIDGQADNYVSNLKM 659

Query: 700 GHYSKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAITYYNA 759
           GHY+K+PP+ALFRGQ+ MV +Q  V+LGVLNWSISNIKD+C P Q +KFTCPDA TYYN+
Sbjct: 660 GHYAKVPPVALFRGQLIMVFVQIFVNLGVLNWSISNIKDFCMPTQSAKFTCPDATTYYNS 719

Query: 760 SVLWGAIGPKRIFEGVYPILKWCWXXXXXXXXXXXXXXXXXPRFYPLWFNPLLVVGGMLN 819
           SV+WGA+GPK+IF  VYPI++W W                  R+YP W NP+L+ GGMLN
Sbjct: 720 SVMWGALGPKKIFNDVYPIMRWSWLIGACIGLFFGVWRKFFRRYYPTWLNPVLIAGGMLN 779

Query: 820 MAPPYNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQTGLVXXXXXXXXXVQY 879
           ++PPY LTY+ PGAIANFFSQFY ++ H+R+W K+NYVL AGF  GLV         VQY
Sbjct: 780 VSPPYGLTYVIPGAIANFFSQFYYKRRHVRLWSKFNYVLSAGFSAGLVFSSIVIFFAVQY 839

Query: 880 KEKPISWWGNDVINNGLDAAGPPKKNVSLTPRGYFGPEYGHFP 922
           K   ++WWGN V   GLD A PP K+VSLTP+G+FGP+ GH+P
Sbjct: 840 KNYDLNWWGNTVPYAGLDGAEPPMKDVSLTPKGHFGPDPGHYP 882

>SAKL0D09350g Chr4 (775699..778362) [2664 bp, 887 aa] {ON} similar
           to uniprot|Q06593 Saccharomyces cerevisiae YPR194C OPT2
           Oligopeptide transporter member of the OPT family with
           potential orthologs in S. pombe and C. albicans
          Length = 887

 Score = 1040 bits (2688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/853 (58%), Positives = 635/853 (74%), Gaps = 6/853 (0%)

Query: 72  EIGVVETIISP--SGKVSDEQWTVLLKKAGFDNPDNITDIPADLKYVASQIVNMSLEEAA 129
           E G V  + S   +   SDEQ   LLKK G++  ++I++IP ++++V ++I  +S+EEA 
Sbjct: 39  EAGTVVEVDSKGYAESCSDEQMANLLKKMGYERCEDISEIPPEIRFVCTKIEKLSVEEAV 98

Query: 130 EVLKLGAEYHADDPNLSSDEYNDFVKLSELNPVTLHPFEEDALELKAVAGLLHFHSPYKA 189
           E+LK G EYH DDPN+ S+EY ++V+ +  N    H  E++  ELKA+AGLL FHSPY  
Sbjct: 99  EILKEGVEYHEDDPNIPSNEYAEYVRFA--NGDYDHENEKEIFELKALAGLLKFHSPYAE 156

Query: 190 VRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSMVQLLLFPMG 249
           VRA V P D+   PVETFR+YFLALVW I+GSGFNEFF+HRL+ I+IS+S+VQ+ L+  G
Sbjct: 157 VRAVVEPSDNPTIPVETFRAYFLALVWGIVGSGFNEFFSHRLVSISISTSVVQMFLYLCG 216

Query: 250 SLWAKIMPYWSFPIWKGKRIHLNIPQPWSQKEQMFSTVLFSIAVSSFYMDSVILTLKMFY 309
           +LWAK +P W F + KGKR  LNI  PW+ KEQMF+T+LF+I    FY    ILT K++Y
Sbjct: 217 TLWAKHLPCWGFTV-KGKRFALNIETPWTDKEQMFATLLFAICNGVFYTHYNILTQKIYY 275

Query: 310 KEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPSHAIWPSQLQTMALNKALFSKKTEKG 369
            +K+SFGYQF+ SI +QF+GFGFAG LRRFV+YP+  +WP+ + T+ALN AL S++ +  
Sbjct: 276 GDKISFGYQFWLSICIQFIGFGFAGILRRFVVYPARTLWPTSMSTIALNNALLSREKDVS 335

Query: 370 GRGLTSQTFFYICVAFTFFYEWLPTYLFQILSTFNWMTWIKPDNFNLAMVTGSMGGVGIN 429
            +GL+  +FF+I   F F Y W PTYL  IL+TFNWMTWI P+NF+LA +TG + G+GIN
Sbjct: 336 -KGLSRYSFFFIATTFMFLYTWFPTYLINILNTFNWMTWIAPNNFDLAAITGGVSGLGIN 394

Query: 430 PIASFDWNVINYYSALVTPLFSYANQMAGGLIAAICVLAIYYSNQFDCQYLPMFSNALFT 489
           PI+SFDWNVIN+   LVTP FSY+ Q AG   AA+ V+A+YY+N  DCQYLP+FSN+LFT
Sbjct: 395 PISSFDWNVINFLYPLVTPFFSYSVQFAGSFFAALVVIAVYYTNYKDCQYLPIFSNSLFT 454

Query: 490 NTGTEYDVTSIINSKAEVDVNKYQNYSPPYYSAGNLFCYGVFIASYPLLFAYSFLTQWKV 549
           NTGT Y +  I+NS  +VD  KYQ YSPP+YSAGNL  YG FIA YP+L  Y+F+T+ KV
Sbjct: 455 NTGTPYSIKKILNSDYKVDEEKYQQYSPPFYSAGNLVSYGSFIAVYPMLIIYAFITESKV 514

Query: 550 LLRAFKDWASAIWSLTKKHTWLYSWRESSHALEEFHDPHSRMMRRYNEVPDWWYYIVLIL 609
           LL A KDWA  IWSL K  +W    ++  HAL+ F+DPHS MM++Y EVPDWWY+++L++
Sbjct: 515 LLGACKDWAKGIWSLRKWQSWTNMAKQEYHALDSFNDPHSNMMKKYKEVPDWWYFMILLI 574

Query: 610 SIVIGIAALEGYHTNTPIWSLFMAVGLNAVFLIPITILEATTALQLGLNVLIEIIMGYAL 669
           SIVI I  LE Y TNTPIW+LFM++G N VFLIPITIL+ATT   +GLN+LIE+I+GYAL
Sbjct: 575 SIVISIIVLEKYETNTPIWALFMSLGFNFVFLIPITILQATTGFSIGLNLLIEMIIGYAL 634

Query: 670 PGNPQALMLIKAFGYNIDGQADSYVGNLKLGHYSKIPPMALFRGQMFMVLIQTLVSLGVL 729
           PGNP ALM++KAFGYNIDGQAD+YV NLK+ HY KIPP+ALFRGQ+FMV +Q LV+LGVL
Sbjct: 635 PGNPYALMIVKAFGYNIDGQADNYVSNLKMAHYCKIPPVALFRGQLFMVFVQVLVNLGVL 694

Query: 730 NWSISNIKDYCQPNQESKFTCPDAITYYNASVLWGAIGPKRIFEGVYPILKWCWXXXXXX 789
           NW ISNIKD+CQPNQ SKFTCPDA TYYNASV+WGA+GPK+IF  VYPIL+WCW      
Sbjct: 695 NWQISNIKDFCQPNQASKFTCPDARTYYNASVMWGAMGPKKIFNDVYPILRWCWLIGACL 754

Query: 790 XXXXXXXXXXXPRFYPLWFNPLLVVGGMLNMAPPYNLTYMTPGAIANFFSQFYMRKYHLR 849
                       R+YP WFNP+L VGGM+NM PPY L Y+ PG   +FFSQFY++KYHLR
Sbjct: 755 GVFFGLWKVYGRRYYPTWFNPILFVGGMINMGPPYGLMYVVPGFFVSFFSQFYLKKYHLR 814

Query: 850 IWQKYNYVLVAGFQTGLVXXXXXXXXXVQYKEKPISWWGNDVINNGLDAAGPPKKNVSLT 909
           +W+KYNYV  A F  GLV         VQYK+K ++WWGN VI  GLD  G  KK++S T
Sbjct: 815 LWEKYNYVCDAAFSAGLVFSSIVIFFAVQYKQKDLNWWGNTVIYAGLDGEGLAKKDISQT 874

Query: 910 PRGYFGPEYGHFP 922
            +GYFGP  GH+P
Sbjct: 875 SKGYFGPAPGHYP 887

>Kpol_455.13 s455 (24582..27260) [2679 bp, 892 aa] {ON}
           (24582..27260) [2679 nt, 893 aa]
          Length = 892

 Score =  997 bits (2578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/893 (53%), Positives = 631/893 (70%), Gaps = 11/893 (1%)

Query: 35  ENKPEVKHEVRETNSSIESEKVDGDFGNTTNYYSDKPEIGVVETIISPS-----GKVSDE 89
           +NK +V +E+ +  S+   E+ +    + +N  ++K +   + T+   S     G   + 
Sbjct: 6   DNKTQV-YEMDDRGSN-GLERTNISLEDDSNDSAEKKQHTKIHTVTEHSFDTAEGSYDEA 63

Query: 90  QWTVLLKKAGFDNPDNITDIPADLKYVASQIVNMSLEEAAEVLKLGAEYHADDPNLSSDE 149
           Q   ++KK G+   ++++DIP  + Y+AS++  + LE+A E L+  AEYH DDPN+ SDE
Sbjct: 64  QLEYVMKKMGYHKYEDLSDIPPTVAYIASKVSELPLEDAIEELRKAAEYHKDDPNIPSDE 123

Query: 150 YNDFVKLSELNPVTLHPFEEDALELKAVAGLLHFHSPYKAVRACVSPQDDYESPVETFRS 209
           Y +   LS    + +   ++   E + +A ++ FHSPYK VRA V P DD   PVETFRS
Sbjct: 124 YEEIKYLSNPENIDIDD-KKQCYEARILASMIKFHSPYKEVRAVVDPTDDPTIPVETFRS 182

Query: 210 YFLALVWAIIGSGFNEFFAHRLMVITISSSMVQLLLFPMGSLWAKIMPYWSFPIWKGKRI 269
           Y  AL WAI+GSGFNEFF+HR + I+I++S+VQ+ L+P G LWAK +P W   I KG++ 
Sbjct: 183 YLFALFWAIVGSGFNEFFSHRQVTISINTSVVQMFLYPSGLLWAKYVPCWGISI-KGRKY 241

Query: 270 HLNIPQPWSQKEQMFSTVLFSIAVSSFYMDSVILTLKMFYKEKVSFGYQFFTSIAVQFLG 329
            +NI +PWSQKEQMFST+LFSI   +FY    ILT K++Y + VSFGYQF  S+++QFLG
Sbjct: 242 AINIDKPWSQKEQMFSTLLFSICSGTFYTHYNILTQKVYYHDNVSFGYQFLLSLSIQFLG 301

Query: 330 FGFAGSLRRFVIYPSHAIWPSQLQTMALNKALFSKKTEKGGRGLTSQTFFYICVAFTFFY 389
           FGFAG LR+FV+YP+ A+WP+   T+ALNKAL S+K E+   G+T   FF++     F Y
Sbjct: 302 FGFAGILRKFVVYPTKALWPTSFPTIALNKALLSRK-EENTNGMTRYKFFFLTFFAMFIY 360

Query: 390 EWLPTYLFQILSTFNWMTWIKPDNFNLAMVTGSMGGVGINPIASFDWNVINYYSALVTPL 449
            W PTY+  I +TFNWMTWI P+NFNLAM+TG + G+G NPIASFDWNV +Y + L  P 
Sbjct: 361 NWFPTYIINIFNTFNWMTWISPNNFNLAMITGGVSGIGFNPIASFDWNVASYINPLRIPF 420

Query: 450 FSYANQMAGGLIAAICVLAIYYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDV 509
           FS   Q  G + AA+ V+A+Y++N  DCQYLP+FSN L+TN  T Y VT +++S  ++D 
Sbjct: 421 FSNMTQYCGAVFAALVVIAVYWTNYMDCQYLPLFSNTLYTNRATRYQVTEVLDSDWKLDN 480

Query: 510 NKYQNYSPPYYSAGNLFCYGVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHT 569
            KYQ YS PYYSAGNL  YG FIA+YP+L  YS LT+ K+L  A K W  ++WSLTKKHT
Sbjct: 481 AKYQEYSAPYYSAGNLVAYGSFIATYPMLIVYSMLTETKLLWSAMKQWTLSLWSLTKKHT 540

Query: 570 WLYSWRESSHALEEFHDPHSRMMRRYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWS 629
           W     + S AL+EF DPHSRMM+ Y EVPDWWY++VL+ +I +GIA +E YHTNTP+WS
Sbjct: 541 WTNLLTQESCALDEFDDPHSRMMKNYKEVPDWWYFVVLLAAIGVGIAVIEAYHTNTPVWS 600

Query: 630 LFMAVGLNAVFLIPITILEATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQ 689
           LF+++G N  FLIP+T+L+AT    LGLN+LIE+I+GYALPGNP ALM+IKAFGYNIDGQ
Sbjct: 601 LFVSIGFNVAFLIPLTMLQATAGFSLGLNLLIEMIVGYALPGNPFALMIIKAFGYNIDGQ 660

Query: 690 ADSYVGNLKLGHYSKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFT 749
           AD+YV NLK+ HY+KIPP+ALFRGQM MV +Q  V+LGVLNW ISNIK +C  +Q++KFT
Sbjct: 661 ADNYVSNLKMAHYTKIPPIALFRGQMIMVFLQIFVNLGVLNWQISNIKGFCTHDQKAKFT 720

Query: 750 CPDAITYYNASVLWGAIGPKRIFEGVYPILKWCWXXXXXXXXXXXXXXXXXPRFYPLWFN 809
           CPDA TYYNASV+WGA+GPK+IF  VYPIL+WCW                  +FYP WFN
Sbjct: 721 CPDATTYYNASVVWGALGPKKIFNDVYPILRWCWLIGACIGLFFGVWKRFG-KFYPTWFN 779

Query: 810 PLLVVGGMLNMAPPYNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQTGLVXX 869
           P+L VGGM+NMAPPY L Y TPG I ++ SQ++ +KYHLR+W+KYNY+L AGF +GLV  
Sbjct: 780 PILFVGGMINMAPPYGLMYFTPGIIVSYLSQYHFKKYHLRLWEKYNYILDAGFTSGLVLS 839

Query: 870 XXXXXXXVQYKEKPISWWGNDVINNGLDAAGPPKKNVSLTPRGYFGPEYGHFP 922
                  VQY+    SWWGN+V   GLD AGPP KN+S T RGYFGPE GH P
Sbjct: 840 AIIIFFAVQYEGTNFSWWGNNVPYAGLDGAGPPLKNISDTARGYFGPELGHLP 892

>Suva_16.526 Chr16 complement(906594..909227) [2634 bp, 877 aa] {ON}
            YPR194C (REAL)
          Length = 877

 Score =  957 bits (2475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/838 (54%), Positives = 605/838 (72%), Gaps = 7/838 (0%)

Query: 87  SDEQWTVLLKKAGFDNPDNITDIPADLKYVASQIVNMSLEEAAEVLKLGAEYHADDPNLS 146
           +DEQ    +KK G+ N   + DIP D+KY+  ++  +SLE++ +VLK    Y+ DD NL 
Sbjct: 45  TDEQLLHFMKKLGYAN-RTLYDIPDDVKYIVKEMPKLSLEDSFQVLKDAIVYYEDDENLP 103

Query: 147 SDEYNDFVKLSEL-NPVTLHPFEE-DALELKAVAGLLHFHSPYKAVRACVSPQDDYESPV 204
            D+Y ++ +L+EL +P      +E D+  ++A A  + FHSPY+ VRA V P DD   PV
Sbjct: 104 HDQYEEWKRLAELESPDWKEQLDEYDSFNIRAFASAIKFHSPYQEVRAVVDPSDDPTVPV 163

Query: 205 ETFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSMVQLLLFPMGSLWAKIMPYWSFPIW 264
           ETFR+YFLA+VW+I+GSGFNEFF+HR++ IT+ + ++Q+ L+  G  WAK +P W F + 
Sbjct: 164 ETFRAYFLAIVWSIVGSGFNEFFSHRVVTITLGTPVIQMFLYICGKAWAKTVPCWGFTV- 222

Query: 265 KGKRIHLNIPQPWSQKEQMFSTVLFSIAVSSFYMDSVILTLKMFYKEKVSFGYQFFTSIA 324
           KG +  +NI  PW+QKEQMF+T+L+ I   +FY    ILT K+FY    SFGYQF  S+A
Sbjct: 223 KGTKYGININTPWTQKEQMFATLLYGICQGAFYTHYNILTQKIFYHSSFSFGYQFLLSLA 282

Query: 325 VQFLGFGFAGSLRRFVIYPSHAIWPSQLQTMALNKALFSKKTEKGGRGLTSQTFFYICVA 384
           VQF+GFGFAG LRRFV+YPS A+WP+ + T+A+NKAL  K  EK   G++   FF++   
Sbjct: 283 VQFIGFGFAGILRRFVVYPSRALWPTVMPTIAINKALLGK--EKYESGMSRYNFFFLTFF 340

Query: 385 FTFFYEWLPTYLFQILSTFNWMTWIKPDNFNLAMVTGSMGGVGINPIASFDWNVINYYSA 444
             F Y W PTY+  IL+TFNWMTWIKP N NLA +TGS+ G+GINPI+SFDWNV+++ S 
Sbjct: 341 IMFIYNWFPTYILNILNTFNWMTWIKPSNINLANITGSVTGIGINPISSFDWNVLSFNSP 400

Query: 445 LVTPLFSYANQMAGGLIAAICVLAIYYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSK 504
           LV P +SY  Q  G ++AA+ V+A+YYSN  +CQ+LPMF+N+L+TNTG  + VT I++S+
Sbjct: 401 LVFPFWSYLTQYLGSILAALIVVAVYYSNYMNCQFLPMFTNSLYTNTGESFKVTKILDSE 460

Query: 505 AEVDVNKYQNYSPPYYSAGNLFCYGVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSL 564
            ++D+ KYQ+YSPP+Y+AGNL  YG FI +YPL+  +SF+   K+LL AFKDWA  +WSL
Sbjct: 461 NKLDLKKYQSYSPPFYTAGNLVSYGSFICAYPLMITWSFIVHSKLLLNAFKDWALNLWSL 520

Query: 565 TKKHTWLYSWRESSHALEEFHDPHSRMMRRYNEVPDWWYYIVLILSIVIGIAALEGYHTN 624
            K  +W   ++    AL+EF DPHS  M+ Y EVPDWWY+ +L+ S+V+GIA +E Y TN
Sbjct: 521 RKPKSWTAMFKSEYAALDEFDDPHSNAMKSYKEVPDWWYFAILLASLVVGIAVVEHYPTN 580

Query: 625 TPIWSLFMAVGLNAVFLIPITILEATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGY 684
           TP+W LF+++G N VFLIP TIL+ATT    GLN+LIE++MGYALPGNP A+M++KAFGY
Sbjct: 581 TPVWGLFVSLGFNFVFLIPTTILQATTGFSFGLNLLIEMVMGYALPGNPVAIMILKAFGY 640

Query: 685 NIDGQADSYVGNLKLGHYSKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQ 744
           NIDGQAD+YV NLK+ HY KIPPMA+FRGQ  +VLIQ  V+LGVLNW ISNIKD+C P+Q
Sbjct: 641 NIDGQADNYVSNLKIAHYCKIPPMAVFRGQCVIVLIQIFVNLGVLNWQISNIKDFCTPHQ 700

Query: 745 ESKFTCPDAITYYNASVLWGAIGPKRIFEGVYPILKWCWXXXXXXXXXXXXXXXXXPRFY 804
            +KFTCPDA+TYYNASV+WGAIGPKRIF  +YPI KWCW                  RFY
Sbjct: 701 NAKFTCPDAVTYYNASVVWGAIGPKRIFNHIYPIFKWCWLIGACIGIVFGVWKRWG-RFY 759

Query: 805 PLWFNPLLVVGGMLNMAPPYNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQT 864
           P  F+P+L VGGM+NM PPYNL Y TPG I +F SQ+YM+++HL +W+KYNYVL AGF T
Sbjct: 760 PRDFDPMLFVGGMINMGPPYNLMYFTPGMIVSFISQYYMKRHHLNLWEKYNYVLSAGFST 819

Query: 865 GLVXXXXXXXXXVQYKEKPISWWGNDVINNGLDAAGPPKKNVSLTPRGYFGPEYGHFP 922
           GLV         VQYK+   +WWGN V   G D AG P KN++ T +GYFGP+ GH+P
Sbjct: 820 GLVLSAIIIFFAVQYKDTAFNWWGNTVPYAGADGAGYPLKNITDTAKGYFGPDPGHYP 877

>Skud_16.498 Chr16 complement(866362..868995) [2634 bp, 877 aa] {ON}
           YPR194C (REAL)
          Length = 877

 Score =  941 bits (2431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/837 (53%), Positives = 601/837 (71%), Gaps = 7/837 (0%)

Query: 88  DEQWTVLLKKAGFDNPDNITDIPADLKYVASQIVNMSLEEAAEVLKLGAEYHADDPNLSS 147
           DEQ    ++K G+ N   + DIP D+ Y+  ++  ++ E++ ++LK    YH DD NL  
Sbjct: 46  DEQLLHFMRKLGYTN-RTLYDIPEDIIYIVKKMPELTFEDSIQILKDSIVYHKDDENLPH 104

Query: 148 DEYNDFVKLSEL-NPVTLHPFEE-DALELKAVAGLLHFHSPYKAVRACVSPQDDYESPVE 205
           D+Y ++ +L EL N  +    +E D+ +++A A  + FHSPY+ VRA V P DD   PVE
Sbjct: 105 DQYEEWKRLVELENSYSKEGVDEYDSFDIRAFASAIKFHSPYQEVRAVVDPDDDPTIPVE 164

Query: 206 TFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSMVQLLLFPMGSLWAKIMPYWSFPIWK 265
           TFR+YFLA++W+IIGSGFNEFF+HR++ I++ + ++Q+ L+  G  WAK +P +   + +
Sbjct: 165 TFRAYFLAVIWSIIGSGFNEFFSHRVVTISLETPIIQMFLYLCGKAWAKTVPCYGITV-R 223

Query: 266 GKRIHLNIPQPWSQKEQMFSTVLFSIAVSSFYMDSVILTLKMFYKEKVSFGYQFFTSIAV 325
           G +  +NI +PW+QKEQMF+T+L++I   +FY    ILT K+FY    SFGYQF  S++V
Sbjct: 224 GTKYGININRPWTQKEQMFATLLYAICQGTFYTHYNILTQKLFYHSAFSFGYQFLLSLSV 283

Query: 326 QFLGFGFAGSLRRFVIYPSHAIWPSQLQTMALNKALFSKKTEKGGRGLTSQTFFYICVAF 385
           QF+GFGFAG LR+FV+YP+ A+WP+ + T+A+NKAL  K  EK   G++   FF++    
Sbjct: 284 QFIGFGFAGILRKFVVYPARALWPTVMPTIAINKALLGK--EKNESGMSRYKFFFLTFFI 341

Query: 386 TFFYEWLPTYLFQILSTFNWMTWIKPDNFNLAMVTGSMGGVGINPIASFDWNVINYYSAL 445
            F Y W PTY+  IL+TFNWMTWIKP N NLA +TG + G+GINPI+SFDWNVI+  S L
Sbjct: 342 MFIYNWFPTYIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISSNSPL 401

Query: 446 VTPLFSYANQMAGGLIAAICVLAIYYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKA 505
           V P +SY  Q  G ++AA+ V+AIYYSN  +CQYLPMF+N+L+TNTG  + VT+I++S  
Sbjct: 402 VYPFWSYLTQYLGSVLAALIVVAIYYSNYMNCQYLPMFTNSLYTNTGDSFKVTNILDSSN 461

Query: 506 EVDVNKYQNYSPPYYSAGNLFCYGVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLT 565
           ++D+ KYQ+YSPPYYSAGNL  YG FI +YPL+ A+SF+   K+L  AFKDWA ++W+L 
Sbjct: 462 KLDLKKYQSYSPPYYSAGNLVTYGAFICAYPLMIAWSFIVHSKILFSAFKDWALSLWALR 521

Query: 566 KKHTWLYSWRESSHALEEFHDPHSRMMRRYNEVPDWWYYIVLILSIVIGIAALEGYHTNT 625
           K   W+  ++    AL+++ DPHS  MR Y EVP+WWY+ +LI S+++GIA +E Y TNT
Sbjct: 522 KLKAWVIMYKSDYKALDDYDDPHSIAMRNYKEVPEWWYFAILIASLIVGIAVVEHYPTNT 581

Query: 626 PIWSLFMAVGLNAVFLIPITILEATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYN 685
           P+W LF+++G N VFLIP TIL+ATT    GLN+LIE++MGYALPGNP A+M++KAFGYN
Sbjct: 582 PVWGLFVSLGFNFVFLIPTTILQATTGFSFGLNLLIEMVMGYALPGNPVAIMILKAFGYN 641

Query: 686 IDGQADSYVGNLKLGHYSKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQE 745
           IDGQADSYV NLK+ HY KIPPMALFRGQ  +VLIQ  V+LGVLNW ISNIK++C P+Q+
Sbjct: 642 IDGQADSYVSNLKIAHYCKIPPMALFRGQCVIVLIQIFVNLGVLNWQISNIKNFCTPHQD 701

Query: 746 SKFTCPDAITYYNASVLWGAIGPKRIFEGVYPILKWCWXXXXXXXXXXXXXXXXXPRFYP 805
           +KFTCPDA+TYYNASV+WGAIGPKRIF  +YPI KWCW                  RFYP
Sbjct: 702 AKFTCPDAVTYYNASVVWGAIGPKRIFNHIYPIFKWCWLIGACIGVLFGVWKRWG-RFYP 760

Query: 806 LWFNPLLVVGGMLNMAPPYNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQTG 865
             F+P+L VGGMLNM+PPYNL Y TPG I ++ SQ+YM+++HL +W+KYNYVL AGF TG
Sbjct: 761 RNFDPMLFVGGMLNMSPPYNLMYYTPGMIVSYISQYYMKRHHLNLWEKYNYVLSAGFSTG 820

Query: 866 LVXXXXXXXXXVQYKEKPISWWGNDVINNGLDAAGPPKKNVSLTPRGYFGPEYGHFP 922
           LV         VQY++   +WWGN V   G D AG P KN+S T  GYFG   GH+P
Sbjct: 821 LVLSAIIIFFAVQYRDTSFNWWGNTVSYAGADGAGYPLKNISDTANGYFGYAPGHYP 877

>TPHA0C05020 Chr3 (1085361..1088051) [2691 bp, 896 aa] {ON} 
          Length = 896

 Score =  939 bits (2427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/829 (52%), Positives = 585/829 (70%), Gaps = 3/829 (0%)

Query: 94  LLKKAGFDNPDNITDIPADLKYVASQIVNMSLEEAAEVLKLGAEYHADDPNLSSDEYNDF 153
           +L+K G+ + +N+TD+P  +KY+ S++  +S EE  ++LK  A     DPN+   EY + 
Sbjct: 71  VLEKMGYLDYENLTDVPESVKYIVSKVRTLSPEEGFDILKKAAVEFEGDPNIPELEYEEL 130

Query: 154 VKLSELNPVTLHPFEEDALELKAVAGLLHFHSPYKAVRACVSPQDDYESPVETFRSYFLA 213
            K  +   ++    E +  EL+ +A ++ FHSPYK VRA V   DD   PVETFRSYFLA
Sbjct: 131 QKFGKAEDISQFN-EIEIFELRTLAAMIKFHSPYKEVRAVVEATDDPNIPVETFRSYFLA 189

Query: 214 LVWAIIGSGFNEFFAHRLMVITISSSMVQLLLFPMGSLWAKIMPYWSFPIWKGKRIHLNI 273
           L+ AI+GSGFNEFF+HR++ I++++S++Q+ L+  G  W + +P W   + KG++  +NI
Sbjct: 190 LLCAIVGSGFNEFFSHRVVTISVNTSVIQMFLYFFGKAWERYIPCWGISV-KGRKYAINI 248

Query: 274 PQPWSQKEQMFSTVLFSIAVSSFYMDSVILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFA 333
            +PW+ KEQMF+T+LF+I   +FY    ILT K++YKE V FGYQF+ S++VQFLGFGFA
Sbjct: 249 DKPWTAKEQMFATLLFAICSGTFYTHYNILTQKVYYKEDVPFGYQFWLSLSVQFLGFGFA 308

Query: 334 GSLRRFVIYPSHAIWPSQLQTMALNKALFSKKTEKGGRGLTSQTFFYICVAFTFFYEWLP 393
           G LRR+V+Y   A+WP+ + T+ALNKAL   K +KG  G++   FF+I  +  F Y W P
Sbjct: 309 GILRRYVVYNPRALWPTVMTTLALNKALLDNKQDKG-NGMSRYKFFFITFSAMFIYNWFP 367

Query: 394 TYLFQILSTFNWMTWIKPDNFNLAMVTGSMGGVGINPIASFDWNVINYYSALVTPLFSYA 453
           TY+  IL+TFNWMTWI P N  LA++TG + G+G NP  SFDWNV++  S L+ P +S  
Sbjct: 368 TYIINILNTFNWMTWISPQNLKLALITGGVSGLGFNPFPSFDWNVVSNVSPLIIPFYSNM 427

Query: 454 NQMAGGLIAAICVLAIYYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQ 513
            Q  G   AA+ ++A+Y++N  DCQYLPMF+N LFTN  T Y++T+I+NS  ++D  KYQ
Sbjct: 428 TQFCGAFFAALVIIAVYFTNYKDCQYLPMFTNPLFTNKATVYEITNILNSDFKIDEKKYQ 487

Query: 514 NYSPPYYSAGNLFCYGVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYS 573
            YS PYY+AGNL  YG FIA YPLL  YSF+T W++L  AF  W +++WS    + W  +
Sbjct: 488 EYSAPYYTAGNLVAYGSFIALYPLLIVYSFITDWELLSGAFGLWINSLWSFRSWNQWKKT 547

Query: 574 WRESSHALEEFHDPHSRMMRRYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMA 633
           + +   A++ + D HS MM+ Y EVPDWWY+I+LI SI++ I   E Y TNTPIW+LF++
Sbjct: 548 FSKQYSAMDSYDDAHSNMMKNYAEVPDWWYFIILICSIIVAICVCEKYQTNTPIWALFVS 607

Query: 634 VGLNAVFLIPITILEATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSY 693
           +G N  FLIP+TILEATT    GLN+LIE+I+GYALPGNP ALML+KAFGYNIDGQAD+Y
Sbjct: 608 IGFNFAFLIPLTILEATTGFSFGLNLLIEMIIGYALPGNPLALMLVKAFGYNIDGQADNY 667

Query: 694 VGNLKLGHYSKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDA 753
           V NLK+GHYSKIPP+ALFRGQ+ MV IQ  V+LGVLNWSISNIK +C   Q +KFTCPDA
Sbjct: 668 VSNLKMGHYSKIPPVALFRGQLIMVFIQIFVNLGVLNWSISNIKGFCTRTQSAKFTCPDA 727

Query: 754 ITYYNASVLWGAIGPKRIFEGVYPILKWCWXXXXXXXXXXXXXXXXXPRFYPLWFNPLLV 813
            TYYNASV+WGA+GPK+IF  VYPIL+WCW                  ++YP WFNP+L 
Sbjct: 728 QTYYNASVVWGALGPKKIFNEVYPILRWCWLIGALIGLFFGIWRRFGSKYYPNWFNPVLF 787

Query: 814 VGGMLNMAPPYNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQTGLVXXXXXX 873
           VGGM N++PPY L Y  PG + N+FSQ+YM++ HLR+W KYNY+L +GF +GLV      
Sbjct: 788 VGGMSNLSPPYGLMYFIPGIVVNWFSQYYMKRNHLRLWSKYNYILDSGFTSGLVLSAIII 847

Query: 874 XXXVQYKEKPISWWGNDVINNGLDAAGPPKKNVSLTPRGYFGPEYGHFP 922
              VQ+K+  +SWWGN+V  NG+DA   P +NVS  PRGYFGPE GH P
Sbjct: 848 FFAVQFKDTELSWWGNNVPYNGVDANTIPLRNVSALPRGYFGPELGHLP 896

>YPR194C Chr16 complement(924304..926937) [2634 bp, 877 aa] {ON}
           OPT2Oligopeptide transporter; member of the OPT family,
           with potential orthologs in S. pombe and C. albicans;
           also plays a role in formation of mature vacuoles
          Length = 877

 Score =  931 bits (2406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/838 (52%), Positives = 599/838 (71%), Gaps = 7/838 (0%)

Query: 87  SDEQWTVLLKKAGFDNPDNITDIPADLKYVASQIVNMSLEEAAEVLKLGAEYHADDPNLS 146
           +DEQ    +KK G++N   + DIP D+ Y+  ++  ++LE++ ++LK    Y  DD N+ 
Sbjct: 45  TDEQILHFMKKLGYEN-RTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDENIP 103

Query: 147 SDEYNDFVKLSELNPVTLHPF--EEDALELKAVAGLLHFHSPYKAVRACVSPQDDYESPV 204
            D+Y ++ +L +L  +       E D+ +++A A  + FHSPY+ VRA V P+DD   PV
Sbjct: 104 HDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVRAVVDPEDDPTIPV 163

Query: 205 ETFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSMVQLLLFPMGSLWAKIMPYWSFPIW 264
           ETFR+YFLA++W++IGSGFNEFF+HR++ I++++ ++Q+ L+  G  WAK +P W+  I 
Sbjct: 164 ETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPIIQMFLYICGKAWAKTIPCWTITI- 222

Query: 265 KGKRIHLNIPQPWSQKEQMFSTVLFSIAVSSFYMDSVILTLKMFYKEKVSFGYQFFTSIA 324
           +G++  +NI +PW+QKEQMFST+L++I   +FY    ILT K+FY    SFGYQF  S++
Sbjct: 223 RGRKYGINIDKPWTQKEQMFSTLLYAICQGAFYTHYNILTQKLFYHSAFSFGYQFLLSLS 282

Query: 325 VQFLGFGFAGSLRRFVIYPSHAIWPSQLQTMALNKALFSKKTEKGGRGLTSQTFFYICVA 384
           VQF+GFGFAG LR+FV+YP+ A+WP+ + T+A+NKAL  K  EK   G++   FF++   
Sbjct: 283 VQFIGFGFAGILRKFVVYPARALWPTVMPTIAINKALLGK--EKHESGMSRYKFFFLTFF 340

Query: 385 FTFFYEWLPTYLFQILSTFNWMTWIKPDNFNLAMVTGSMGGVGINPIASFDWNVINYYSA 444
             F Y W PTY+  IL+TFNWMTWIKP N NLA +TG + G+GINPI+SFDWNVI++ S 
Sbjct: 341 IMFIYNWFPTYIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP 400

Query: 445 LVTPLFSYANQMAGGLIAAICVLAIYYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSK 504
           LV P +SY  Q  G ++AA+ V+A+YYSN   CQYLP+F+N+L+TNTG  + VT +++S 
Sbjct: 401 LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGHSFKVTEVLDSD 460

Query: 505 AEVDVNKYQNYSPPYYSAGNLFCYGVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSL 564
            ++DV KYQ+YSPPYYSAGNL  YG FI +YPL+  +SF+   K+L  AFKDWA  +W++
Sbjct: 461 NKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFIVHSKLLFNAFKDWALNLWAM 520

Query: 565 TKKHTWLYSWRESSHALEEFHDPHSRMMRRYNEVPDWWYYIVLILSIVIGIAALEGYHTN 624
            K  +W+  ++    AL+++ DPHS  M+ Y EVPDWWY+ +LI S+V+GIA +E Y TN
Sbjct: 521 RKLKSWVTMFKSDYRALDDYDDPHSNAMKNYKEVPDWWYFAILIGSLVVGIAVVEHYPTN 580

Query: 625 TPIWSLFMAVGLNAVFLIPITILEATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGY 684
           TP+W LF+ +G N VFLIP TIL+ATT    GLN+LIE++MGYALPGNP A+M++KAFGY
Sbjct: 581 TPVWGLFVCLGFNFVFLIPTTILQATTGYSFGLNLLIEMVMGYALPGNPIAIMILKAFGY 640

Query: 685 NIDGQADSYVGNLKLGHYSKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQ 744
           NIDGQAD+YV NLK+ HY KIPPMALFRGQ  +V IQ  V+LGVLNW ISNIKD+C P+Q
Sbjct: 641 NIDGQADNYVSNLKIAHYCKIPPMALFRGQCVIVFIQIFVNLGVLNWQISNIKDFCTPHQ 700

Query: 745 ESKFTCPDAITYYNASVLWGAIGPKRIFEGVYPILKWCWXXXXXXXXXXXXXXXXXPRFY 804
            +KFTCPDA+TYYNASV+WGAIGPKRIF  +YPI KWCW                  +FY
Sbjct: 701 NAKFTCPDAVTYYNASVVWGAIGPKRIFNYIYPIFKWCWLIGACIGIFFGVWKRWG-KFY 759

Query: 805 PLWFNPLLVVGGMLNMAPPYNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQT 864
           P +F+P+L VGGMLNM+PPYNL Y T G I ++ SQ+YM+++HL +W+KYNYVL AGF T
Sbjct: 760 PRYFDPMLFVGGMLNMSPPYNLMYYTSGMIVSYISQYYMKRHHLNLWEKYNYVLSAGFST 819

Query: 865 GLVXXXXXXXXXVQYKEKPISWWGNDVINNGLDAAGPPKKNVSLTPRGYFGPEYGHFP 922
           GLV         VQYK+   +WWGN V   G D  G P KN++ T  GYFG   GH+P
Sbjct: 820 GLVLSAIIIFFAVQYKDTAFNWWGNTVPYAGADGVGYPLKNITDTANGYFGYAPGHYP 877

>Ecym_2739 Chr2 complement(1430077..1432680) [2604 bp, 867 aa] {ON}
           similar to Ashbya gossypii ADL399C /ACL205C /AGL027W
          Length = 867

 Score =  870 bits (2247), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/872 (47%), Positives = 591/872 (67%), Gaps = 15/872 (1%)

Query: 54  EKVDGDFGNT-TNYYSDKPEIGVVETIISPSGKVSDEQWTVLLKKAGFDNPDNITDIPAD 112
           EK +G      +  Y  + E+   E+        S E    +++K G+ N ++  +IP+ 
Sbjct: 8   EKTNGQLSEKDSKTYGLRDEVVEAESF---EALASGELLYFVMRKMGYQNMEH-EEIPSS 63

Query: 113 LKYVASQIVNMSLEEAAEVLKLGAEYHADDPNLSSDEYNDFVKLSELNPVTLHPFEE-DA 171
           + ++AS++ N+S+++A  +L+     + DDPN+ +DEY   ++  +    + +P  E D 
Sbjct: 64  VSFIASKVTNLSVDDAVNILRKAVLEYRDDPNIPADEYEIIMRFED---SSYYPSGEVDQ 120

Query: 172 LELKAVAGLLHFHSPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFFAHRL 231
           LE++ +A L+ +HSPY  VR+ VSP DD   P+ETFR+YF+A  W+++GSGFNEFF HR 
Sbjct: 121 LEVRMIAALIRYHSPYTEVRSMVSPTDDPSIPIETFRAYFIATFWSVVGSGFNEFFRHRQ 180

Query: 232 MVITISSSMVQLLLFPMGSLWAKIMPYWSFPIWKGKRIHLNIPQPWSQKEQMFSTVLFSI 291
           + I+I ++ VQLL+ P+G LWA  +P W F + +G+R  +N+P+PWS+KEQMF+T+L+SI
Sbjct: 181 VPISIETAAVQLLICPIGKLWANKVPLWGFTV-RGRRFAINVPEPWSEKEQMFATLLYSI 239

Query: 292 AVSSFYMDSVILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPSHAIWPSQ 351
            + SFY    ILT+K +Y + VS+ +Q   SI++QF+GFGFAG LRRFV+YP+ A+WPS 
Sbjct: 240 TLGSFYSSFNILTMKKYYNDDVSYLFQLLLSISLQFMGFGFAGVLRRFVVYPAKAVWPSC 299

Query: 352 LQTMALNKALFSKKTEKGGRGLTSQTFFYICVAFTFFYEWLPTYLFQILSTFNWMTWIKP 411
           L ++A+NKAL S+K + GG  L+ Q FFYI +   F Y W+PT L   L+ FNWMTW+ P
Sbjct: 300 LPSIAVNKALLSRKDKSGG--LSIQNFFYISLGVLFAYNWIPTVLAGFLANFNWMTWLAP 357

Query: 412 DNFNLAMVTGSMGGVGINPIASFDWNVINYYSALVTPLFSYANQMAGGLIAAICVLAIYY 471
           +NFNLA +TG   G+  NP+ SFD N I Y++ LVTP F+Y++   G +IA++ V+A+YY
Sbjct: 358 NNFNLAAITGGSTGLAYNPLPSFDLNAIAYFTPLVTPFFAYSHIYIGAVIASLVVIALYY 417

Query: 472 SNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPPYYSAGNLFCYGVF 531
           SN  + QYLP+FS +L+TN  T+Y+++ I+    +VD  KYQ YSPPYYSAG L  YG F
Sbjct: 418 SNYMESQYLPVFSQSLYTNKATKYNISEIL-VDYKVDEAKYQTYSPPYYSAGVLVSYGSF 476

Query: 532 IASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSHALEEFHDPHSRM 591
           +  Y ++F ++ + +++VL  AF+DW  A+ SL  K +W+  W    H L EF D HSR+
Sbjct: 477 LCFYTMVFGFAIIDEFRVLYEAFRDWFFALLSLRHKKSWIDMWASDYHVLSEFDDAHSRL 536

Query: 592 MRRYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNAVFLIPITILEATT 651
           MR Y EVPDWW+++VL+++I   I  +E +++ TP+W LF+++GLN +FLIP+T L A T
Sbjct: 537 MRNYKEVPDWWFFVVLVVAIAFAIIVIECFNSQTPLWLLFLSIGLNFIFLIPLTTLHART 596

Query: 652 ALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSYVGNLKLGHYSKIPPMALF 711
               GLN+L+E+I+GY LPGNP ALMLIKAFGYNIDGQAD+Y+ N+K+ HY KI P+ALF
Sbjct: 597 TFTAGLNLLVEMIVGYILPGNPYALMLIKAFGYNIDGQADNYISNMKVAHYCKISPVALF 656

Query: 712 RGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAITYYNASVLWGAIGPKRI 771
           RGQ+ MV IQ  V+L V+NW  SNI  +C  +Q +KF+CPD  TYYNASV+WGA+GP++I
Sbjct: 657 RGQLVMVFIQIFVNLFVVNWQFSNISGFCDEHQPAKFSCPDIRTYYNASVMWGAMGPQKI 716

Query: 772 FEGVYPILKWCWXXXXXXXXXXXXXXXXXPRFYPLWFNPLLVVGGMLNMAPPYNLTYMTP 831
           F  VYP LKWCW                  +FYP  FNP+L++ GML+ +PPYN+ Y TP
Sbjct: 717 FTKVYPQLKWCWAIGAVIGVGCALWKKYG-KFYPRSFNPILIIIGMLSFSPPYNMVYFTP 775

Query: 832 GAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQTGLVXXXXXXXXXVQYKEKPISWWGNDV 891
           G I NF SQFYM++Y LRIW+KYNYVL    + GLV         +QY +  ++WWGN V
Sbjct: 776 GFIVNFISQFYMKRYRLRIWEKYNYVLEGALKCGLVFSSLVIFAAIQYNDYQLNWWGNSV 835

Query: 892 INNGL-DAAGPPKKNVSLTPRGYFGPEYGHFP 922
               + +     K NVSLT +GYFGP+ G+FP
Sbjct: 836 PETSVYERTYISKLNVSLTEKGYFGPDPGNFP 867

>ADL399C Chr4 complement(3872..6529) [2658 bp, 885 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR194C
           (OPT2)
          Length = 885

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/841 (48%), Positives = 551/841 (65%), Gaps = 11/841 (1%)

Query: 86  VSDEQWTVLLKKAGFDNPDNITDIPADLKYVASQIVNMSLEEAAEVLKLGAEYHADDPNL 145
           ++++Q   +  + G+++  ++  IP  ++Y+ S++ ++ +E+  E++ +  + H  DPNL
Sbjct: 51  LTEDQLIYITTRMGYEHATDLEHIPESVRYLESKLADLDVEKCCEIIDVHIKEHDQDPNL 110

Query: 146 SSDEYNDFVKLSELNPVTLHPFEEDALELKAVAGLLHFHSPYKAVRACVSPQDDYESPVE 205
           S++++ND V+ S+ +    +P  +   ELK VA + H++SPY  VRA  SP DD   PVE
Sbjct: 111 STEDWNDLVRFSKRDFDPKNP--QQVFELKVVAAIFHYYSPYVEVRAVASPVDDPTIPVE 168

Query: 206 TFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSMVQLLLFPMGSLWAKIMPYWSFPIWK 265
           TFR+YFLA +W +IGSGFN FFA R   I++    VQ+L++P   LW ++MP W F ++ 
Sbjct: 169 TFRAYFLATLWVVIGSGFNMFFAQRQPAISLGVFAVQMLVYPCAVLWVRVMPCWGFKVF- 227

Query: 266 GKRIHLNIPQPWSQKEQMFSTVLFSIAVSSFYMDSVILTLKMFYKEKVSFGYQFFTSIAV 325
           G+RI LNI   WS+KEQMF T+L+SI   +FY +  I+T ++ YK  +S+ YQF  S ++
Sbjct: 228 GRRIALNIESQWSEKEQMFVTLLYSITNGAFYSEYNIVTQQIHYKSPMSYAYQFLLSFSL 287

Query: 326 QFLGFGFAGSLRRFVIYPSHAIWPSQLQTMALNKALFSKKTEKGGRGLTSQTFFYICVAF 385
           QFLGFG AG +RR+V+YPS A+WPS + T+ALNKAL S     G   +  +  FYI    
Sbjct: 288 QFLGFGLAGIMRRYVVYPSIALWPSSMTTIALNKALLSSDHSNG---IGRKKMFYITATA 344

Query: 386 TFFYEWLPTYLFQILSTFNWMTWIKPDNFNLAMVTGSMGGVGINPIASFDWNVINYYSAL 445
            F Y W PTYLF+ LSTFNWMTWIKPDNF+LA VTG + GVG+NPI++FDW  I   S+L
Sbjct: 345 IFVYNWFPTYLFEALSTFNWMTWIKPDNFSLATVTGGINGVGLNPISTFDWTNIGT-SSL 403

Query: 446 VTPLFSYANQMAGGLIAAICVLAIYYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKA 505
             P         GGL+AA+  L +YY N  +CQ+LP+F+ +L+ N  T Y V  I+    
Sbjct: 404 YLPFRVTLTTYLGGLLAALVTLGVYYMNYRECQFLPIFTQSLYNNRATSYRVEEILTEDR 463

Query: 506 EVDVNKYQNYSPPYYSAGNLFCYGVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLT 565
           ++D  K+Q Y  PYY+AGN+  YG F+  Y  L   S L Q     R +K W   +WSL 
Sbjct: 464 KLDEQKFQKYGFPYYTAGNIVAYGCFMCVYTALVVTSILQQGAFYGRVYKTWILDLWSLR 523

Query: 566 KKHTWLYSWRESSHALEEFHDPHSRMMRRYNEVPDWWYYIVLILSIVIGIAALEGYHTNT 625
           K  +W   +    H L++FHD HSRMMR+Y EVP+WWY  + I+SIVIGI  ++ + TNT
Sbjct: 524 KPSSWRAVFSNDKHVLDDFHDSHSRMMRKYKEVPEWWYMTIFIVSIVIGIIVVKVFKTNT 583

Query: 626 PIWSLFMAVGLNAVFLIPITILEATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYN 685
           P+W LF+AV LN V L+PIT+L+AT  + +GLN+L+++I G ALPGNP ALM IKAFGYN
Sbjct: 584 PVWGLFLAVALNFVLLLPITLLQATRGVTIGLNLLLQMISGLALPGNPYALMFIKAFGYN 643

Query: 686 IDGQADSYVGNLKLGHYSKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQE 745
           IDGQAD+Y+GN+KL HY+KIPP+ LFRGQ+ MVLIQ  V+LGV+NW + NI++YC P Q 
Sbjct: 644 IDGQADNYLGNMKLAHYAKIPPVPLFRGQLLMVLIQIFVNLGVINWQLHNIENYCDPKQR 703

Query: 746 SKFTCPDAITYYNASVLWGAIGPKRIFEGVYPILKWCWXXXXXXXXXXXXXXXXXPRF-- 803
            KFTCP   TY+NASV+WGAIGPKRIFE VYPI+KWCW                   +  
Sbjct: 704 FKFTCPGIRTYFNASVMWGAIGPKRIFEHVYPIMKWCWLIGACVGLFFGLWKKLSIMYKK 763

Query: 804 --YPLWFNPLLVVGGMLNMAPPYNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNYVLVAG 861
             YP  F+P++ + GML+  PPYNL Y T G    F S  YM++YHLR+W++YNYV+ AG
Sbjct: 764 IPYPDRFSPVIFIIGMLSFGPPYNLQYTTSGLYVGFISMCYMKRYHLRVWERYNYVVAAG 823

Query: 862 FQTGLVXXXXXXXXXVQYKEKPISWWGNDVINNGLDAAGPPKKNVSLTPRGYFGPEYGHF 921
              GLV         VQ+K   ISWWGN V   GLD A  P  NV+ T RGYFGPE G  
Sbjct: 824 ISCGLVFSAIVMFFTVQWKGVEISWWGNTVSYAGLDYARVPLLNVTETERGYFGPELGQI 883

Query: 922 P 922
           P
Sbjct: 884 P 884

>ACL205C Chr3 complement(1169..3841) [2673 bp, 890 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR194C
           (OPT2)
          Length = 890

 Score =  796 bits (2055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/828 (46%), Positives = 535/828 (64%), Gaps = 11/828 (1%)

Query: 86  VSDEQWTVLLKKAGFDNPDNITDIPADLKYVASQIVNMSLEEAAEVLKLGAEYHADDPNL 145
           ++DEQ   L+ + G+D+P +++D+PA ++Y+ S++  + +E+   ++ L  E H +D NL
Sbjct: 44  LTDEQLVYLISRMGYDHPRDLSDVPASVRYLESKLAELDIEKCLRIIDLSFEIHNEDFNL 103

Query: 146 SSDEYNDFVKLSELNPVTLHPFEEDALELKAVAGLLHFHSPYKAVRACVSPQDDYESPVE 205
            +D++ND V+ S+ +     P  +   ELK VAG+  ++SPY  VRA  SP DD   PVE
Sbjct: 104 KTDDWNDLVRFSKRDFDPEDP--QHVFELKTVAGIFEYYSPYVEVRAVASPVDDPTIPVE 161

Query: 206 TFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSMVQLLLFPMGSLWAKIMPYWSFPIWK 265
           TFR+YFLA  W ++GS    FF+ R   I +S S VQ+L++P G LWA++MP W F ++ 
Sbjct: 162 TFRAYFLATFWVVVGSALTMFFSERQPSIALSISAVQMLVYPCGLLWARLMPCWGFNVY- 220

Query: 266 GKRIHLNIPQPWSQKEQMFSTVLFSIAVSSFYMDSVILTLKMFYKEKVSFGYQFFTSIAV 325
           G+RI LNI  PW++KEQMF T+L+ I   SFY +  ILT  + Y+  + + YQ   SI +
Sbjct: 221 GRRIALNIDSPWTEKEQMFVTLLYGITTGSFYANYNILTQHIHYRSPMPYAYQLLLSIPL 280

Query: 326 QFLGFGFAGSLRRFVIYPSHAIWPSQLQTMALNKALFSKKTEKGGRGLTSQTFFYICVAF 385
           QFLGFG AG +R++V+YP+ A+WPS + T+ALNKA+ S +   GG G   +  FY+  A 
Sbjct: 281 QFLGFGLAGIMRKYVVYPATAMWPSIMTTIALNKAMMSDE-HSGGFG--RKKMFYLTFAI 337

Query: 386 TFFYEWLPTYLFQILSTFNWMTWIKPDNFNLAMVTGSMGGVGINPIASFDWNVINYYSAL 445
            F Y W PTYLF+ LSTFNW+TWIKPDNFNLA VTG + GVG+NP+++ DW  I      
Sbjct: 338 IFVYNWFPTYLFEALSTFNWITWIKPDNFNLATVTGGINGVGLNPLSTLDWTNIGV-GGF 396

Query: 446 VTPLFSYANQMAGGLIAAICVLAIYYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKA 505
             P         GGL+AA+  L +YY N  +CQ+LP+F+ +L+ N    Y V  I+    
Sbjct: 397 YLPFRVTLTMYMGGLLAALITLGVYYMNYSECQFLPIFTQSLYNNKAKVYQVEEILTEDR 456

Query: 506 EVDVNKYQNYSPPYYSAGNLFCYGVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLT 565
            +D  K+Q Y  PYY+AGN+  YG F+  Y  L   S L Q    +R +K W   +WSL 
Sbjct: 457 LLDEQKFQKYGFPYYTAGNMVAYGCFMCVYTALVVSSILQQGAFYMRVYKAWILDLWSLR 516

Query: 566 KKHTWLYSWRESSHALEEFHDPHSRMMRRYNEVPDWWYYIVLILSIVIGIAALEGYHTNT 625
            +     ++    H L+EFHDPH RMMR+Y EVP+WWY  + ++SIVIG+  +  + TNT
Sbjct: 517 TRSGLREAFSNEKHVLDEFHDPHCRMMRKYKEVPEWWYMSIFVVSIVIGVIVVTTFKTNT 576

Query: 626 PIWSLFMAVGLNAVFLIPITILEATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYN 685
           P+W LF+AVGLN + L+PIT+L+AT  + +GLN+L+++I G ALPGNP ALM IKAFGYN
Sbjct: 577 PVWGLFLAVGLNFILLLPITLLQATRGVTIGLNLLLQMISGLALPGNPYALMFIKAFGYN 636

Query: 686 IDGQADSYVGNLKLGHYSKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQE 745
           IDGQ D+Y+ N+K+ HY+KIPP+ LFRGQ+ MVLIQ  V+LGV+NW + N+++YC P Q 
Sbjct: 637 IDGQTDNYLSNMKMAHYAKIPPIPLFRGQLLMVLIQVFVNLGVINWQLHNVENYCDPKQR 696

Query: 746 SKFTCPDAITYYNASVLWGAIGPKRIFEGVYPILKWCWXXXXXXXXXXXXXXXXXPRF-- 803
            KFTCP   TY+NASV+WGAIGP+RIFE VYPI+KWCW                   +  
Sbjct: 697 FKFTCPGVRTYFNASVMWGAIGPRRIFEHVYPIMKWCWLIGACVGLFFGIWKRLSIMYDK 756

Query: 804 --YPLWFNPLLVVGGMLNMAPPYNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNYVLVAG 861
             YP  F+P++ + GML+  PPYNL Y T G    F S FY+++YHLRIW++YNYV+ A 
Sbjct: 757 IPYPRRFSPVIFIIGMLSFGPPYNLQYSTSGLYVGFISMFYLKRYHLRIWERYNYVIAAA 816

Query: 862 FQTGLVXXXXXXXXXVQYKEKPISWWGNDVINNGLDAAGPPKKNVSLT 909
              G+V         VQ+K+  ++WWGN +   GLD A  P  NV+ T
Sbjct: 817 ITCGVVFSAILMFFSVQWKDIELNWWGNSISYAGLDYARVPLLNVTET 864

>Smik_16.458 Chr16
           complement(787205..789133,789181..789306,789322..789348,
           789352..789837) [2568 bp, 855 aa] {ON} YPR194C (REAL)
          Length = 855

 Score =  789 bits (2038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/845 (47%), Positives = 557/845 (65%), Gaps = 41/845 (4%)

Query: 86  VSDEQWTVLLKKAGFDNPDNITDIPADLKYVASQIVNMSLEEAAEVLKLGAEYHADDPNL 145
            +DEQ    +KK G++N  ++ D+P D+ Y+  ++  ++LE + ++LK    Y+ DD N+
Sbjct: 44  CTDEQILHFMKKLGYEN-RSLYDVPEDVAYIFKKMPELTLEGSFKILKDSVIYYKDDENV 102

Query: 146 SSDEYNDFVKLSELNPVTLHPFEEDALELKAVAGLLHFHSPYKAV----RACVSPQDDYE 201
             ++Y ++ +L+ L  +      ++ L       L H   P   +    R  +S      
Sbjct: 103 PYNQYEEWKRLAALKDLD----SKEGLMSTIALILGHLLLPSNFILHIKRLGLSLILMTT 158

Query: 202 SPVET-FRSYFLALVWAIIGSGFNEFFA-HRLMVIT--ISSSMVQLLLFPMGSLWAKIMP 257
            P +  F   F  LV  ++ S   E+F  H ++ ++    +S+V+L              
Sbjct: 159 PPFQRRFEHIFWQLVPVLMSSFLTEWFRFHWILQLSRCFCTSVVKL-------------- 204

Query: 258 YWSFPIWKGKRIHLNIPQPWSQKEQMFSTVLFSIAVSSFYMDSVILTLKMFYKEKVSFGY 317
                   G+++    P   +QK+QMFST+L++I   +FY    ILT K+FY    SFGY
Sbjct: 205 --------GQKL---CPTGLTQKKQMFSTLLYAICQGAFYTHYNILTQKLFYHSAFSFGY 253

Query: 318 QFFTSIAVQFLGFGFAGSLRRFVIYPSHAIWPSQLQTMALNKALFSKKTEKGGRGLTSQT 377
           QF  S++VQF+GFGFAG LR+FV+YP+ A+WP+ + T+A+NKAL  K  E+   G++   
Sbjct: 254 QFLLSLSVQFIGFGFAGILRKFVVYPARALWPTVMPTIAINKALLGK--EEHESGMSRYK 311

Query: 378 FFYICVAFTFFYEWLPTYLFQILSTFNWMTWIKPDNFNLAMVTGSMGGVGINPIASFDWN 437
           FF++     F Y W PT++  IL+TFNWMTWIKP + NLA +TG + G+GINPI+SFDWN
Sbjct: 312 FFFLTFFVMFVYNWFPTFIINILNTFNWMTWIKPTSINLANITGGVTGLGINPISSFDWN 371

Query: 438 VINYYSALVTPLFSYANQMAGGLIAAICVLAIYYSNQFDCQYLPMFSNALFTNTGTEYDV 497
           VI++ S LV P +SY  Q  G ++AA+ V+A+YYSN   CQYLP+F+N+L+TNTG  + V
Sbjct: 372 VISFNSPLVYPFWSYLTQYLGCILAALIVIAVYYSNYMICQYLPIFTNSLYTNTGNSFKV 431

Query: 498 TSIINSKAEVDVNKYQNYSPPYYSAGNLFCYGVFIASYPLLFAYSFLTQWKVLLRAFKDW 557
           T I++S  ++DV KYQ+YSPPYY+AGNL  YG FI +YPL+  +SF+   K+L  AFKDW
Sbjct: 432 TKILDSDNKLDVKKYQSYSPPYYTAGNLVTYGAFICAYPLMITWSFIVHSKLLFNAFKDW 491

Query: 558 ASAIWSLTKKHTWLYSWRESSHALEEFHDPHSRMMRRYNEVPDWWYYIVLILSIVIGIAA 617
              +W+L K  TW   ++ +   L+++ DPHS  M+ Y EVPDWWY+ +LI S+++GIA 
Sbjct: 492 TLNLWALRKLTTWAIMFKNNYRLLDDYDDPHSNAMKNYREVPDWWYFAILIASLIVGIAV 551

Query: 618 LEGYHTNTPIWSLFMAVGLNAVFLIPITILEATTALQLGLNVLIEIIMGYALPGNPQALM 677
           +E Y TNTP+W LF+++G N VFLIP TIL+ATT    GLN+LIE++MGYALPGNP A+M
Sbjct: 552 VEHYPTNTPVWGLFVSLGFNFVFLIPTTILQATTGYSFGLNLLIEMVMGYALPGNPVAIM 611

Query: 678 LIKAFGYNIDGQADSYVGNLKLGHYSKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIK 737
           ++KAFGYNIDGQAD+YV NLK+ HY KIPPMALFRGQ  +VLIQ  V+LGVLNW ISNIK
Sbjct: 612 ILKAFGYNIDGQADNYVSNLKIAHYCKIPPMALFRGQCIIVLIQIFVNLGVLNWQISNIK 671

Query: 738 DYCQPNQESKFTCPDAITYYNASVLWGAIGPKRIFEGVYPILKWCWXXXXXXXXXXXXXX 797
           D+C P+Q +KFTCPDA+TYYNASV+WGAIGPKRIF  +YPI+KWCW              
Sbjct: 672 DFCTPHQNAKFTCPDAVTYYNASVVWGAIGPKRIFNYIYPIIKWCWLIGACIGILFGVWK 731

Query: 798 XXXPRFYPLWFNPLLVVGGMLNMAPPYNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNYV 857
               +FYP +F+P+L VGGMLNM+PPYNL Y T G I ++ SQ+YM+++HL +W+KYNYV
Sbjct: 732 RWG-KFYPKYFDPMLFVGGMLNMSPPYNLMYYTSGMIVSYISQYYMKRHHLNLWEKYNYV 790

Query: 858 LVAGFQTGLVXXXXXXXXXVQYKEKPISWWGNDVINNGLDAAGPPKKNVSLTPRGYFGPE 917
           L AGF TGLV         VQYK+   +WWGN V   G D  G P KN++ T +GYFG  
Sbjct: 791 LSAGFSTGLVLSAIIIFFAVQYKDTAFNWWGNTVPYAGADGVGYPLKNITDTAKGYFGYA 850

Query: 918 YGHFP 922
            GH+P
Sbjct: 851 PGHYP 855

>AGL027W Chr7 (657958..660591) [2634 bp, 877 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPR194C (OPT2)
          Length = 877

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/885 (43%), Positives = 540/885 (61%), Gaps = 21/885 (2%)

Query: 41  KHEVRETNSSIESEKVDGDFGNTTNYYSDKPEIGVVETIISPSGKVSDEQWTVLLKKAGF 100
           K+  R  +    + + DG  G+     SD  E+ +++          DE   +LL K G+
Sbjct: 11  KNSDRLPSPCAPASEKDGKAGSQDVPLSDTQELSLLD----------DEHLILLLHKMGY 60

Query: 101 DNPDNITDIPADLKYVASQIVNMSLEEAAEVLKLGAEYHADDPNLSSDEYNDFVKLSELN 160
            + D + DIP  + Y+ ++I  +++E++  +LK  A  HA DPN++ +E  D  + +  +
Sbjct: 61  KHAD-LEDIPPVVHYLVARINELTIEKSLTILKKCAVDHAGDPNITEEEATDLERFTSGD 119

Query: 161 PVTLHPFEEDALELKAVAGLLHFHSPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIG 220
               H  E +  +LK +A L ++HSPY  VRA V P DD   PVETFR YFL     IIG
Sbjct: 120 --FDHTDETEVFQLKLLAALFYYHSPYPEVRAVVGPGDDPTIPVETFRCYFLTTTITIIG 177

Query: 221 SGFNEFFAHRLMVITISSSMVQLLLFPMGSLWAKIMPYWSFPIWKGKRIHLNIPQPWSQK 280
            G   FF  R  +I  SS   Q L F +G+LW+K MP    PI+ G    LN+   WS+K
Sbjct: 178 CGLTTFFQSRYPLIEFSSMAAQFLFFILGTLWSKFMPAVRIPIFPGYGFQLNLQTSWSKK 237

Query: 281 EQMFSTVLFSIAVSSFYMDSVILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFV 340
           EQMF+T+L+SI    FY    ILT  MFY +  S G+Q   S+++QF+GFG AG LR FV
Sbjct: 238 EQMFATLLYSITTGVFYSYFNILTQDMFYNDPTSLGFQIILSLSLQFMGFGLAGLLRPFV 297

Query: 341 IYPSHAIWPSQLQTMALNKALFSKKTEKGGRGLTSQTFFYICVAFTFFYEWLPTYLFQIL 400
           ++P+ A+WP  + T+ALN AL ++   KG      + FFY  +   F Y W PT    +L
Sbjct: 298 VFPARALWPLSMPTIALNNALLAQDVGKGTS--IRKVFFYFGIGM-FIYNWFPTVFADVL 354

Query: 401 STFNWMTWIKPDNFNLAMVTGSMGGVGINPIASFDWNVINYYSALVTPLFSYANQMAGGL 460
           S  NW+TWIKP+NFNLA +TG   G+  NP+ + DWN I ++ AL  P ++   Q  G L
Sbjct: 355 SNLNWLTWIKPNNFNLAAITGGRYGIATNPLPTLDWNYITHW-ALALPFYTVFLQYLGSL 413

Query: 461 IAAICVLAIYYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPPYY 520
           ++ + ++A+YY+N  +CQYLP+F   L++N G  +D + ++ +  ++D  KYQ YS PYY
Sbjct: 414 LSVVIIIAVYYTNYMECQYLPIFGQPLYSNEGKFFDASKVL-TDFKLDWQKYQQYSLPYY 472

Query: 521 SAGNLFCYGVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSHA 580
           SAGN+  YG FI+ Y LL AYS +T++++L  A K     +WSLTK  TW    +  S  
Sbjct: 473 SAGNIVGYGSFISLYTLLAAYSIITEYEILGGACKRLGVGLWSLTKLDTWRNLHKNDSSI 532

Query: 581 LEEFHDPHSRMMRRYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNAVF 640
           LE + D H R MR+Y EVP+WW++ + ++S+V+ I  +  Y TNTP+W +F+AVGLN  F
Sbjct: 533 LEGYDDAHCREMRKYPEVPEWWFFAIFLISLVLAIILVTTYKTNTPVWGIFLAVGLNVAF 592

Query: 641 LIPITILEATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSYVGNLKLG 700
           L+P+T L++TT   LGLN+L+++I GY LPGNP ALM+IKAFGYNIDGQAD+Y+ NLK+ 
Sbjct: 593 LLPLTTLQSTTGASLGLNLLVQMITGYLLPGNPYALMIIKAFGYNIDGQADNYLSNLKMA 652

Query: 701 HYSKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAITYYNAS 760
           HY KIPP+ LFRGQ+ MVL+Q +VSL V+NW I N+ D+C P   S F C    TYYNAS
Sbjct: 653 HYCKIPPVPLFRGQLSMVLLQVIVSLAVINWQIHNVPDFCNPKNRSGFICQGPRTYYNAS 712

Query: 761 VLWGAIGPKRIFEGVYPILKWCWXXXXXXXXXXXXXXXXXPR---FYPLWFNPLLVVGGM 817
           ++WG IGPK++F  +YP++KWCW                  +   +YP  FNP++ V GM
Sbjct: 713 IVWGIIGPKKVFSYLYPMMKWCWLIGALLGVLFGGWCRLSRKYKLYYPRSFNPVVFVTGM 772

Query: 818 LNMAPPYNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQTGLVXXXXXXXXXV 877
           +++ PPYNL   T      F  Q+++R+YHLRIW+KYNYV+ A F  G++         +
Sbjct: 773 ISLMPPYNLRVYTSKLYVAFIGQYWLRRYHLRIWEKYNYVVAAAFNCGVIFSAITIFFAI 832

Query: 878 QYKEKPISWWGNDVINNGLDAAGPPKKNVSLTPRGYFGPEYGHFP 922
           QY E  + W  N + + G+DA   P K+V LT RGYFGP  G  P
Sbjct: 833 QYPEIRLDWILNTINDVGIDATPTPLKDVKLTERGYFGPPRGSLP 877

>KLLA0D15378g Chr4 complement(1303787..1306396) [2610 bp, 869 aa]
           {ON} similar to uniprot|Q06593 Saccharomyces cerevisiae
           YPR194C OPT2 Oligopeptide transporter member of the OPT
           family with potential orthologs in S. pombe and C.
           albicans
          Length = 869

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/852 (41%), Positives = 513/852 (60%), Gaps = 38/852 (4%)

Query: 90  QWTVLLKKAGFDNPDNITD--IPADLKYVASQIVNMSLEEAAEVLKLGAEYHADDPNLSS 147
           ++T  + +A   +P++  D   P +++Y+ +    +S+EE+ ++L+   + H DD NL  
Sbjct: 37  EFTNAIVEACGHDPESFPDGIYPKEVEYMITVTKRLSIEESLKILEKTLKEHEDDANLPE 96

Query: 148 D---------EYNDFVKLSELNPVTLHPFEEDALELKAVAGLLHFHSPYKAVRACVSPQD 198
           D         + +D++K         H   E   + K  A ++H+HSPY  VR   SP D
Sbjct: 97  DLIERTRSLLDRDDYLKQG-------HSEFEWFEQCKIDAAMIHYHSPYPEVRTVTSPID 149

Query: 199 DYESPVETFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSMVQLLLFPMGSLWAKIMPY 258
           D   P+ETFR+YFL   W I+G+G NEFF HR   I++++ ++Q+LL+P G L+ ++MP 
Sbjct: 150 DETIPIETFRAYFLGFFWTILGAGVNEFFVHRKPKISLTAPVMQILLYPCGKLFERVMPN 209

Query: 259 WSFPIWKGKRIHLNI-PQPWSQKEQMFSTVLFSIAVSSFYMDSVILT--LKMFYKEK-VS 314
            +F   K  +I +N  P PWS KEQMFST++F++A S  Y+   I    L++FY  K + 
Sbjct: 210 HTF---KLGKISVNFNPGPWSFKEQMFSTIIFNVATSYTYVSHNIYVQRLEIFYNNKWLD 266

Query: 315 FGYQFFTSIAVQFLGFGFAGSLRRFVIYPSHAIWPSQLQTMALNKALFSKKTEKGGRG-- 372
           FGY+    +  Q LGFG+AG LR+FVIY    IWP+   T+ALN AL    +++   G  
Sbjct: 267 FGYEVLLMLCSQLLGFGYAGILRKFVIYNEKCIWPTLFPTLALNGALLKPDSKENINGWR 326

Query: 373 LTSQTFFYICVAFTFFYEWLPTYLFQILSTFNWMTWIKPDNFNLAMVTGSMGGVGINPIA 432
           +T   FF       F Y W+PTYLF+ LSTF+W+TW  P NF+LA+VTGS  G+G+NP+ 
Sbjct: 327 MTRYKFFLTFFVIMFIYNWIPTYLFEGLSTFSWLTWCSPKNFDLAVVTGSQYGLGLNPVP 386

Query: 433 SFDWNVINYYSALVTPLFSYANQMAGGLIAAICVLAIYYSNQFDCQYLPMFSNALFTNTG 492
           +FDWN+I+Y  AL  P FS  NQ  G  I    +L IYYSN     +LP+ SN +FTN G
Sbjct: 387 TFDWNIIDYNYALTIPFFSQLNQYIGTFIGFFAILGIYYSNYKWTAFLPLNSNDIFTNRG 446

Query: 493 TEYDVTSIINSKAEVDVNKYQNYSPPYYSAGNLFCYGVFIASYPLLFAYSFLTQWKVLLR 552
             Y V  I++  + +  +KYQ YSPPYYSAGNL  YG   A YP  F Y F T+W  +L+
Sbjct: 447 ESYVVQDILDENSMLVESKYQEYSPPYYSAGNLLVYGGIFAQYPFAFLYVFFTEWASILQ 506

Query: 553 AFKDWASAIWSLTKKHTWLYSWRESSHALEEFHDPHSRMMRRYNEVPDWWYYIVLILSIV 612
            FK     I +              S   + F DP +R+M++Y +VPDWW+ +VL++++V
Sbjct: 507 CFKQMYRQIKNFRNVSI-------KSSTYDGFDDPQTRLMKKYKDVPDWWFLVVLVVALV 559

Query: 613 IGIAALEGYHTNTPIWSLFMAVGLNAVFLIPITILEATTALQLGLNVLIEIIMGYALPGN 672
           +GI  ++ Y T TP+W LF  +G+N VFLIPI  + + T   + + V+ EII+GYALPGN
Sbjct: 560 LGILCIKLYPTQTPVWGLFFILGINFVFLIPICFIFSMTGFNMTMGVITEIIIGYALPGN 619

Query: 673 PQALMLIKAFGYNIDGQADSYVGNLKLGHYSKIPPMALFRGQMFMVLIQTLVSLGVLNWS 732
             ALM +K+ GY ID QA+SY+ + KL HY+KIP  A+F+GQ+  VLIQ  VSLGV++W 
Sbjct: 620 GLALMTLKSLGYTIDNQAESYIADQKLAHYAKIPQRAVFKGQLVGVLIQCFVSLGVISWQ 679

Query: 733 ISNIKDYCQPNQESKFTCPDAITYYNASVLWGAIGPKRIFEGVYPILKWCWXXXXXXXXX 792
           I N+KD C    E+KFTCP  + +Y++SV WG IGPKR+F G+YPILK+ +         
Sbjct: 680 IVNVKDICTSKAENKFTCPKEVNFYSSSVFWGVIGPKRVFNGLYPILKYTFLIGFLLCLL 739

Query: 793 XXXXXXXXPRFYPLWFNPLLVVGGMLNMAPPYNLTYMTPGAIANFFSQFYMRKYHLRIWQ 852
                   PR   L F+P +++GGM   A PYNL+Y+T G   +F   FY+++Y+ + W+
Sbjct: 740 CCAIKYFFPRQTRL-FHPTILIGGMQQFA-PYNLSYVTAGLYFSFGFMFYIKRYYTKWWE 797

Query: 853 KYNYVLVAGFQTGLVXXXXXXXXXVQYKEKPISWWGNDVINNGLDAAGPPK--KNVSLTP 910
           KYNYVL A F + +          V+YK KPI WWGN+++  G+D     +  KN++   
Sbjct: 798 KYNYVLAAAFSSAVAFSAIIIFFSVKYKPKPIDWWGNNIVGVGVDGGEGRQTLKNITSAF 857

Query: 911 RGYFGPEYGHFP 922
            GYFGP  G +P
Sbjct: 858 DGYFGPRKGSYP 869

>KLLA0E00419g Chr5 (28957..31341) [2385 bp, 794 aa] {ON} similar to
           uniprot|P40897 Saccharomyces cerevisiae YJL212C OPT1
           Plasma membrane transporter that transports tetra- and
           pentapeptides and glutathione member of the OPT family
          Length = 794

 Score =  360 bits (925), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 241/813 (29%), Positives = 395/813 (48%), Gaps = 61/813 (7%)

Query: 106 ITDIPADLKYVASQIVNMSLEEAAEVLKLGAEYHADDPNLSSDEYNDFVKLSELNPVTLH 165
           + D+  +  ++ S   N++LE+    L++       D  L S                  
Sbjct: 19  LLDVGQERSFINSSDDNLNLEDKKRGLEVNVFAARSDYLLGSQ----------------- 61

Query: 166 PFEEDALELKAVAGLLHFHSPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNE 225
               + +E +    ++   S Y  VRA V   DD   P  T R + + ++ A +GSG N 
Sbjct: 62  -LSHEVIEDEYAGIVVEDDSAYPEVRAAVPSSDDPTLPQNTVRMWVIGMLMATVGSGLNL 120

Query: 226 FFAHRLMVITISSSMVQLLLFPMGSLWAKIMPYWS-FPIWKGKRIHLNIPQPWSQKEQMF 284
            F+     I +S+ +  +L +P+G  W K+MP    F  + G  ++   P P++ KE   
Sbjct: 121 LFSLHSPSIVLSAFVTSILAWPIGKAWDKVMPDVKLFGRFGGPSLN---PSPFNLKEHCL 177

Query: 285 STVLFSIAVSS--FYMDSVILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIY 342
             ++ +++      Y   + L +  +++    +G+   T +A Q +GF  AG ++  +I 
Sbjct: 178 IQIMANVSFGGGEAYATDIFLAMNNYFEADFGWGFDIVTILATQCIGFALAGLVKDILIT 237

Query: 343 PSHAIWPSQLQTMA-LNKALFSKKTEKGGRGLTSQTFFYICVAFTFFYEWLPTYLFQILS 401
           P+  IWPS L T   L     ++     G  ++   FF++     F Y W P ++FQ LS
Sbjct: 238 PASMIWPSNLVTCTFLTNLHINENHMANGWKISRLKFFFMVFIIGFVYYWFPGFIFQALS 297

Query: 402 TFNWMTWIKPDNFNLAMVTGSMGGVGINPIASFDWNVINYY--SALVTPLFS-YANQMAG 458
            F W+TWI+PDN  +  + G+  G+GI P+ +FDWN I  Y  S LV P+ + ++  ++ 
Sbjct: 298 YFAWVTWIRPDNVIINQIFGASTGLGIIPL-TFDWNQIAGYVGSPLVPPVSTIFSILLSM 356

Query: 459 GLIAAICVLAIYYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPP 518
            +I  + V AI+YSN +  +YLP+  +  +      Y+V+ I+      D++ Y++YSP 
Sbjct: 357 IMIFWVTVPAIHYSNVWFGKYLPISDSGSYDRFQQSYNVSKIVTPNLSFDIDAYKSYSPL 416

Query: 519 YYSAGNLFCYGVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESS 578
           Y  A  +  YG+  AS      ++ L   K +  AF++         KK           
Sbjct: 417 YLPATFVISYGMSFASNTATLVHAGLFHGKEITGAFRN--------VKK----------- 457

Query: 579 HALEEFHDPHSRMMRRYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNA 638
               E  D H+R+M+ Y +VP WWY IV ++   + IA +  ++T  P+W+L  A+ +  
Sbjct: 458 ----EQEDIHNRLMKNYRDVPHWWYGIVFLVFFGLAIAGIRAWNTEMPVWALIFALVIAG 513

Query: 639 VFLIPITILEATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSYVGNLK 698
           VFL+PI I+ A T++ +GLNVL E I+GY LPG P A+M  K FGY  + QA +Y  ++K
Sbjct: 514 VFLVPIGIICAVTSISVGLNVLTEFIIGYILPGKPIAMMFFKTFGYITNHQAVTYAQDMK 573

Query: 699 LGHYSKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAITYYN 758
           LGHY KI P  +F  Q    +  ++V + VL W+  NI D C  +Q+S FTCP+A  ++N
Sbjct: 574 LGHYMKIAPRLMFSAQFIATVWSSVVQVCVLKWAQGNITDVCDAHQKSHFTCPNARVFFN 633

Query: 759 ASVLWGAIGPKRIFEG--VYPILKWCWXXXXXXXXXXXXXXXXXPRFYPLWFN-PLLVVG 815
           A+++WG IGP+R+F    +Y  + W +                 P+    + N P+   G
Sbjct: 634 AAIIWGVIGPQRMFSSGQLYSKVLWFFLIGASLPLINWLVLKKWPKSPIKYLNWPVFFSG 693

Query: 816 -GMLNMAPPYNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQTGLVXXXXXXX 874
            G++  A PYN  Y +   +   F  F  RK+    W KYNY L A     L        
Sbjct: 694 TGLIPPATPYN--YGSYCMVGITFGYFIKRKW-FHWWTKYNYSLSAALDISLAWSSLMIF 750

Query: 875 XXVQYKEKPI-SWWGNDVINNGLDAAGPPKKNV 906
             +        +WWGN VI+  +D  G   +++
Sbjct: 751 FCLTLTNTNAPNWWGNTVIDT-IDYEGTAIQSI 782

>SAKL0G15224g Chr7 complement(1311409..1313826) [2418 bp, 805 aa]
           {ON} similar to uniprot|P40897 Saccharomyces cerevisiae
           YJL212C OPT1 Plasma membrane transporter that transports
           tetra- and pentapeptides and glutathione member of the
           OPT family
          Length = 805

 Score =  353 bits (907), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 236/765 (30%), Positives = 368/765 (48%), Gaps = 69/765 (9%)

Query: 155 KLSELNPVTLHPFEEDALELKAVAGLLHFHSPYKAVRACVSPQDDYESPVETFRSYFLAL 214
           + +E +P++       ALE +     +   SPY  VRA V   DD   P  T R + L L
Sbjct: 62  RSAEYDPLS-EKLSAAALEDEYAGITIEDDSPYPEVRAAVPSTDDPLLPQNTVRMWTLGL 120

Query: 215 VWAIIGSGFNEFFAHRLMVITISSSMVQLLLFPMGSLWAKIMP-YWSFPIWKGKRIHLNI 273
           +   IG   N  F+     I +++ +  +L +P+G  W + +P    F  + G  ++   
Sbjct: 121 IMTTIGCALNMLFSLHSPSIVLTTFVTSILAWPLGKAWERFIPDVRVFGKYGGPSLN--- 177

Query: 274 PQPWSQKEQMFSTVLFSIAVS--SFYMDSVILTLKMFYKEKVSFGYQFFTSIAVQFLGFG 331
           P P++ KE    T++ +++    + Y   ++L +  FY +   +G+      + Q +GF 
Sbjct: 178 PGPFNLKEHALITIMGNVSFGGGNAYATDILLAMNNFYHKNFGWGFNLLAIWSTQCIGFA 237

Query: 332 FAGSLRRFVIYPSHAIWPSQLQTMALNKALFSKKTEKG-GRGLTSQTFFYICVAFTFFYE 390
            AG  +  ++ P+  +WPS L T      L   +  K  G  ++   FF++     F Y 
Sbjct: 238 MAGLAKDVLVTPASMVWPSNLVTCTFLTNLHVNENHKANGWTISRLKFFFLIFVIGFVYY 297

Query: 391 WLPTYLFQILSTFNWMTWIKPDNFNLAMVTGSMGGVGINPIASFDWNVINYY--SALVTP 448
           W P ++FQ LS F W+TWIKP+N  +  V G+  G+GI P+ +FDWN I  Y  S L+ P
Sbjct: 298 WFPGFIFQALSYFAWVTWIKPNNVIVNQVFGASTGLGIIPL-TFDWNQIAGYVGSPLIPP 356

Query: 449 ---LFSYANQMAGGLIAAICVLAIYYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKA 505
              +F+    M    I  + V AI+YSN +  +YLP+  +  +      Y+V+ I+    
Sbjct: 357 AGVIFTILLSMVS--IFWVVVPAIHYSNVWYGKYLPISDSGSYDRFQGSYNVSRIVGDNL 414

Query: 506 EVDVNKYQNYSPPYYSAGNLFCYGVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLT 565
             D   Y  YSP Y SA        F  SY + FA +  T     L   KD         
Sbjct: 415 TFDKAAYNKYSPLYLSA-------TFAISYGMSFASTTATVVHAALFHGKD--------- 458

Query: 566 KKHTWLYSWRESSHALEEFHDPHSRMMRRYNEVPDWWYYIVLILSIVIGIAALEGYHTNT 625
                   W +      E  D H+R+M++Y + P WWY IV ++   + IA + G++T  
Sbjct: 459 -------IWNQVRRVKTEEKDVHARLMQQYKDTPQWWYAIVFVVFFGLSIATIRGWNTEM 511

Query: 626 PIWSLFMAVGLNAVFLIPITILEATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYN 685
           P+++L +A+ + A FL+PI I+ A T + +GLNV+ E I+GY LPG P A+M  K FGY 
Sbjct: 512 PVFALVIALLIAAFFLLPIGIIYALTNISVGLNVITEFIIGYMLPGKPIAMMFFKTFGYI 571

Query: 686 IDGQADSYVGNLKLGHYSKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQE 745
            + QA ++  ++KLGHY K+ P  +F  Q    +  +LV + VL W+  NIKD C+P+Q+
Sbjct: 572 TNNQAITFAQDMKLGHYMKVAPRIMFSAQFVATIWGSLVQICVLKWAQGNIKDICEPHQK 631

Query: 746 SKFTCPDAITYYNASVLWGAIGPKRIFE---------------GVYPILKWCWXXXXXXX 790
           S FTCP +  ++NASV+WG IGP+R+F                 + PI+ W         
Sbjct: 632 SHFTCPGSRVFFNASVIWGVIGPQRMFSSGQMYNKVMYFFLLGALLPIVNWLILKKWPNS 691

Query: 791 XXXXXXXXXXPRFYPLWFNPLLVVGGMLNMAPPYNLTYMTPGAIANFFSQFYMRKYHLRI 850
                        +P++F+      G++  A PYN  Y     +  FF  +Y+++     
Sbjct: 692 LVRHLN-------WPVFFSGT----GLIPPATPYN--YGAYCMVGIFFG-YYVKQKWFHW 737

Query: 851 WQKYNYVLVAGFQTGLVXXXXXXXXXVQYKEKPI-SWWGNDVINN 894
           W KYNY L AG    L          +        SWWGN+VIN 
Sbjct: 738 WSKYNYSLSAGLDISLAWSSLMIFLCLSLTNTDAPSWWGNNVINT 782

>ABR156W Chr2 (692938..695328) [2391 bp, 796 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YJL212C (OPT1)
          Length = 796

 Score =  345 bits (884), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 235/768 (30%), Positives = 355/768 (46%), Gaps = 69/768 (8%)

Query: 168 EEDALELKAVAGLLHFHSPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFF 227
           E D+ E   V  L+   SPY  VRA V   DD      T R + + L+   IGS  N  F
Sbjct: 57  EGDSGEFTDV--LVEDDSPYPEVRAAVPSFDDTTMLQNTVRMWTIGLLMTTIGSAVNMLF 114

Query: 228 AHRLMVITISSSMVQLLLFPMGSLWAKIMPYWS-FPIWKGKRIHLNIPQPWSQKEQMFST 286
           +     + +S+ +  +L +P+G  WA+ +P    F  + G  ++   P P+S KE    T
Sbjct: 115 SMHAPSMAVSTFVTSMLAWPLGRFWARWVPNVRIFGRFGGPFLN---PGPFSLKEHALIT 171

Query: 287 VLFSIAVS--SFYMDSVILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPS 344
           V+ +I+    + Y   ++L++ MFYK    + +      + Q +GF  AG   + +I P 
Sbjct: 172 VMGNISFGGGAAYATDILLSMNMFYKRDYGWLFDLLAIWSTQCIGFSLAGLCYKILITPP 231

Query: 345 HAIWPSQL-QTMALNKALFSKKTEKGGRGLTSQTFFYICVAFTFFYEWLPTYLFQILSTF 403
             IWPS L Q   L+           G  ++   FF I     F Y WLP YLFQ LS+F
Sbjct: 232 LMIWPSTLVQCTFLSNIHIHNNKVANGWKVSRLKFFMIIFIAGFIYYWLPGYLFQALSSF 291

Query: 404 NWMTWIKPDNFNLAMVTGSMGGVGINPIASFDWNVINYY--SALVTPLFSYANQMAGGL- 460
            W+TWI P N  +  + GS  G+G+ PI +FDWN I  Y  S LV P+ +    +   + 
Sbjct: 292 AWVTWIAPKNVVVNQIFGSSTGLGLLPI-TFDWNQIAGYVGSPLVPPISAIFTILCSMVT 350

Query: 461 IAAICVLAIYYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPPYY 520
           I  I V  ++YSN +   Y+P+  +         Y+VT ++N +  +D+  Y +YS  Y 
Sbjct: 351 IFWIVVPIVHYSNTWYGNYVPISDSTSMDRFQQRYNVTKVVNQRLSLDLEAYHSYSRLYL 410

Query: 521 SAGNLFCYGVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSHA 580
                  YG+  AS                              T  HT  + WR   + 
Sbjct: 411 PTTFAISYGMSFASV---------------------------MATISHTACFHWRTIYNG 443

Query: 581 LEEFH----DPHSRMMRRYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGL 636
           +   +    D H+R+M RY   P WWY +   + + + IA +  + T  P+W+LF+A+ +
Sbjct: 444 VRNINTQDRDVHARLMERYKAPPYWWYLVTFFVFLALSIATVRAWDTQLPVWALFLALAI 503

Query: 637 NAVFLIPITILEATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSYVGN 696
              FL+P+ I+ A T + +GLNV+ E I+GY LPG P A+M  K FGY  + QA ++  +
Sbjct: 504 AGFFLLPVGIIYALTNMAVGLNVITEFIIGYMLPGRPIAMMFFKTFGYITNSQAITFAQD 563

Query: 697 LKLGHYSKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAITY 756
           +KLGHY K+ P  +F  Q    +  + V + VL WS +NIK  C   Q   FTCP A  +
Sbjct: 564 MKLGHYLKVAPKLMFTAQFIATIWGSTVQIAVLRWSEANIKGLCTKAQPGHFTCPGATVF 623

Query: 757 YNASVLWGAIGPKRIFEG---------------VYPILKWCWXXXXXXXXXXXXXXXXXP 801
           + AS++WG IGP+R+F                   PI+ W                    
Sbjct: 624 FTASIIWGVIGPQRMFSAGQMYSSLNYFFVLGFFLPIVNWLILSKWSKRFEKSGRGLKFV 683

Query: 802 RFYPLWFNPLLVVG-GMLNMAPPYNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNYVLVA 860
             Y  W  P+   G G++  A PYN        I   F  +++++Y+ + W KYNY L A
Sbjct: 684 AKYLSW--PVFFSGTGLIPPATPYNYGSY---CIVGIFFGYFIKRYYFQWWCKYNYSLSA 738

Query: 861 GFQTGLV--XXXXXXXXXVQYKEKPISWWGNDVINNGLDAAGPPKKNV 906
               GL            +  ++ P+ WWGN VI+  LD  G   K +
Sbjct: 739 ALDIGLAWGALIIFFSTGIAVRKAPV-WWGNTVIDT-LDTNGQAIKYI 784

>Kwal_55.19788 s55 complement(125184..127616) [2433 bp, 810 aa] {ON}
           YJL212C (OPT1) - Oligopeptide transporter; Opt1p
           transports tetra- and pentapeptides, including the
           endogenous opioid pentapeptide leucine enkephalin.
           [contig 159] FULL
          Length = 810

 Score =  343 bits (880), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 229/731 (31%), Positives = 353/731 (48%), Gaps = 53/731 (7%)

Query: 185 SPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSMVQLL 244
           SPY  VRA V   DD      T R + L ++ + IG G N  F+     I +++ +  +L
Sbjct: 94  SPYPEVRAAVPSSDDTSLVQNTVRMWTLGMIMSTIGCGLNMLFSMHSPSIVLTTFVTSIL 153

Query: 245 LFPMGSLWAKIMP------YWSFPIWKGKRIHLNIPQPWSQKEQMFSTVLFSIAVS--SF 296
            +P+G  W  IMP       +  P W         P P++ KE    T + +++    S 
Sbjct: 154 AWPLGRGWDLIMPDKPMFGRFGGPSWN--------PGPFNVKEHALITAMGNVSFGGGSA 205

Query: 297 YMDSVILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPSHAIWPSQLQTMA 356
           Y   +IL++  FY +   +G+    + + Q +GF  AG +R  ++ P+  IWP+ L T  
Sbjct: 206 YATDIILSMNNFYNKDFGWGFDLLATWSTQCIGFAMAGLVRNVLVTPASMIWPANLVTTT 265

Query: 357 -LNKALFSKKTEKGGRGLTSQTFFYICVAFTFFYEWLPTYLFQILSTFNWMTWIKPDNFN 415
            L     ++     G  ++   FF I     F Y W P ++FQ LS F W+TWIKP++  
Sbjct: 266 FLTNMHVNENHVANGWTISRLKFFLIIFLAGFIYYWFPGFIFQALSYFAWVTWIKPNDVI 325

Query: 416 LAMVTGSMGGVGINPIASFDWNVINYY--SALVTPLFSYANQMAGG-LIAAICVLAIYYS 472
           +  V G+  G+G+ P+ +FDWN I  Y  S LV PL      +    LI  + V A++YS
Sbjct: 326 VNQVFGASSGLGLIPL-TFDWNQIAGYVGSPLVPPLGVIVTILLSMILIFWVVVPAVHYS 384

Query: 473 NQFDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPPYYSAGNLFCYGVFI 532
           N +  +YLP+  ++ +      Y+V+ I++     D   Y+ YSP Y SA     YG+  
Sbjct: 385 NVWYGKYLPISDSSSYDRYQGTYNVSKIVSENLSFDKAAYEEYSPLYLSATFAISYGL-- 442

Query: 533 ASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSHALEEFHDPHSRMM 592
                    SF      ++ A       IW     H      R    A +E  D H+R+M
Sbjct: 443 ---------SFAGITSTIMHAICFHGKLIW----DHM-----RNIKRAEDE--DVHARLM 482

Query: 593 RRYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNAVFLIPITILEATTA 652
           R+Y +VP WWY IV ++   + +A +  + T  P+++L +A+ +   FL+P+ I+ A T 
Sbjct: 483 RQYRDVPQWWYLIVFVIFFGMSVATIRAWPTEMPVFTLIIALLIAFFFLLPVGIIYALTN 542

Query: 653 LQLGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSYVGNLKLGHYSKIPPMALFR 712
           + +GLNV+ E I+GY  PG P A+M  K +GY  + QA ++  ++KLGHY K+ P  LF 
Sbjct: 543 ISVGLNVITEFIIGYMTPGKPIAMMFFKTYGYITNNQAITFAQDMKLGHYLKLAPRVLFA 602

Query: 713 GQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAITYYNASVLWGAIGPKRIF 772
            Q+   +  +LV + V+ W+  NI+D C   Q S FTCP A  ++NAS++WG IGP+R+F
Sbjct: 603 AQLIATIWGSLVQICVMKWAQGNIEDVCTRKQASHFTCPGARVFFNASIIWGVIGPQRMF 662

Query: 773 EG--VYPILKWCWXXXXXXXXXXXXXXXXXPRFYPLWFN-PLLVVG-GMLNMAPPYNL-T 827
               +Y  L + +                 P  Y  + N P+   G G++  A PYN   
Sbjct: 663 SAGQMYNKLMYFFILGAGLPVVNWLILKKWPGSYIKYLNWPVFFSGTGLIPPATPYNYGA 722

Query: 828 YMTPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQTGLVXXXXXXXXXVQYKEKPI-SW 886
           Y   G I      +Y++      W KYNY L AG    L          +         W
Sbjct: 723 YCMVGIIFG----YYIKTRFFNWWAKYNYTLSAGLDISLAWSSLIIFLALGLTNTDAPKW 778

Query: 887 WGNDVINNGLD 897
           WGNDV+N  +D
Sbjct: 779 WGNDVMNGTMD 789

>KLTH0E01496g Chr5 complement(146000..148444) [2445 bp, 814 aa] {ON}
           similar to uniprot|P40897 Saccharomyces cerevisiae
           YJL212C OPT1 Plasma membrane transporter that transports
           tetra- and pentapeptides and glutathione member of the
           OPT family
          Length = 814

 Score =  342 bits (876), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 226/722 (31%), Positives = 354/722 (49%), Gaps = 41/722 (5%)

Query: 185 SPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSMVQLL 244
           SPY  VRA V   DD      T R + + ++   IG G N  F+     I +++ +  +L
Sbjct: 99  SPYPEVRASVPSTDDPSLVQNTIRMWTIGMIMTTIGCGLNMLFSMHSPTIVLTTFVTSIL 158

Query: 245 LFPMGSLWAKIMPYWS-FPIWKGKRIHLNIPQPWSQKEQMFSTVLFSIAVSS--FYMDSV 301
            +P+G  W  +MP    F  + G  ++   P P++ KE    T + ++A  S   Y   +
Sbjct: 159 AWPLGRAWDMVMPDKPVFGRFGGPSLN---PGPFNVKEHALITAMGNVAFGSGNAYATDI 215

Query: 302 ILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPSHAIWPSQLQTMA-LNKA 360
           IL++  FY +   +G+      + Q +GF  AG  R+ ++ P+  IWP+ L T   L   
Sbjct: 216 ILSMNNFYNKDFGWGFDLLAVWSTQCIGFAMAGLSRKVLVTPASMIWPANLVTCTFLTNM 275

Query: 361 LFSKKTEKGGRGLTSQTFFYICVAFTFFYEWLPTYLFQILSTFNWMTWIKPDNFNLAMVT 420
             ++     G  ++   FF I     F Y W P ++FQ LS F W+TWIKP +  +  V 
Sbjct: 276 HINENHVANGWKISRLKFFMIVFIVGFVYYWFPGFIFQALSYFAWVTWIKPKDVIVNQVF 335

Query: 421 GSMGGVGINPIASFDWNVINYY--SALVTPLFSYANQMAGGLIAA-ICVLAIYYSNQFDC 477
           G+  G+G+ P+ +FDWN I  Y  S LV PL   A  +   +I   I V A++YSN +  
Sbjct: 336 GASTGLGLIPL-TFDWNQIAGYVGSPLVPPLGVIATILLSMVIIFWIVVPAVHYSNIWYG 394

Query: 478 QYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPPYYSAGNLFCYGVFIASYPL 537
           +YLP+  +  +      Y+V+ I++     + + Y+ YSP Y SA        F  SY L
Sbjct: 395 KYLPISDSGSYDRFQNTYNVSKIVSESLTFNKDAYREYSPLYLSA-------TFAISYGL 447

Query: 538 LFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSHALEEFHDPHSRMMRRYNE 597
            FA +  T    +  A       IW   +  T             E  D H+++MR Y +
Sbjct: 448 SFAGTMAT----ITHAICFHGKQIWGAIRNIT-----------SSEEEDVHAKLMRNYRD 492

Query: 598 VPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNAVFLIPITILEATTALQLGL 657
           VP WW+ +V ++   + IA +  + T  P+++L +A+ +   FL+P+ I+ A T + +GL
Sbjct: 493 VPQWWFIVVFLIFFGLSIATVRAWPTEMPVFTLIIALLIAFFFLLPVGIIYALTNIAVGL 552

Query: 658 NVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSYVGNLKLGHYSKIPPMALFRGQMFM 717
           NV+ E I+GY  PG P A+M  K FGY  + QA ++  ++K+GHY K+ P  LF  Q+  
Sbjct: 553 NVITEFIIGYMTPGKPIAMMFFKTFGYITNNQAITFAQDMKIGHYMKVAPRVLFSAQLVA 612

Query: 718 VLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAITYYNASVLWGAIGPKRIFEG--V 775
            +   LV + V+ W+  NI+D C   Q+S FTCP +  ++NAS++WG IGP+R+F    +
Sbjct: 613 TVWGGLVQMCVMKWAQGNIEDICTSKQKSHFTCPGSKVFFNASIIWGVIGPQRMFSAGQM 672

Query: 776 YPILKWCWXXXXXXXXXXXXXXXXXPRFYPLWFN-PLLVVG-GMLNMAPPYNLTYMTPGA 833
           Y  L + +                 PR    + N P+   G G++  A PYN  Y     
Sbjct: 673 YDKLMYFFILGAGLPVVNWLVLKKWPRSLVRYLNWPVFFSGTGLIPPATPYN--YGAYCM 730

Query: 834 IANFFSQFYMRKYHLRIWQKYNYVLVAGFQTGLVXXXXXXXXXVQYKEKPI-SWWGNDVI 892
           +  FF  ++++K +   W KYNY L AG    L          +        SWWGN+VI
Sbjct: 731 VGIFFG-YFIKKNYFNWWAKYNYSLSAGLDISLAWSSLIIFLALGLTNTDAPSWWGNNVI 789

Query: 893 NN 894
           N 
Sbjct: 790 NT 791

>KNAG0G02310 Chr7 complement(530112..532484) [2373 bp, 790 aa] {ON} 
          Length = 790

 Score =  339 bits (870), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 238/756 (31%), Positives = 369/756 (48%), Gaps = 65/756 (8%)

Query: 184 HSPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSMVQL 243
           +SPY  VRA V   DD    +  +R++FL  V+ I+ +G N+FF+ R   +TI+  + Q+
Sbjct: 75  NSPYAQVRAVVPVGDDPTIEINHWRTWFLTTVFVILFAGVNQFFSLRYPSLTINFLVAQV 134

Query: 244 LLFPMGSLWAKIMPYWSFPIWKGKRIH---LNIPQPWSQKEQMFSTVLFSIAVSSFYMDS 300
             +P+G L +     W  P WK KR H   LN P P+++KE    T+  ++  S+ Y   
Sbjct: 135 CCYPIGKLLS-----W-LPDWKCKRCHFFDLN-PGPFTKKEHAIVTISVALTSSTAYAMY 187

Query: 301 VILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPSHAIWPSQLQTMALNKA 360
           V+     FYK+K S GYQF      Q LG+G AG  RR+++YP+  +WP  L  ++L  +
Sbjct: 188 VLNAQTAFYKKKQSVGYQFLLVWTSQMLGYGAAGLTRRWIVYPAACVWPQTLIAVSLFDS 247

Query: 361 LFSKKTEK---GGRGLTSQTFFYICVAFTFFYEWLPTYLFQILSTFNWMTW--IKPDNFN 415
           L +   +K    G  +T   FF+  +  +F + W+P YLF  LS FN + W     +NF 
Sbjct: 248 LHNTAIDKTIVNGWRITRYRFFFFVLLGSFVWYWVPGYLFTGLSNFNVILWGPKTRNNFI 307

Query: 416 LAMVTGSMGGVGINPIASFDWNVINYY---SALVTPLFSYANQMAGGLIAAICVLA-IYY 471
           +  + G   G+G+ P+ +FD+  I+     S   TP +  AN  A   I  + VL  +Y+
Sbjct: 308 VNTIFGVKSGMGLMPV-TFDYTQISQALTGSVFATPFYVVANTYASVFIFFMIVLPFLYF 366

Query: 472 SNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPPYYSAGNLFCYGVF 531
            N +  +Y+P+ S   + NTG  ++VT +IN    +++ KY+ YSP       L  Y + 
Sbjct: 367 YNVWYAKYMPVISGTTYDNTGKSFNVTKVINPDFTINLEKYKKYSPIMVPFSYLLAYALN 426

Query: 532 IASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSHALEEFH---DPH 588
            A+   +F +  L   K +++ F +                           FH   D H
Sbjct: 427 FAAVVAVFVHCGLYHGKDIMKGFTN--------------------------RFHGGRDIH 460

Query: 589 SRM-MRRYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNAVFLIPITIL 647
           +R  ++ YN+ PDWWY IV ++   +G A + G+ +  P+W+  +A+ L+ V  IP  IL
Sbjct: 461 TRTYLKNYNDCPDWWYGIVQVVVAGLGFATVCGFDSGLPVWAFIIAIMLSLVNFIPQGIL 520

Query: 648 EATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSYVGNLKLGHYSKIPP 707
           EA T   +GLN++ E+I GY LP  P + +L K +G+ +  Q      +LKLG Y K+PP
Sbjct: 521 EAMTNQHVGLNIITELICGYMLPLRPMSNLLFKLYGFIVMRQGLELSRDLKLGVYMKVPP 580

Query: 708 MALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAITYYNASVLWGAIG 767
             LF  QM+  +I  +V++G+  W   +I D C   Q+  F C +  T +NAS++W    
Sbjct: 581 RLLFFIQMYATIISGMVTVGIQEWMYVHIDDVCSTTQKDGFICANGRTMFNASIIWSL-- 638

Query: 768 PKRIF--EGVYPILKWCWXXXXXXXXXXXXXXXXXPR--FYPLWFNPLLVVG-GMLNMAP 822
           PK +F    +Y  L W +                  +  F      P+   G G +  + 
Sbjct: 639 PKYLFSPHRLYSPLMWFFLIGLLVPLGVYAAQRVFKKNQFLKHINTPVFFTGPGNIPPST 698

Query: 823 PYNLT-YMTPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQTGLVXXXXXXXXXVQYKE 881
           PYN T Y   G     +  F +RK   R + KYN+V+ A  +TG+          VQY  
Sbjct: 699 PYNYTLYFAMG-----YMLFTIRKRFPRWFNKYNFVMGAAVETGVAIAVVIIFLCVQYPA 753

Query: 882 KPISWWGNDVINNGLDAAGPPKKNVSLTPRGYFGPE 917
             I WWGN V  N  D  G  K   +L     FGP+
Sbjct: 754 GNIKWWGNTVWKNTYD--GKYKTYYTLKKNETFGPQ 787

>Ecym_7185 Chr7 (379870..382272) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii ABR156W
          Length = 800

 Score =  339 bits (869), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 238/832 (28%), Positives = 380/832 (45%), Gaps = 64/832 (7%)

Query: 113 LKYVASQIVNMSLEEAAEVLKLGAEYHADDPNLSSDEYNDFVKLSELNPVTLHPFEEDAL 172
           +K + S+   ++ +  A+V     + H    +L  DE      L     +     + D  
Sbjct: 4   IKSILSRDAPITEKVPAKVQHNEKDGHISSVHLVKDEIQPSESLPHYPLIDKLSGQVDVD 63

Query: 173 ELKAVAGLLHFHSPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFFAHRLM 232
           E  ++   +   SPY  VRA V   DD      T R + + L    +GS  N  F+    
Sbjct: 64  EYASLT--VEGDSPYPEVRAAVPSYDDSSLLQNTVRMWAIGLFMTTVGSALNMLFSMHTP 121

Query: 233 VITISSSMVQLLLFPMGSLWAKIMPYWS-FPIWKGKRIHLNIPQPWSQKEQMFSTVLFSI 291
            I +++ +  L+ +PMG  W   +P W  F    G  ++   P P++ KE    T++ ++
Sbjct: 122 PIALTAFVTSLMGWPMGKAWEYFVPNWRLFGPLGGPYLN---PTPFNLKEHALITIMGNV 178

Query: 292 AVS--SFYMDSVILTL--KMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPSHAI 347
           A    + Y   ++L++  K FY     + +      + Q +GF  AG   + ++ P+  I
Sbjct: 179 AFGGGNAYATDILLSMHIKDFYNRNYGWAFDLLAVWSTQCIGFSLAGMCHQILVKPAVMI 238

Query: 348 WPSQLQTMA-LNKALFSKKTEKGGRGLTSQTFFYICVAFTFFYEWLPTYLFQILSTFNWM 406
           WPS L T   L     ++     G  ++   FF I     F + W+P YLFQ L TF W 
Sbjct: 239 WPSALVTCTFLTNIHINENHVANGWKISRLKFFLIVFIIGFVWYWIPGYLFQALGTFVWP 298

Query: 407 TWIKPDNFNLAMVTGSMGGVGINPIASFDWNVINYY--SALVTPLFSYANQMAGGLIAAI 464
            WI P N  +  + G   G+G+ P+ +FDWN I+ +  S LV P+ S    +A  +++  
Sbjct: 299 LWIAPKNVIVNQLFGPQTGMGLLPL-TFDWNQISGFTGSPLVPPV-SAIITIAISVVSIF 356

Query: 465 CVL--AIYYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPPYYSA 522
            +L   I+YSN +  +YLPM  +  +      Y+V++I++    +D  +YQNYSP Y   
Sbjct: 357 WILLPIIHYSNIWYGKYLPMSRSKSYDRYQNTYNVSAIVDETLSLDKQEYQNYSPLYLPT 416

Query: 523 GNLFCYGVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSHALE 582
                YG+  AS      ++ L   K ++                       R  S   E
Sbjct: 417 SFAISYGMSFASITATVMHTILFHGKDIVA----------------------RMRSLKTE 454

Query: 583 EFHDPHSRMMRRYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNAVFLI 642
           E  D H+R+M+ Y  VP WWY  V ++ + + IA + G+ T  PIW+L  A+G+  VFL+
Sbjct: 455 E-EDVHARLMKSYKTVPWWWYACVFLVFLAMSIAVIAGWDTQMPIWALIFALGIATVFLL 513

Query: 643 PITILEATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSYVGNLKLGHY 702
           P+ I+ A T + +GLNV+ E ++GY LPG P A+M  K FGY  + QA ++  ++K+GHY
Sbjct: 514 PVGIIYALTNISVGLNVITEFLIGYVLPGRPIAMMFFKTFGYITNNQAITFAQDMKIGHY 573

Query: 703 SKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAITYYNASVL 762
            K+ P  +F  Q    +    V + V+ W+  NI D C   ++  F CP A  ++NAS++
Sbjct: 574 LKLAPRLMFTAQFLATIWGGTVQVAVMRWAEGNIPDLC--TKDGSFNCPHATVFFNASII 631

Query: 763 WGAIGPKRIFE---------------GVYPILKWCWXXXXXXXXXXXXXXXXXPRFYPLW 807
           WG IGP+R+F                 + P++ W                      Y  W
Sbjct: 632 WGVIGPQRMFSSGQLYSKLNYFFIAGAILPVINWLILNKWPKRFEKYGRIPKICAKYLSW 691

Query: 808 FNPLLVVG-GMLNMAPPYNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQTGL 866
             P+   G GM+  A  YN        I   F  +++++Y    W KYNY L A    GL
Sbjct: 692 --PVFFSGTGMIPPATAYNYGAY---CILGIFFGYFVKRYWFHWWTKYNYSLSAALDIGL 746

Query: 867 VXXXXXXXXXVQ-YKEKPISWWGNDVINNGLDAAGPPKKNVSLTPRGYFGPE 917
                        +   P SWWGN+V++N LD+ G   +    +   +FGP 
Sbjct: 747 AWSALIVFFSTSIHTVNPPSWWGNNVVSNTLDSKGTAMQITLTSSEDFFGPS 798

>SAKL0F14674g Chr6 complement(1170374..1172791) [2418 bp, 805 aa]
           {ON} similar to uniprot|P40897 Saccharomyces cerevisiae
           YJL212C OPT1 Plasma membrane transporter that transports
           tetra- and pentapeptides and glutathione member of the
           OPT family
          Length = 805

 Score =  334 bits (857), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 231/783 (29%), Positives = 364/783 (46%), Gaps = 58/783 (7%)

Query: 136 AEYHADDPNLSSDEYNDFVKLSELNPVTLHPFEEDALELKAVAGLLHFHSPYKAVRACVS 195
           A     +P  S+   ND +  +EL          + L+       +   SPY  VRA V 
Sbjct: 45  ASVAKAEPIASTAFQNDSIDPNELG----RKVSSEVLDDGYAGITVDDDSPYAEVRAAVP 100

Query: 196 PQDDYESPVETFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSMVQLLLFPMGSLWAKI 255
             D+   P  T R + L  +   IGS  N  F+     I +++ +  +L +P+G  WA+ 
Sbjct: 101 STDNPVIPQNTIRMWTLGFIMTTIGSAINMLFSMHSPSIILTTFVTSILAWPLGKAWARF 160

Query: 256 MP-YWSFPIWKGKRIHLNIPQPWSQKEQMFSTVLFSIAVS--SFYMDSVILTLKMFYKEK 312
           +P    F  + G  ++   P P++ KE    TV+ +++    + Y   ++L++  FY   
Sbjct: 161 LPDVRIFGKYGGPSLN---PGPFNLKEHTLITVMGNVSFGGGNAYATDILLSMNNFYGTD 217

Query: 313 VSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPSHAIWPSQLQTMA-LNKALFSKKTEKGGR 371
             +G+      + Q +GF  AG  ++ ++ PS  IWPS L T   L     ++     G 
Sbjct: 218 FGWGFGLLAIWSTQCIGFSLAGLAKKILVTPSTMIWPSNLVTCTFLTNLHINENHSASGW 277

Query: 372 GLTSQTFFYICVAFTFFYEWLPTYLFQILSTFNWMTWIKPDNFNLAMVTGSMGGVGINPI 431
            ++   FF++     F Y W P ++F+ LS F W+TWIKP+N  +  V G+  G+G+ PI
Sbjct: 278 TISRLRFFFLVFLIGFLYYWFPGFIFEGLSYFAWVTWIKPNNVVINQVFGASTGLGLIPI 337

Query: 432 ASFDWNVINYYSA---------LVTPLFSYANQMAGGLIAAICVLAIYYSNQFDCQYLPM 482
            +FDWN I  Y+          LVT L S        +I  I V  I+YSN +  +YLP+
Sbjct: 338 -TFDWNQIAGYTGSPLIPPVGVLVTILLSMV------IIFWIVVPIIHYSNVWYGKYLPI 390

Query: 483 FSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPPYYSAGNLFCYGVFIASYPLLFAYS 542
             +  +      Y+V+ I++     D   Y+ YSP Y SA     YG+  AS      ++
Sbjct: 391 SDSESYDRFQQPYNVSKIVDDSLTFDPAGYKKYSPLYLSASFAIAYGMSFASTTATIVHA 450

Query: 543 FLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSHALEEFHDPHSRMMRRYNEVPDWW 602
            L   K +                       W ++     E  D H+R+MR Y E P WW
Sbjct: 451 VLFHGKDV-----------------------WDQARSLKVEEEDVHARLMREYKETPCWW 487

Query: 603 YYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNAVFLIPITILEATTALQLGLNVLIE 662
           Y IV ++   + +  +  ++T  P+++L +A+ + A FL+PI I+ A T + +GLNV  E
Sbjct: 488 YAIVFLVFFGLAVVTVRVWNTEMPVYALIIALVIAAFFLLPIGIIYALTNIPVGLNVFTE 547

Query: 663 IIMGYALPGNPQALMLIKAFGYNIDGQADSYVGNLKLGHYSKIPPMALFRGQMFMVLIQT 722
            I+GY LPG P A+M  K FGY  + QA  +  ++KLGHY K+ P  LF  Q    +  +
Sbjct: 548 FIVGYMLPGKPIAMMFFKTFGYITNNQAIIFAQDMKLGHYMKVAPRLLFTAQFLATIWGS 607

Query: 723 LVSLGVLNWSISNIKDYCQPNQESKFTCPDAITYYNASVLWGAIGPKRIFEG--VYPILK 780
           LV + VL W+   I   C  +Q+  +TCP +  ++NASV+WG IGP ++F    +Y  L 
Sbjct: 608 LVQICVLKWAQDTIPGLCSDDQKDNYTCPGSRVFFNASVIWGVIGPDKMFSSGKIYNGLL 667

Query: 781 WCWXXXXXXXXXXXXXXXXXPRFYPLWFN-PLLVVG-GMLNMAPPYNLTYMTPGAIANFF 838
           + +                 P     + N P+   G  M+  A P+N  Y     +  FF
Sbjct: 668 YFFLLGAILPVINWLILRKWPNSLIQYMNWPVFFSGTAMIPPATPFN--YGAYCMVGIFF 725

Query: 839 SQFYMRKYHLRIWQKYNYVLVAGFQTGLVXXXXXXXXXVQYKEKPI-SWWGNDVINNGLD 897
             +Y+R+     W KYNY L AG   GL          +         WWGN V+++ +D
Sbjct: 726 G-YYVRRKWFHWWSKYNYSLSAGLDIGLAWSSLIIFLCLYLTNASFPDWWGNSVVDSTMD 784

Query: 898 AAG 900
           + G
Sbjct: 785 SWG 787

>Skud_10.5 Chr10 complement(7830..10229) [2400 bp, 799 aa] {ON}
           YJL212C (REAL)
          Length = 799

 Score =  330 bits (845), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 231/751 (30%), Positives = 371/751 (49%), Gaps = 56/751 (7%)

Query: 165 HPFEEDALELKAVAGLLHFHSPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFN 224
           H  +E+ L  K     L  +SPY  VRA VS +DD    +  +R++FL  ++ ++ +G N
Sbjct: 66  HSIQEEGLVWKGDPTYLP-NSPYPEVRAAVSIEDDPTIRLNHWRTWFLTTIFVVVFAGVN 124

Query: 225 EFFAHRLMVITISSSMVQLLLFPMGSLWAKIMPYWSFPIWKGKR---IHLNIPQPWSQKE 281
           +FF+ R   + I+  + Q++ FP+G + A +      P WK +R     LN P P+++KE
Sbjct: 125 QFFSLRYPSLEINFIVAQVVCFPIGRVLALL------PDWKCRRAPFFDLN-PGPFTKKE 177

Query: 282 QMFSTVLFSIAVSSFYMDSVILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVI 341
               T+  ++  S+ Y   ++     FY  K++ GYQF      Q +G+G AG  RR+V+
Sbjct: 178 HAVVTIAVALTSSTAYAMYILNAQGSFYNMKLNVGYQFLLVWTSQMIGYGAAGLTRRWVV 237

Query: 342 YPSHAIWPSQLQTMALNKALFSKKTEK---GGRGLTSQTFFYICVAFTFFYEWLPTYLFQ 398
            P+ +IWP  L +++L  +L S+K EK    G  +    FF I +  +F + W+P +LF 
Sbjct: 238 NPASSIWPQTLISVSLFDSLHSRKIEKTVANGWTMPRYRFFLIVLIGSFLWYWVPGFLFT 297

Query: 399 ILSTFNWMTW--IKPDNFNLAMVTGSMGGVGINPIASFDWNVINYY---SALVTPLFSYA 453
            LS FN + W      NF    + G+  G+G  PI +FD+  I+     S   TP +  A
Sbjct: 298 GLSYFNVVLWGSKTRHNFIANTIFGTQSGLGALPI-TFDYTQISQAMSGSVFATPFYVSA 356

Query: 454 NQMAGGLIAAICVL-AIYYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKY 512
           N  A  LI  + VL  +Y++N +  +Y+P+ S + + NT  +Y+VT I+N    +++ KY
Sbjct: 357 NTYASVLIFFVIVLPCLYFTNTWYAKYMPVISGSTYDNTQNKYNVTKILNEDYSINLEKY 416

Query: 513 QNYSPPYYSAGNLFCYGVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLY 572
           + YSP +     L  Y +  A+   +F + FL   K +L  FKD                
Sbjct: 417 KEYSPVFVPFSYLLSYALNFAAVIAVFVHCFLYHGKEILAKFKD---------------- 460

Query: 573 SWRESSHALEEFHDPHSRM-MRRYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLF 631
             R++        D H R+  + Y + PDWWY ++ I+ I +G  A+  + T  P W+  
Sbjct: 461 --RKNGGT-----DIHMRIYTKNYKDCPDWWYLLLQIVMIGLGFVAVCCFDTKFPAWAFV 513

Query: 632 MAVGLNAVFLIPITILEATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQAD 691
           +A+ ++ V  IP  ILEA T   +GLN++ E+I GY LP  P A +L K +G+ +  Q  
Sbjct: 514 IAILISLVNFIPQGILEAMTNQHVGLNIITELICGYMLPLRPMANLLFKLYGFIVMRQGL 573

Query: 692 SYVGNLKLGHYSKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCP 751
           +   +LKL  Y K+ P  +F  Q++  +I  +V++GV  W + NI   C  +Q + FTC 
Sbjct: 574 NLSRDLKLAMYMKVSPRLIFAVQIYATIISGMVNVGVQEWMMHNIDGLCTTDQPNGFTCA 633

Query: 752 DAITYYNASVLWGAIGPKRIFEG--VYPILKWCWXXXXXXXXXXXXXXXXXP--RFYPLW 807
           +  T +NAS++W    PK +F    +Y  L W +                 P  +F    
Sbjct: 634 NGRTVFNASIIWSL--PKYLFSTGRIYNPLMWFFLIGLLFPLVVYAVQWKFPNFKFAKHI 691

Query: 808 FNPLLVVG-GMLNMAPPYNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQTGL 866
             P+   G G +  + PYN +       A  F    +RK     + KYN+V+ AG + G+
Sbjct: 692 HTPVFFTGPGNIPPSTPYNYSLF----FAMSFCLNVIRKRWRAWFNKYNFVMGAGVEAGV 747

Query: 867 VXXXXXXXXXVQYKEKPISWWGNDVINNGLD 897
                     VQY    +SWWGN+V     D
Sbjct: 748 AIAVVIIFLCVQYPGGKLSWWGNNVWKRTYD 778

>KLLA0E00397g Chr5 (23256..25637) [2382 bp, 793 aa] {ON} highly
           similar to uniprot|P40897 Saccharomyces cerevisiae
           YJL212C OPT1 Plasma membrane transporter that transports
           tetra- and pentapeptides and glutathione member of the
           OPT family
          Length = 793

 Score =  329 bits (844), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 226/751 (30%), Positives = 371/751 (49%), Gaps = 62/751 (8%)

Query: 168 EEDALELKAVAGLLHFHSPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFF 227
           E+D L  K     L  +SPY  VR  VS +DD    +  +R++FL  ++ ++ +G N+FF
Sbjct: 63  EDDGLVWKGDPTYLP-NSPYPDVRFAVSIEDDPTIRLNHWRTWFLTTIFVVVFAGVNQFF 121

Query: 228 AHRLMVITISSSMVQLLLFPMGSLWAKIMPYWSFPIWKGKRI---HLNIPQPWSQKEQMF 284
           + R   ++I   + Q++ +P+G + AK+      P WK +R+    LN P P+++KE   
Sbjct: 122 SLRYPSLSIDFIVAQVICYPIGKVLAKL------PDWKCRRVPFFDLN-PGPFTKKEHAV 174

Query: 285 STVLFSIAVSSFYMDSVILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPS 344
            T+  ++  S+ Y   ++     FY  K++ GYQF      Q +G+G AG  RR+V+ P+
Sbjct: 175 VTIAVALTSSTAYAMYILNAQGSFYNMKLNVGYQFLLVWTSQMIGYGAAGLTRRWVVNPA 234

Query: 345 HAIWPSQLQTMALNKALFSKKTEKG---GRGLTSQTFFYICVAFTFFYEWLPTYLFQILS 401
            AIWP  L +++L  +L S+K E+    G  +    FF I    +F + W+P +LF  LS
Sbjct: 235 SAIWPQTLISVSLFDSLHSRKIERAVVNGWSMPRYKFFVIVFIASFVWYWVPGFLFTGLS 294

Query: 402 TFNWMTW--IKPDNFNLAMVTGSMGGVGINPIASFDWNVINYY---SALVTPLFSYANQM 456
            FN + W     DNF    + G   G+G  PI SFD+  I+     S   TP +  AN  
Sbjct: 295 YFNVILWGPKTRDNFVANTIFGVESGLGAFPI-SFDYTQISQAMSGSVFATPFYVSANTY 353

Query: 457 AGGLIAAICVL-AIYYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNY 515
           A  L+  + +L  +Y+SN +  +Y+P+ S + + NT ++Y+VT I+N    +++ KY+NY
Sbjct: 354 ASVLLFFVIILPCLYFSNTWYAKYMPVISGSTYDNTQSKYNVTKILNEDYSINLEKYKNY 413

Query: 516 SPPYYSAGNLFCYGVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWR 575
           SP +     L  Y +  A+   +F +  L   K +L   KD                  R
Sbjct: 414 SPIFVPFSYLLSYALNFAAVIAVFVHCILYHGKDILAKLKD------------------R 455

Query: 576 ESSHALEEFHDPHSRMM-RRYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAV 634
            +        D H+R+  + Y + PDWWY ++ ++ I +G   +  + +  P W+  +A+
Sbjct: 456 RNGGT-----DIHARIYSKNYADCPDWWYLVLQVVMIGLGFVTVCAFDSKFPAWAFVIAI 510

Query: 635 GLNAVFLIPITILEATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSYV 694
            ++ V  IP  ILEA T   +GLN++ E+I GY LP  P A +L K +G+ +  Q  +  
Sbjct: 511 LISLVNFIPQGILEAMTNQHVGLNIITELICGYMLPLRPMANLLFKLYGFIVMRQGLNLS 570

Query: 695 GNLKLGHYSKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAI 754
            +LKL  Y K+PP  +F  Q++  ++  +V++GV  W   NI+  C  +Q + FTC +  
Sbjct: 571 RDLKLAMYMKVPPRLIFFIQIYATILSGMVNVGVQEWMTHNIEGICSTDQSNGFTCANGR 630

Query: 755 TYYNASVLWGAIGPKRIFE--GVYPILKWCWXXXXXXXXXXXXXXXXXPR--FYPLWFNP 810
           T +NAS++W    PK +F    +Y  L W +                 P+  F      P
Sbjct: 631 TVFNASIIWSL--PKYLFSPGRIYNPLMWFFLIGLVVPLIVYAIQRKFPKIQFAKYIHTP 688

Query: 811 LLVVGGMLNMAPPYNLTYMTPGAIANFFSQFYMRKYHLRIW----QKYNYVLVAGFQTGL 866
           +   G       P N+   TP   + FFS  +      + W    +KYNYV+ A  ++G+
Sbjct: 689 VFFTG-------PGNIPPSTPYNYSLFFSASFCLHIIRKRWGPWFKKYNYVMGAAVESGV 741

Query: 867 VXXXXXXXXXVQYKEKPISWWGNDVINNGLD 897
                     VQ+    ++WWGN+V  N  D
Sbjct: 742 AIAVVIIFLCVQFPGAELNWWGNNVWKNTYD 772

>YJL212C Chr10 complement(33850..36249) [2400 bp, 799 aa] {ON}
           OPT1Proton-coupled oligopeptide transporter of the
           plasma membrane; also transports glutathione and
           phytochelatin; member of the OPT family
          Length = 799

 Score =  325 bits (834), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 233/794 (29%), Positives = 385/794 (48%), Gaps = 58/794 (7%)

Query: 121 VNMSLEEAAEVLKLGAEYHADDPNLSSDEYNDFVKLSELNPVTLHPFEEDALELKAVAGL 180
           +NM  EE  +      +   ++   ++DE +   +  E      H  +E+ L  K     
Sbjct: 26  INME-EEKKDAFVKNIDEDVNNLTATTDEED---RDPESQKFDRHSIQEEGLVWKGDPTY 81

Query: 181 LHFHSPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSM 240
           L  +SPY  VR+ VS +DD    +  +R++FL  V+ ++ +G N+FF+ R   + I+  +
Sbjct: 82  LP-NSPYPEVRSAVSIEDDPTIRLNHWRTWFLTTVFVVVFAGVNQFFSLRYPSLEINFLV 140

Query: 241 VQLLLFPMGSLWAKIMPYWSFPIWKGKRI---HLNIPQPWSQKEQMFSTVLFSIAVSSFY 297
            Q++ +P+G + A +      P WK  ++    LN P P+++KE    T+  ++  S+ Y
Sbjct: 141 AQVVCYPIGRILALL------PDWKCSKVPFFDLN-PGPFTKKEHAVVTIAVALTSSTAY 193

Query: 298 MDSVILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPSHAIWPSQLQTMAL 357
              ++     FY  K++ GYQF      Q +G+G AG  RR+V+ P+ +IWP  L +++L
Sbjct: 194 AMYILNAQGSFYNMKLNVGYQFLLVWTSQMIGYGAAGLTRRWVVNPASSIWPQTLISVSL 253

Query: 358 NKALFSKKTEK---GGRGLTSQTFFYICVAFTFFYEWLPTYLFQILSTFNWMTW--IKPD 412
             +L S+K EK    G  +    FF I +  +F + W+P +LF  LS FN + W      
Sbjct: 254 FDSLHSRKVEKTVANGWTMPRYRFFLIVLIGSFIWYWVPGFLFTGLSYFNVILWGSKTRH 313

Query: 413 NFNLAMVTGSMGGVGINPIASFDWNVINYY---SALVTPLFSYANQMAGGLIAAICVL-A 468
           NF    + G+  G+G  PI +FD+  ++     S   TP +  AN  A  LI  + VL  
Sbjct: 314 NFIANTIFGTQSGLGALPI-TFDYTQVSQAMSGSVFATPFYVSANTYASVLIFFVIVLPC 372

Query: 469 IYYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPPYYSAGNLFCY 528
           +Y++N +  +Y+P+ S + + NT  +Y+VT I+N    +++ KY+ YSP +     L  Y
Sbjct: 373 LYFTNTWYAKYMPVISGSTYDNTQNKYNVTKILNEDYSINLEKYKEYSPVFVPFSYLLSY 432

Query: 529 GVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSHALEEFHDPH 588
            +  A+   +F +  L   K ++  FKD  +     T  H  +YS               
Sbjct: 433 ALNFAAVIAVFVHCILYHGKDIVAKFKDRKNG---GTDIHMRIYS--------------- 474

Query: 589 SRMMRRYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNAVFLIPITILE 648
               + Y + PDWWY ++ I+ I +G  A+  + T  P W+  +A+ ++ V  IP  ILE
Sbjct: 475 ----KNYKDCPDWWYLLLQIVMIGLGFVAVCCFDTKFPAWAFVIAILISLVNFIPQGILE 530

Query: 649 ATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSYVGNLKLGHYSKIPPM 708
           A T   +GLN++ E+I GY LP  P A +L K +G+ +  Q  +   +LKL  Y K+ P 
Sbjct: 531 AMTNQHVGLNIITELICGYMLPLRPMANLLFKLYGFIVMRQGLNLSRDLKLAMYMKVSPR 590

Query: 709 ALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAITYYNASVLWGAIGP 768
            +F  Q++  +I  +V++GV  W + NI   C  +Q + FTC +  T +NAS++W    P
Sbjct: 591 LIFAVQIYATIISGMVNVGVQEWMMHNIDGLCTTDQPNGFTCANGRTVFNASIIWSL--P 648

Query: 769 KRIFEG--VYPILKWCWXXXXXXXXXXXXXXXXXPRFY--PLWFNPLLVVG-GMLNMAPP 823
           K +F    +Y  L W +                 P+F        P+   G G +  + P
Sbjct: 649 KYLFSSGRIYNPLMWFFLIGLLFPLAVYAVQWKFPKFKFAKHIHTPVFFTGPGNIPPSTP 708

Query: 824 YNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQTGLVXXXXXXXXXVQYKEKP 883
           YN +       A  F    +RK     + KYN+V+ AG + G+          VQY    
Sbjct: 709 YNYSLF----FAMSFCLNLIRKRWRAWFNKYNFVMGAGVEAGVAISVVIIFLCVQYPGGK 764

Query: 884 ISWWGNDVINNGLD 897
           +SWWGN+V     D
Sbjct: 765 LSWWGNNVWKRTYD 778

>Smik_10.20 Chr10 complement(32201..34600) [2400 bp, 799 aa] {ON}
           YJL212C (REAL)
          Length = 799

 Score =  325 bits (832), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 232/789 (29%), Positives = 381/789 (48%), Gaps = 57/789 (7%)

Query: 126 EEAAEVLKLGAEYHADDPNLSSDEYNDFVKLSELNPVTLHPFEEDALELKAVAGLLHFHS 185
           +E         E   ++   ++DE +   +  E      H  +E+ L  K     L  +S
Sbjct: 30  DEKKNSFVKSTEEDVNNLTATTDEED---RDPESQKFDRHSIQEEGLVWKGDPTYLP-NS 85

Query: 186 PYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSMVQLLL 245
           PY  VRA VS +DD    +  +R++FL  ++ ++ +G N+FF+ R   + I+  + Q++ 
Sbjct: 86  PYPEVRAAVSIEDDPTIRLNHWRTWFLTTIFVVVFAGVNQFFSLRYPSLEINFLVAQVVC 145

Query: 246 FPMGSLWAKIMPYWSFPIWKGKRI---HLNIPQPWSQKEQMFSTVLFSIAVSSFYMDSVI 302
           +P+G + A +      P WK  R+    LN P P+++KE    T+  ++  S+ Y   ++
Sbjct: 146 YPIGKVLALL------PDWKCARVPFFDLN-PGPFTKKEHAVVTIAVALTSSTAYAMYIL 198

Query: 303 LTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPSHAIWPSQLQTMALNKALF 362
                FY  K++ GYQF      Q +G+G AG  RR+V+ P+ +IWP  L +++L  +L 
Sbjct: 199 NAQGSFYNMKLNVGYQFLLVWTSQMIGYGAAGLTRRWVVNPASSIWPQTLISVSLFDSLH 258

Query: 363 SKKTEK---GGRGLTSQTFFYICVAFTFFYEWLPTYLFQILSTFNWMTW--IKPDNFNLA 417
           S+K EK    G  +    FF I +  +F + W+P +LF  LS FN + W      NF   
Sbjct: 259 SRKIEKTVANGWTMPRYKFFLIVLIGSFVWYWVPGFLFTGLSYFNVILWGSKTRHNFIAN 318

Query: 418 MVTGSMGGVGINPIASFDWNVINYY---SALVTPLFSYANQMAGGLIAAICVL-AIYYSN 473
            + G+  G+G  PI +FD+  ++     S   TP +  AN  A  LI  + VL  +Y++N
Sbjct: 319 TIFGTQSGLGALPI-TFDYTQVSQAMSGSVFATPFYVSANTYASVLIFFVIVLPCLYFTN 377

Query: 474 QFDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPPYYSAGNLFCYGVFIA 533
            +  +Y+P+ S + + NT  +Y+VT I+N    +++ KY+ YSP +     L  Y +  A
Sbjct: 378 TWYAKYMPVISGSTYDNTQHKYNVTKILNEDFSINLEKYKEYSPVFVPFSYLLSYALNFA 437

Query: 534 SYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSHALEEFHDPHSRMMR 593
           +   +F + FL   K ++  FKD  +     T  H  +YS                   +
Sbjct: 438 AVIAVFVHCFLYHGKDIVAKFKDRKNG---GTDIHMRIYS-------------------K 475

Query: 594 RYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNAVFLIPITILEATTAL 653
            Y + PDWWY  + ++ I +G  A+  + T  P W+  +A+ ++ V  IP  ILEA T  
Sbjct: 476 NYKDCPDWWYLALQLVMIGLGFVAVCCFDTKFPAWAFVIAILISLVNFIPQGILEAMTNQ 535

Query: 654 QLGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSYVGNLKLGHYSKIPPMALFRG 713
            +GLN++ E+I GY LP  P A +L K +G+ +  Q  +   +LKL  Y K+ P  +F  
Sbjct: 536 HVGLNIITELICGYMLPLRPMANLLFKLYGFIVMRQGLNLSRDLKLAMYMKVSPRLIFAV 595

Query: 714 QMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAITYYNASVLWGAIGPKRIFE 773
           Q++  +I  +V++GV  W + NI   C  +Q + FTC +  T +NAS++W    PK +F 
Sbjct: 596 QIYATIISGMVNVGVQEWMMHNIDGLCTSDQPNGFTCANGRTVFNASIIWSL--PKYLFS 653

Query: 774 G--VYPILKWCWXXXXXXXXXXXXXXXXXP--RFYPLWFNPLLVVG-GMLNMAPPYNLTY 828
              +Y  L W +                 P  +F      P+   G G +  + PYN + 
Sbjct: 654 SGRIYSPLMWFFLIGLLFPLVVYAVQWKFPNFKFAKHIHTPVFFTGPGNIPPSTPYNYSL 713

Query: 829 MTPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQTGLVXXXXXXXXXVQYKEKPISWWG 888
                 A  F    +RK     + KYN+V+ AG + G+          VQY    +SWWG
Sbjct: 714 F----FAMSFCLNIIRKRWRAWFNKYNFVMGAGVEAGVAISVVIIFLCVQYPGAKLSWWG 769

Query: 889 NDVINNGLD 897
           N+V     D
Sbjct: 770 NNVWKRTYD 778

>Suva_6.290 Chr6 (513382..515787) [2406 bp, 801 aa] {ON} YJL212C
           (REAL)
          Length = 801

 Score =  322 bits (824), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 237/818 (28%), Positives = 391/818 (47%), Gaps = 64/818 (7%)

Query: 106 ITDIPADLKYVASQ--------IVNMSLEEAAEVLKLGAEYHADDPNLSSDEYNDFVKLS 157
           +T I  D+  V SQ        +V + + +A +      +   +D N  +   +D     
Sbjct: 1   MTIIHRDVDSVESQPSTSLSPAVVAIQVSQAEDKKDEFVKNIDEDVNNLTATTDDEDHDP 60

Query: 158 ELNPVTLHPFEEDALELKAVAGLLHFHSPYKAVRACVSPQDDYESPVETFRSYFLALVWA 217
           E      H  +E+ L  K     L  +SPY  VR+ VS +DD    +  +R++FL  ++ 
Sbjct: 61  ESQKYDRHSIQEEGLVWKGDPTYLP-NSPYPEVRSAVSIEDDPTIRLNHWRTWFLTTIFV 119

Query: 218 IIGSGFNEFFAHRLMVITISSSMVQLLLFPMGSLWAKIMPYWSFPIWKGKRI---HLNIP 274
           ++ +G N+FF+ R   + I+  + Q++ FP+G + A +      P WK  R+    LN P
Sbjct: 120 VVFAGVNQFFSLRYPSLEINFLVAQVVCFPIGRMLALL------PDWKCARVPFFDLN-P 172

Query: 275 QPWSQKEQMFSTVLFSIAVSSFYMDSVILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAG 334
            P+++KE    T+  ++  S+ Y   ++     FY  K++ GYQF      Q +G+G AG
Sbjct: 173 GPFTKKEHAVVTIAVALTSSTAYAMYILNAQGSFYNMKLNVGYQFLLVWTSQMIGYGAAG 232

Query: 335 SLRRFVIYPSHAIWPSQLQTMALNKALFSKKTEKG---GRGLTSQTFFYICVAFTFFYEW 391
             RR+V+ P+ +IWP  L +++L  +L S+  EK    G  +    FF   +  +F + W
Sbjct: 233 LTRRWVVNPASSIWPQTLISVSLFDSLHSRDVEKSVANGWKMPRYRFFLFILIGSFIWYW 292

Query: 392 LPTYLFQILSTFNWMTWIKPDNFNLAMVT--GSMGGVGINPIASFDWNVINYY---SALV 446
           +P +LF  LS FN + W     +N    T  G+  G+G  PI +FD+  I+     S   
Sbjct: 293 VPGFLFTGLSYFNVVLWGPKTRYNFIANTIFGTQSGLGALPI-TFDYTQISQAMSGSVFA 351

Query: 447 TPLFSYANQMAGGLIAAICVL-AIYYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKA 505
           TP +  AN  A  LI  + VL  +Y++N +  +++P+ S++ + NT  +Y+VT I+N   
Sbjct: 352 TPFYVSANTYASVLIFFVIVLPCLYFTNTWYAKFMPVISSSTYDNTQNKYNVTKILNEDY 411

Query: 506 EVDVNKYQNYSPPYYSAGNLFCYGVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLT 565
            +++ KY+ YSP +     L  Y +  A+   +F +  L   K ++  FKD         
Sbjct: 412 SINLEKYKEYSPVFVPFSYLLSYALNFAAVIAVFVHCILYHGKDIVAKFKD--------- 462

Query: 566 KKHTWLYSWRESSHALEEFHDPHSRMM-RRYNEVPDWWYYIVLILSIVIGIAALEGYHTN 624
                    R++        D H R+  + Y + PDWWY  + I+ I +G  A+  + T 
Sbjct: 463 ---------RKNGGV-----DIHMRIYSKNYKDCPDWWYLTLQIVMIGLGFVAVCCFDTK 508

Query: 625 TPIWSLFMAVGLNAVFLIPITILEATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGY 684
            P W+  +A+ ++ V  IP  ILEA T   +GLN++ E+I GY LP  P A +L K +G+
Sbjct: 509 FPAWAFVIAILISLVNFIPQGILEAMTNQHVGLNIITELICGYMLPLRPMANLLFKLYGF 568

Query: 685 NIDGQADSYVGNLKLGHYSKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQ 744
            +  Q  +   +LKL  Y K+ P  +F  Q++  +I  LV++GV  W + NI   C  +Q
Sbjct: 569 IVMRQGLNLSRDLKLAMYMKVSPRLIFAIQIYATIISGLVNVGVQEWMMHNIDGLCTTDQ 628

Query: 745 ESKFTCPDAITYYNASVLWGAIGPKRIFE--GVYPILKWCWXXXXXXXXXXXXXXXXXP- 801
            + FTC +  T +N+S++W    PK +F    +Y  L W +                 P 
Sbjct: 629 PNGFTCANGRTVFNSSIIWSL--PKYLFSPGRIYNPLMWFFLIGLLFPIVVYAIQWKFPN 686

Query: 802 -RFYPLWFNPLLVVG-GMLNMAPPYNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNYVLV 859
            +F      P+   G G +  + PYN +       A  F    +RK     + KYN+V+ 
Sbjct: 687 FKFAKHIHTPVFFTGPGNIPPSTPYNYSLF----FATSFCLHIIRKRWRAWYNKYNFVMG 742

Query: 860 AGFQTGLVXXXXXXXXXVQYKEKPISWWGNDVINNGLD 897
           AG + G+          VQY    +SWWGN+V     D
Sbjct: 743 AGVEAGVAIAVVIIFLCVQYPGGKLSWWGNNVWKRTYD 780

>KLTH0D06754g Chr4 complement(588021..590504) [2484 bp, 827 aa] {ON}
           highly similar to uniprot|P40897 Saccharomyces
           cerevisiae YJL212C OPT1 Plasma membrane transporter that
           transports tetra- and pentapeptides and glutathione
           member of the OPT family
          Length = 827

 Score =  318 bits (814), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 218/728 (29%), Positives = 367/728 (50%), Gaps = 47/728 (6%)

Query: 184 HSPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSMVQL 243
           +SP+  VRA V P DD    +  +R++FL  V+ I+ +G N+FF+ R   ++I+  + Q+
Sbjct: 112 NSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQV 171

Query: 244 LLFPMGSLWAKIMPYWSFPIWKGKRIHLNIPQPWSQKEQMFSTVLFSIAVSSFYMDSVIL 303
           + +P+G + A ++P W  P  +    +LN P P+++KE    T+  ++  S+ Y  ++++
Sbjct: 172 VCYPVGKILA-LLPEWDCP--RCPWFNLN-PGPFTKKEHAVVTIAVALTSSTAYAMNILI 227

Query: 304 TLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPSHAIWPSQLQTMALNKALFS 363
               FY  K+S GY        Q L +G AG  RR+V+ P+  IWP  L +++L  +L +
Sbjct: 228 AQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHN 287

Query: 364 K---KTEKGGRGLTSQTFFYICVAFTFFYEWLPTYLFQILSTFNWMTW--IKPDNFNLAM 418
           +   KT+  G  ++   FF    + +F + W+P +LF+ LS FN + W      NF    
Sbjct: 288 RSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHNFIANT 347

Query: 419 VTGSMGGVGINPIASFDWNVINYY---SALVTPLFSYANQMAGGLIAAICVLAI-YYSNQ 474
           + G   G+G  PI +FD+  I+     S   TP +  AN  A  ++  + +L I Y++N 
Sbjct: 348 IFGVESGIGALPI-TFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPILYFTNT 406

Query: 475 FDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPPYYSAGNLFCYGVFIAS 534
           +  +Y+P+ S + + NT  +Y+V+ I+NS   ++  KY++YSP +     L  Y +  A+
Sbjct: 407 WYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNFAA 466

Query: 535 YPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSHALEEFHDPHSRMMRR 594
              +F + FL   K +   F++     +     H  LYS                   + 
Sbjct: 467 VIAVFVHCFLYNGKEIKNKFRN---KNYGGQDIHMRLYS-------------------QN 504

Query: 595 YNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNAVFLIPITILEATTALQ 654
           Y + PDWWY ++ ++ I +G  A+  ++++ P W+  +A+ ++ V  IP  ILEA T   
Sbjct: 505 YKDCPDWWYVVLQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQH 564

Query: 655 LGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSYVGNLKLGHYSKIPPMALFRGQ 714
           +GLN++ E+I GY LP  P A +L K +G+ +  Q      +LKL  Y K+PP  +F  Q
Sbjct: 565 VGLNIITELICGYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQ 624

Query: 715 MFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAITYYNASVLWGAIGPKRIFE- 773
           ++  +I  LV++G+  W  SNIK+ C   Q   FTC +  T +NAS++W    PK +F  
Sbjct: 625 IYATVISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PKYLFSP 682

Query: 774 -GVYPILKWCWXXXXXXXXXXXXXXXXXPRFYPLWF--NPLLVVG-GMLNMAPPYNLTYM 829
             +Y  + W +                      L F  +P+   G G +  + PYN T  
Sbjct: 683 GRIYNPIMWFFLIGLVVPIIVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLY 742

Query: 830 TPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQTGLVXXXXXXXXXVQYKEKPISWWGN 889
                A  ++   +RK   R + KYN+V+ AG +TG+          VQY    ++WWGN
Sbjct: 743 ----FALSWALNTIRKRFPRWFSKYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWGN 798

Query: 890 DVINNGLD 897
           +V  N  D
Sbjct: 799 NVYKNTYD 806

>TDEL0C00130 Chr3 complement(9763..12141) [2379 bp, 792 aa] {ON} 
          Length = 792

 Score =  317 bits (811), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 237/801 (29%), Positives = 380/801 (47%), Gaps = 66/801 (8%)

Query: 120 IVNMSLEEAAEVLKLGAEYHADDPNLSSDEYNDFVKLSELNPVTLHPFEEDALELKAVAG 179
           +V ++ EEA+  L+      +D   ++ +E    V + E    T   F+E  ++     G
Sbjct: 14  VVYLADEEASSTLE---HRGSDAEVVTKNEKLKDVAIDERVSTTDSSFDEAVVDDGVWEG 70

Query: 180 LLHF--HSPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFFAHRLMVITIS 237
            +    +SPY  VRA V   DD    +  +R++FL  V+ ++ +G N+FF+ R   + I+
Sbjct: 71  DVSLLPNSPYPDVRAVVPIDDDPGIILNHWRTWFLTTVFVVVFAGVNQFFSLRYPSLEIN 130

Query: 238 SSMVQLLLFPMGSLWAKIMPYWSFPIWKGKRI---HLNIPQPWSQKEQMFSTVLFSIAVS 294
             + Q++ FP+G   A +      P WK KR     LN P P+++KE    T+  ++  S
Sbjct: 131 FLVAQVVCFPVGKALALL------PDWKCKRFSFFDLN-PGPFTKKEHAVITIAVALTSS 183

Query: 295 SFYMDSVILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPSHAIWPSQLQT 354
           + Y   ++     FY  K++ GYQ       Q LG+G AG  RR+V+ P   IWP  L +
Sbjct: 184 TAYAMYILNAQVSFYHMKLNAGYQLLLVWTSQMLGYGAAGLTRRWVVDPPSCIWPQTLIS 243

Query: 355 MALNKALFSKKTEK---GGRGLTSQTFFYICVAFTFFYEWLPTYLFQILSTFNWMTW--I 409
           ++L  +L S+K +K    G  L     FY  +  +F + W+P +LF+ LS FN + W   
Sbjct: 244 VSLFDSLHSRKVDKTIVNGWSLDRYKMFYFVLIGSFVWHWVPGFLFKGLSYFNVVLWGPK 303

Query: 410 KPDNFNLAMVTGSMGGVGINPIASFDWNVINYY---SALVTPLFSYANQMAGGLIAAICV 466
              NF    + G   G+G+ PI SFD+  ++     S   TP +  AN  A  LI  + V
Sbjct: 304 TRQNFVANALFGVSSGIGLLPI-SFDYTQVSQAMSGSVFATPFWVSANTYASVLIFFVIV 362

Query: 467 LAI-YYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPPYYSAGNL 525
           L I Y++N +  +Y+P+ S + F NT + Y+V  I+N+   +++ KY+ YSP +     L
Sbjct: 363 LPILYFTNTWYAKYMPVISGSTFDNTQSSYNVKKILNADYSINLEKYKEYSPVFVPFSYL 422

Query: 526 FCYGVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSHALEEF- 584
             YG+  A+   +F +  L   K +    +D                           F 
Sbjct: 423 LNYGLNFAAVVAVFVHCALYHGKDIYNKLRD-------------------------SNFG 457

Query: 585 -HDPHSRM-MRRYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNAVFLI 642
             D H R+  + Y E PDWWY ++ I+++ +G   +  + T+ P W+  +A+ +     +
Sbjct: 458 GMDIHRRIYTKNYKECPDWWYGVLQIITLALGFVTVCAFPTHFPPWAFVIALIIAYANFL 517

Query: 643 PITILEATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSYVGNLKLGHY 702
           P  ILEA T   +GLN++ E+I GY LP  P A +L K +G+ +  Q  +   +LKL  Y
Sbjct: 518 PQGILEAITNQHVGLNIITELICGYMLPLKPMANLLFKLYGFIVMRQGLNLSRDLKLALY 577

Query: 703 SKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAITYYNASVL 762
            K+ P  +F  Q++  +I  LV++G+  W  +NIKD C   Q   FTC +  T +NAS++
Sbjct: 578 MKVSPRLIFAIQIYATIISGLVNVGIQEWMRTNIKDICTTTQADGFTCANGRTIFNASII 637

Query: 763 WGAIGPKRIFE--GVYPILKWCWXXXXXXXXXXXXXXXXXPR--FYPLWFNPLLVVGGML 818
           W    PK +F    +Y  L W +                 P+  F+     P+   G   
Sbjct: 638 WSL--PKYLFSPGRIYNPLMWFFLIGLLAPIVVFLIQKKFPKVSFFKYLHTPVFFTGTN- 694

Query: 819 NMAP--PYNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQTGLVXXXXXXXXX 876
           N+ P  PYN +          F  F +RK     + KYN+V  AG +TG+          
Sbjct: 695 NIPPSTPYNYSLF----FGMSFMLFLIRKNWPLWFSKYNFVTGAGVETGVAIAVVIIFLC 750

Query: 877 VQYKEKPISWWGNDVINNGLD 897
           VQ+    + WWGN V  N  D
Sbjct: 751 VQFPGGHLDWWGNTVYKNTGD 771

>ZYRO0D00330g Chr4 complement(22470..24866) [2397 bp, 798 aa] {ON}
           highly similar to uniprot|P40897 Saccharomyces
           cerevisiae YJL212C OPT1 Plasma membrane transporter that
           transports tetra- and pentapeptides and glutathione
           member of the OPT family
          Length = 798

 Score =  316 bits (809), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 231/732 (31%), Positives = 362/732 (49%), Gaps = 57/732 (7%)

Query: 185 SPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSMVQLL 244
           SPY  VRA +SP DD    +  +R++FL  V+ ++ +G N+FF+ R   +TI   + Q++
Sbjct: 84  SPYPEVRAVLSPTDDPSIVLNHWRTWFLVTVFVVVFAGVNQFFSLRYPSLTIDFLVAQVI 143

Query: 245 LFPMGSLWAKIMPYWSFPIWKGKRI---HLNIPQPWSQKEQMFSTVLFSIAVSSFYMDSV 301
            +P+G   A        P WK K +   +LN P P+++KE    T+  ++  S+ Y   +
Sbjct: 144 CYPLGKTLA------CLPDWKCKLVPFFNLN-PGPFTKKEHAVVTIAVALTSSTAYAMYI 196

Query: 302 ILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPSHAIWPSQLQTMALNKAL 361
           +     FY   V+ GYQ     + Q LG+G AG  RR+V+ P+  IWP  L +++L  +L
Sbjct: 197 LNAQVSFYNMSVNSGYQLLLVWSSQMLGYGAAGLTRRWVVNPASCIWPQTLISVSLFDSL 256

Query: 362 FSKKTEKG---GRGLTSQTFFYICVAFTFFYEWLPTYLFQILSTFNWMTW--IKPDNFNL 416
            S+  EK    G  +    FF   +  +F + W+P +LF  LS FN + W      NF L
Sbjct: 257 HSRTIEKSSVNGWKVPRYKFFLFVLIGSFVWYWVPGFLFTGLSYFNIVLWGPKTRHNFVL 316

Query: 417 AMVTGSMGGVGINPIASFDWNVINYY---SALVTPLFSYANQMAGGLIAAICVLAI-YYS 472
             + G   G+G  PI SFD+  I+     S   TP +  AN  A  LI  + +L I Y++
Sbjct: 317 NTIFGVSSGIGALPI-SFDYTQISQAMTGSVFATPFWVSANTYASVLIFFVFLLPILYFT 375

Query: 473 NQFDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPPYYSAGNLFCYGVFI 532
           N +  +Y+P+ S + F NT  +Y+VT I+N    V++ KY++YSP +     L  Y +  
Sbjct: 376 NTWYAKYMPVISTSTFDNTQKKYNVTRILNPDFTVNLEKYKSYSPLFVPFSYLLSYALNF 435

Query: 533 ASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSHALEEFHDPHSRMM 592
           A+   +F +  L   K +    KD                       A     D H R+ 
Sbjct: 436 AAVIAVFVHCGLYHGKDIYGKLKD-----------------------ANFGGSDIHRRLY 472

Query: 593 RR-YNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNAVFLIPITILEATT 651
           ++ Y + PDWWY ++ ++ + +G AA+ G+ T+ P W+  +A+ +     IP  ILEA T
Sbjct: 473 QQNYKDCPDWWYLVLQVIMLGLGFAAVCGFDTHFPAWAFVVALLIAFANFIPQGILEAIT 532

Query: 652 ALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSYVGNLKLGHYSKIPPMALF 711
              +GLNV+ E++ GY LP  P A +L K +G+ +  Q  S   +LKL  Y KIPP  +F
Sbjct: 533 NQHVGLNVITELVCGYMLPFRPMANLLFKLYGFIVMRQGLSLSRDLKLALYMKIPPRLIF 592

Query: 712 RGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAITYYNASVLWGAIGPKRI 771
             Q++  ++  LV++GV  W   NIKD+C P+Q + F C +  T +NAS++W    PK +
Sbjct: 593 CIQIYATIVSGLVNVGVQEWMRHNIKDFCSPDQSNGFICANGRTVFNASIIWSM--PKYL 650

Query: 772 FEG--VYPILKWCWXXXXXXXXXXXXXXXXXPRFYPLWFNPLLVVGGMLNMAPPYNLTYM 829
           F    +Y  L W +                 P+      N L  +   +  A P N+   
Sbjct: 651 FSSGRIYNPLMWFFLIGLGLPLAIFGLQLLLPK-----VNFLKYIHTPIFFAGPGNIPPS 705

Query: 830 TPGAIANFFSQ---FYMRKYHLRIW-QKYNYVLVAGFQTGLVXXXXXXXXXVQYKEKPIS 885
           TP   + FF+     Y+ +    +W +KYN+V+ AG + G+          VQY    + 
Sbjct: 706 TPYNYSLFFAMSFWLYIIRRRWPLWFKKYNFVMGAGVEAGVAISVLVIFLCVQYPGGTLK 765

Query: 886 WWGNDVINNGLD 897
           WWGNDV  N  D
Sbjct: 766 WWGNDVWKNTYD 777

>SAKL0A09394g Chr1 complement(817374..819767) [2394 bp, 797 aa] {ON}
           highly similar to uniprot|P40897 Saccharomyces
           cerevisiae YJL212C OPT1 Plasma membrane transporter that
           transports tetra- and pentapeptides and glutathione
           member of the OPT family
          Length = 797

 Score =  312 bits (800), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 233/808 (28%), Positives = 382/808 (47%), Gaps = 74/808 (9%)

Query: 109 IPADLKYVASQIVNMSLEEAAEVLK-LGAEYHADDPNLSSDEYNDFVKLSELNPVTLHPF 167
           +P D   V S + N   E+  +++K L A    +DP+       D               
Sbjct: 24  VPLDTGKV-SYVPNPEFEQERQIVKTLSATIDLEDPSEKGSLLQD--------------- 67

Query: 168 EEDALELKAVAGLLHFHSPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFF 227
           ++DA+       L +  SPY  VRA V   DD    +  +R++FL  V+ I+ +G N+FF
Sbjct: 68  QDDAIWEGDPTYLPN--SPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFF 125

Query: 228 AHRLMVITISSSMVQLLLFPMGSLWAKIMPYWSFPIWKGKRI---HLNIPQPWSQKEQMF 284
           + R   ++I+  + Q++ +P+G + A      + P WK KR+    LN P P+++KE   
Sbjct: 126 SLRYPSLSINFIVAQVICYPIGKILA------TLPDWKCKRVPFFDLN-PGPFTKKEHAV 178

Query: 285 STVLFSIAVSSFYMDSVILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPS 344
            T+  ++  S+ Y  ++++    FY  K+  GYQ       Q LG+G AG  RR+V+ P+
Sbjct: 179 VTIAVALTSSTAYAMNILIAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPA 238

Query: 345 HAIWPSQLQTMALNKALFSKKTEK---GGRGLTSQTFFYICVAFTFFYEWLPTYLFQILS 401
             +WP  L +++L  AL S K +K    G  +T   FF     F+F + WLP +LF  LS
Sbjct: 239 SCVWPQTLISVSLFDALHSGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLS 298

Query: 402 TFNWMTW--IKPDNFNLAMVTGSMGGVGINPIASFDWNVINYY---SALVTPLFSYANQM 456
            FN++ W      NF    + G   G+G  PI +FD+  I+     S   TP +  AN  
Sbjct: 299 YFNFILWGPKTRHNFIANAIFGVESGLGAIPI-TFDYTQISQAMTGSVFATPFWVSANTY 357

Query: 457 AGGLIAAICVLAI-YYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNY 515
           A  L+  + +L I Y++N +  +Y+P+ S + + N    Y+VT I+N    +++ KY+ Y
Sbjct: 358 ASVLLFFVVILPILYFTNTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGY 417

Query: 516 SPPYYSAGNLFCYGVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWR 575
           SP Y     L  Y +  A+   +F +  L   K ++                       R
Sbjct: 418 SPLYVPFSYLLSYALNFAAVTAVFVHCALYHGKDIISKL--------------------R 457

Query: 576 ESSHALEEFHDPHSRMM-RRYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAV 634
            S+H      D H R+  + Y + PDWWY  + ++++ +G A + G+ T+ P W+  +A+
Sbjct: 458 NSNHGGS---DIHMRLYSKNYKDCPDWWYGALQVVTLGLGFATVCGWDTHFPAWAFVIAL 514

Query: 635 GLNAVFLIPITILEATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSYV 694
            ++   ++P  ILEA T   +GLN++ E++ GY LP  P A +L K +G+ +        
Sbjct: 515 LISFANIVPQGILEAMTNQHVGLNIITELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLS 574

Query: 695 GNLKLGHYSKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAI 754
            +LKL  Y K+ P  +F  Q++  LI  LV++G+  W   NI   C   Q+  F C +  
Sbjct: 575 RDLKLALYMKVSPRLIFAVQIYASLISGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGR 634

Query: 755 TYYNASVLWGAIGPKRIFE--GVYPILKWCWXXXXXXXXXXXXXXXXXP--RFYPLWFNP 810
           T +NAS++W    P+ +F    +Y  L W +                 P  +F     +P
Sbjct: 635 TIFNASIIWSL--PQYLFSPGRIYNPLMWFFLIGLVVPFIVFFLQKKFPSNQFLKYCHSP 692

Query: 811 LLVVG-GMLNMAPPYNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQTGLVXX 869
           +   G G +  + PYN +       A  F    +RK   R + KYN+V+ +G + G+   
Sbjct: 693 VFFTGPGNIPPSTPYNYSLF----FATSFLLNEIRKRWPRWFGKYNFVMGSGVEAGVALS 748

Query: 870 XXXXXXXVQYKEKPISWWGNDVINNGLD 897
                  VQY    ++WWGN V  N  D
Sbjct: 749 VTIIFLCVQYPGGKVNWWGNSVWKNTYD 776

>Kwal_26.7996 s26 complement(604470..606818) [2349 bp, 782 aa] {ON}
           YJL212C (OPT1) - Oligopeptide transporter; Opt1p
           transports tetra- and pentapeptides, including the
           endogenous opioid pentapeptide leucine enkephalin.
           [contig 55] FULL
          Length = 782

 Score =  305 bits (782), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 218/734 (29%), Positives = 357/734 (48%), Gaps = 55/734 (7%)

Query: 184 HSPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSMVQL 243
           +SP+  VRA V   DD    V  +R++FL  V+ ++ +G N+FF+ R   ++I+  + Q+
Sbjct: 67  NSPFPEVRATVPATDDPTIVVNHWRTWFLTTVFVVVFAGVNQFFSLRYPSLSINFLVAQV 126

Query: 244 LLFPMGSLWAKIMPYWSFPIWKGKRIHLNIPQPWSQKEQMFSTVLFSIAVSSFYMDSVIL 303
           + +P+G + A ++P       +    +LN P P+++KE    T+  ++  S+ Y  ++++
Sbjct: 127 VCYPIGKILA-LLPQRDCA--RCPWFNLN-PGPFTKKEHAVVTIAVALTSSTAYAMNILI 182

Query: 304 TLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPSHAIWPSQLQTMALNKALFS 363
               FY  K+  GY        Q LG+G AG  RR+V+ P+  IWP  L +++L  +L +
Sbjct: 183 AQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSLHN 242

Query: 364 KKTEKG---GRGLTSQTFFYICVAFTFFYEWLPTYLFQILSTFNWMTWIKP--DNFNLAM 418
           +  +     G  ++   FF I ++ +F + W+P +LF+ LS FN + W      NF    
Sbjct: 243 RTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIANT 302

Query: 419 VTGSMGGVGINPIASFDWNVINYY---SALVTPLFSYANQMAGGLIAAICVLAI-YYSNQ 474
           + G   G+G  PI SFD+  ++     S   TP +  AN  A   I  I +L I Y++N 
Sbjct: 303 IFGVESGIGALPI-SFDYTQVSQAMSGSVFATPYWVSANSCASVFIFFILILPILYFTNT 361

Query: 475 FDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPPYYSAGNLFCYGVFIAS 534
           +  +Y+P+ S   F NT  +Y+V+ I+N    V++ KY+ YSP +     L  Y +  A+
Sbjct: 362 WYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYALNFAA 421

Query: 535 YPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSHALEEFHDPHSRM-MR 593
              +F +  L   K +   F                    R  +H  +   D H R+  +
Sbjct: 422 VVAVFVHCALYNGKDIKNKF--------------------RNKNHGGQ---DIHMRLYTQ 458

Query: 594 RYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNAVFLIPITILEATTAL 653
            Y + PDWWY ++ ++ + +G A + G+ ++ P W+ F+A+ ++ +  IP  ILEA T  
Sbjct: 459 NYKDCPDWWYLVLQVVMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQ 518

Query: 654 QLGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSYVGNLKLGHYSKIPPMALFRG 713
            +GLN++ E+I GY LP  P A +L K +G+ +  Q      +LKL  Y K+PP  +F  
Sbjct: 519 HVGLNIITELICGYMLPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAI 578

Query: 714 QMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAITYYNASVLWGA----IGPK 769
           Q++  +I  LV++G+  W  SNIK+ C   Q   FTC +  T +NAS++W        P 
Sbjct: 579 QIYATIISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLFSPG 638

Query: 770 RIFEGVYPILKWCWXXXXXXXXXXXXXXXXXPRFYPLWFNPLLVVGGMLNMAPPYNLTYM 829
           RI+    PI+ W +                      + F    V     N  PP      
Sbjct: 639 RIYN---PIM-WFFLIGLAVPLIVFALQRVFKHNQAIKFMHAPVFFAGPNSIPP-----S 689

Query: 830 TPGAIANFFSQFYMRKYHLRIW----QKYNYVLVAGFQTGLVXXXXXXXXXVQYKEKPIS 885
           TP   + FF+  Y+     + W     KYNYV+ AG +TG+          VQY    ++
Sbjct: 690 TPYNYSLFFAMSYVLNRIRKRWPLWFSKYNYVMGAGVETGVALAVVIIFLCVQYPGGKLN 749

Query: 886 WWGNDVINNGLDAA 899
           WWGN V  N  D A
Sbjct: 750 WWGNSVYKNTYDHA 763

>ZYRO0G22484g Chr7 (1848658..1851123) [2466 bp, 821 aa] {ON} similar
           to uniprot|O59822 Schizosaccharomyces pombe SPCC1840
           SPCC965.02 protein and weakly similar to YJL212C
           uniprot|P40897 Saccharomyces cerevisiae YJL212C OPT1
           Plasma membrane transporter that transports tetra- and
           pentapeptides and glutathione member of the OPT family
          Length = 821

 Score =  222 bits (566), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 183/724 (25%), Positives = 325/724 (44%), Gaps = 61/724 (8%)

Query: 203 PVETFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSMVQLLLFPMGSLWAKIMPYWSFP 262
           P  T R + ++++ +++ +G + FFA R   I+I   + QL+ +P G +WA+IMP W F 
Sbjct: 127 PANTLRMWLMSIILSMVIAGIDSFFAFRFPSISIGPIVAQLISYPCGIIWARIMPNWKFS 186

Query: 263 IWKGKRIHLNIPQPWSQKEQMFSTVLFSIAVSSFYMDSVILTLKMFYKEKVSFGYQFFTS 322
           I       LN P  +S +EQ    +  +  +++  + +  +    F+K  V  G      
Sbjct: 187 IGSKYTFELN-PGNFSPQEQALVYLFCNTVIATGLLRNTQVEQIKFFKVDVGIGRFILFD 245

Query: 323 IAVQFLGFGFAGSLRRFVIYPSHAIWPSQLQTMALNKALFSKKTEKGGRGLTSQ------ 376
           +    + +G AG     ++     IWPS L   AL  AL S     G +G  S       
Sbjct: 246 MVGYLIAWGMAGLSIPMLVDREELIWPSVLSPSALINALHS-----GTKGSISDFKKPKF 300

Query: 377 TFFYICVAFTFFYEWLPTYLFQILSTFN-WMTWIKPDNFNLAMVTGSMGGVGINPIASFD 435
           +FF I  A +F + W    +F  +++   + +WI+P N  L  V G   G+G+ PI SFD
Sbjct: 301 SFFMIAFAGSFVWYWFSDLIFPFIASLGAFPSWIRPKNKVLGQVFGVKNGLGLLPI-SFD 359

Query: 436 WNVI-NYYSALVTPLFSYANQMAGGLIAA-ICVLAIYYSNQFDCQYLPMFSNALFTNTGT 493
           W  I N  + L TP+++     A     A I +  +YY N ++  +LP+ SN +F   G 
Sbjct: 360 WPTISNINNPLTTPVWAGVMIFASFFFWAWIVIPGLYYQNHWETAHLPLMSNKIFDKNGQ 419

Query: 494 EYDVTSIINSKAEVDVNKYQNYSPPYYSAGNLFCYGVFIASYPLLFAYSFLTQWKVLLRA 553
            Y V +++NSK E+D++KY+ YSP Y   G L    + +  +  +  + F   WK     
Sbjct: 420 SYQVKNVVNSKWELDLDKYKQYSPVYLPIGFLIQLALGLGGFSSMMIFFF---WK----- 471

Query: 554 FKDWASAIWSLTKKHTWLYSWRESSHALEEFHDPHSRMMRRYNEVPDWWYYIVLILSIVI 613
           FK   S +W   K+H    S ++++H               YN+     +   ++L + +
Sbjct: 472 FK---SDVWDPFKQH----STKKTAH-----------YKSAYNKFFVAAFIGSMVLGLAL 513

Query: 614 GIAALEGYHTNTPIWS--LFMAVGLNAVFLIPITILEATTALQLGLNVLIEIIMGYALPG 671
           G   +E ++ +T I S    +++ +  V  +P+ ++E+ ++  L +N    ++  +   G
Sbjct: 514 GFVFVEAWNRDTQIDSGGFIVSIIIGIVLYLPVALVESKSSFTLNMNGFFNVVGAFWYKG 573

Query: 672 NPQALMLIKAFGYNIDGQADSYVGNLKLGHYSKIPPMALFRGQMFMVLI----QTLVSLG 727
            P A +    FGY+I   A  +    KLG+Y K PP    R  +F++ +     +LV+  
Sbjct: 574 KPMATLYFLNFGYSIFQHAMHFTQGAKLGYYMKTPP----RLTLFVLFVAGVWASLVTPS 629

Query: 728 VLNWSISNIKDYCQPNQESKFTCPDAITYYNASVLWGAIGPKRIFE--GVYPILKWCWXX 785
           V  + + ++ + C  N  +   C    T +N  ++WG  G   +F   G Y  + + +  
Sbjct: 630 VTGYVLYHVGNVCTSNAHNNMVCRSQQTAFNTQIIWGLFG-SHLFSTGGRYQFIMYFFLV 688

Query: 786 XXXXXXXXXXXXXXXPRFYPLW--FNPLLVVGGMLNMAPPYNLTYMTPGAIANFFSQFYM 843
                          PR   +W   +P L++ G  +M     L Y T   ++     F++
Sbjct: 689 GAGVALIVILMQWWRPR-SRVWSHVSPTLLLSGAEDMPTSTGLHYGT-WFMSILVFNFFI 746

Query: 844 RKYHLRIWQKYNYVLVAGFQTGLVXXXXXXXXXVQYK--EKPISWWGNDVINNGLDAAGP 901
            +   + W+KYN +L +    G+          V Y        WW  +V ++  D+ G 
Sbjct: 747 HRKRPQWWRKYNLILASALDCGVAIAAIIVYFAVTYTGGSSHYKWWATEVTSSSCDSKGC 806

Query: 902 PKKN 905
           P K+
Sbjct: 807 PYKS 810

>ZYRO0C18568g Chr3 (1457201..1459666) [2466 bp, 821 aa] {ON} similar
           to uniprot|O59822 Schizosaccharomyces pombe SPCC1840
           SPCC965.02 protein and weakly similar to YJL212C
           uniprot|P40897 Saccharomyces cerevisiae YJL212C OPT1
           Plasma membrane transporter that transports tetra- and
           pentapeptides and glutathione member of the OPT family
          Length = 821

 Score =  208 bits (529), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 197/824 (23%), Positives = 336/824 (40%), Gaps = 60/824 (7%)

Query: 104 DNITDIPADLKYVASQIVNMSLEEAAEVLKLGAEYHADDPNLSSDEYNDFVKLSELNPVT 163
           DN++     L     +  N +L E    +       +D PN   + Y+ FV   E    +
Sbjct: 25  DNVSKTSFGLTTPGGEEKNPTLTEKDPHIS-----SSDSPN-DEEGYHKFVGGKEQEQTS 78

Query: 164 LHPF-EEDALE---------LKAVAGLLHFHSPYKAVRACVSPQDDYESPVETFRSYFLA 213
           +    EED  E           A A +L                +DY  P  T R + + 
Sbjct: 79  IKKAGEEDPFEGSSFNDSSSSIAAADVLDITRADIHHIVDFKETEDYP-PANTLRMWLMG 137

Query: 214 LVWAIIGSGFNEFFAHRLMVITISSSMVQLLLFPMGSLWAKIMPYWSFPIWKGKRIHLNI 273
           ++ +++    + FFA R   I IS  + QL+ +P G LW +IMP W F I       LN 
Sbjct: 138 IILSMVIGAIDTFFAFRFPSIAISPIVGQLISYPFGILWYRIMPNWKFSIGSRYTFELN- 196

Query: 274 PQPWSQKEQMFSTVLFSIAVSSFYMDSVILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFA 333
           P  +S +EQ    +  +    +  + +  +    F+   V  G     +I    L +G A
Sbjct: 197 PGKFSPQEQALVYLFCNTVYGTGVLKNTQVEQTRFFNVDVGIGRFILFNIVGYLLAWGMA 256

Query: 334 GSLRRFVIYPSHAIWPSQLQTMALNKALFSKKTEKGGRGLTSQ-TFFYICVAFTFFYEWL 392
           G     ++     IWPS L   AL  A  S    K       + +FF I  A +F + W 
Sbjct: 257 GLAIPILVDREELIWPSVLGPSALINAFHSDTKGKFSDLKKPKFSFFMIAFAGSFVWYWF 316

Query: 393 PTYLFQILSTFN-WMTWIKPDNFNLAMVTGSMGGVGINPIASFDW-NVINYYSALVTPLF 450
              +   ++    + +WI+P N  L  V G   G+G+ PI SFDW  V N  + L TP++
Sbjct: 317 SDLILPFIANLGAFPSWIRPKNKVLGQVFGVKNGLGLLPI-SFDWPTVSNISNPLTTPVW 375

Query: 451 SYANQMAGGLIAAICVL-AIYYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDV 509
           +     A     A  V+  +YY + +   ++P+ SN +F   G  Y V  ++N K E+D 
Sbjct: 376 AGVMIFASFFFWAWVVIPGLYYQDHWQTAHMPLMSNKIFDKNGESYQVKKVVNKKWELDF 435

Query: 510 NKYQNYSPPYYSAGNLFCYGVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHT 569
            KY+ YSP Y   G L    + +  +  +  + F   WK     FK   S +W    +H 
Sbjct: 436 EKYKKYSPVYLPIGFLIQLALGLGGFSSVMTFFF---WK-----FK---SDVWDPFMQH- 483

Query: 570 WLYSWRESSHALEEFHDPHSRMMRRYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWS 629
              S ++++H    +  P               Y   ++L + +G   +E +  +T I S
Sbjct: 484 ---STKKTAHYKPAYTKPFVAA-----------YIASMVLGLGLGFVFVEAWDRDTQIDS 529

Query: 630 --LFMAVGLNAVFLIPITILEATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYNID 687
               +++ +  V  +P+ ++E+ ++  L +N ++ +I  +   G P A +    FG+++ 
Sbjct: 530 GGFVVSIIIGIVLFLPVALVESRSSFLLNMNGILNVIGAFWYKGKPMATLYFLNFGFSLF 589

Query: 688 GQADSYVGNLKLGHYSKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESK 747
                +    KLG+Y K PP       +   +  +L+   V  + + ++ + C PN  + 
Sbjct: 590 QHGMHFTQGAKLGYYMKTPPRLTILVLLVSGIWTSLIIPSVTGYVLYHVGNVCTPNAHNN 649

Query: 748 FTCPDAITYYNASVLWGAIGPKRIFE--GVYPILKWCWXXXXXXXXXXXXXXXXXP--RF 803
            TC    T +N  ++WG  G   +F   G Y  + + +                 P  RF
Sbjct: 650 MTCKSQQTAFNTQIVWGLFG-SHLFSNGGRYQFIMYFFLVGAGVSLIVILMQWRRPNSRF 708

Query: 804 YPLWFNPLLVVGGMLNMAPPYNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQ 863
           +    +P L++ G  +M     L Y T   +   F+ F  +K     W+KYN +L     
Sbjct: 709 WSK-VSPTLLLSGAEDMPTSTGLHYGTWFFLVLVFNGFIHKK-RPHWWRKYNLILATALD 766

Query: 864 TGLVXXXXXXXXXVQYK--EKPISWWGNDVINNGLDAAGPPKKN 905
            G+          V Y        WW  +V ++  D+ G P K+
Sbjct: 767 CGVAIAAIIVYFAVSYTGGSSHYKWWATEVTSSSCDSKGCPYKS 810

>ZYRO0D17974g Chr4 complement(1492455..1494785) [2331 bp, 776 aa]
           {ON} weakly similar to uniprot|Q06593 Saccharomyces
           cerevisiae YPR194C OPT2 Oligopeptide transporter member
           of the OPT family
          Length = 776

 Score =  177 bits (450), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 183/736 (24%), Positives = 317/736 (43%), Gaps = 62/736 (8%)

Query: 190 VRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSMVQLLLFPMG 249
           V+  V+ +DD + P  TFR   L++++ + G+  +   ++R      S   VQ+  + +G
Sbjct: 61  VKGVVTLEDDPQEPCFTFRMVILSIIFILPGAFLDTMNSYRTTSAAYSIFFVQICSYWVG 120

Query: 250 SLWAKIMPYWSFPIWKGKRIHLNIPQPWSQKEQMFSTVLFSIAVSSFYMDSVILTLKMFY 309
              AKI+P     I K K   LN P PWS KE +  T+  +   +     + +   +++Y
Sbjct: 121 KWLAKILPSKQIGIGKYK-FSLN-PGPWSIKENVLITLAAASGATGNQGTTPVSLAEVYY 178

Query: 310 KEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPSHAIWPSQL-QTMALN---KALFSKK 365
           K KV+     F    + F G+  +   R F+IY    +WP  L QT   N   KA     
Sbjct: 179 KTKVNPAVAIFFMWCINFSGYAMSYIARNFLIYDPQFVWPRALMQTNLFNSMKKADLPNH 238

Query: 366 TEKGGRGLTSQTFFYICVAFTFFYEWLPTYLFQILSTFNWMTWIKPDNFNLAMVTGSMGG 425
             +  R +  + FF + +  T  +E+ P Y+F +LS+ +++ W+ P+N+    + G MGG
Sbjct: 239 QRQSSRKM--KVFFMLIIGMTV-WEFFPEYVFPMLSSLSFLCWVAPNNYTANFIGGGMGG 295

Query: 426 VG-INPIASFDWNVINYYSALVTPLFSYANQMAGGLIAAICVLAIYYSNQFDCQYLPMFS 484
           +G +N   S DW  I   S +++P ++   Q A    +   ++              + S
Sbjct: 296 MGFLN--HSLDWANITS-SVMLSPYWTTCVQFAAFFFSCWVLIPAAKWGNMSSYKKGLMS 352

Query: 485 NALFTNTGTEYDVTSII--------NSKAEVDVNKYQNYSPPYYSAGN----LFCYGVFI 532
           N L T  GT Y  +S+I        N K   +   YQ + P Y  A       F Y  F 
Sbjct: 353 NKLLTRNGTVYPSSSLIIYDEGASKNGKVSFNEKAYQLHGPIYIGAQKAWNMFFDYAAFT 412

Query: 533 A--SYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSHALEEFHDPHSR 590
           +  S+ LLF        K + + FK     ++   K    LY            +D  ++
Sbjct: 413 SAISWMLLFGR------KDIAKNFKKLKQRLFH-NKNINLLY------------NDRLNK 453

Query: 591 MMRRYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNAVFLIPITILEAT 650
           +   Y EVP WW+ ++ ++++V+ +          P W+ F+AVG++ + +IP+  L A 
Sbjct: 454 IQSNYEEVPVWWFALLFLITLVVFVTIFATNTMFIPWWTYFVAVGVSFIIIIPLAYLYAI 513

Query: 651 TALQLGLNVLIEIIMGYALPG-----NPQALMLIKAFGYNIDGQADSYVGNLKLGHYSKI 705
           +  QL +    E++ G  +       +P +     A   ++  +A   + + K+GHY  I
Sbjct: 514 SNFQLAIGTFDELLYGVMVQNLSTHKHPASASTYGALSGDLWYRAQYMLQDQKIGHYMHI 573

Query: 706 PPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQES---KFTCPDAITYYNASVL 762
           PP A+F  Q+   LI   ++ G + W +    DY +   +    ++T     +Y   +VL
Sbjct: 574 PPKAVFLSQVLGQLIGVPMNYGTVRWVLDTKMDYLRGTAKDPLHQWTGQSLTSYNTNAVL 633

Query: 763 WGAIGPKRIF-EGVYPILKWCWXXXXXXXXXXXXXXXXXPRF-YPLWFNPLLVVGGMLNM 820
           +  +GP R F  G   I+ +                   PR  + LW N  +    M   
Sbjct: 634 YVLLGPTRFFSSGHNKIIPFGLLVGFFAPFLIYALYKLFPRRKFNLW-NVTIFCSTMSTF 692

Query: 821 APPYNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQTGLVXXXXXXXXXVQYK 880
               +  Y T   +   FS +Y+  +  + W+ YNY+  A F TG           +   
Sbjct: 693 YGNLSTGYATQFVVGT-FSMYYLYNHKPKFWRNYNYLTAAAFDTGY-NLAVLLIFIIFSS 750

Query: 881 EKPI---SWWGNDVIN 893
            KPI   +WWGN+ ++
Sbjct: 751 HKPIKMPNWWGNNAVS 766

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 99,497,060
Number of extensions: 4333229
Number of successful extensions: 10844
Number of sequences better than 10.0: 43
Number of HSP's gapped: 10899
Number of HSP's successfully gapped: 44
Length of query: 922
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 803
Effective length of database: 39,836,145
Effective search space: 31988424435
Effective search space used: 31988424435
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)