Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D09900g3.494ON28328312161e-170
TDEL0D056203.494ON27925710831e-150
YGR132C (PHB1)3.494ON28725810461e-144
Smik_6.2283.494ON28725710451e-144
Skud_7.4433.494ON28725810401e-143
SAKL0F02728g3.494ON28225710331e-142
Suva_7.4203.494ON28725710331e-142
KLTH0F14872g3.494ON28025710181e-140
CAGL0I10472g3.494ON28825110171e-139
NCAS0E007903.494ON32725810141e-138
Kpol_1017.53.494ON28325710081e-138
Kwal_55.212403.494ON28325710071e-138
TPHA0D032903.494ON28525910051e-138
NDAI0G009203.494ON2962519911e-135
TBLA0D029503.494ON2822569731e-133
KAFR0C019803.494ON2832599731e-133
KNAG0B007903.494ON2842579671e-132
KLLA0D16302g3.494ON2262119251e-126
Ecym_12353.494ON2832579231e-125
AFR313C3.494ON2832609151e-124
ADL141W5.98ON3072316613e-85
CAGL0L06490g5.98ON3132416589e-85
TBLA0H022205.98ON3072316492e-83
Suva_7.5235.98ON3102346483e-83
YGR231C (PHB2)5.98ON3102346473e-83
SAKL0G15510g5.98ON3082346456e-83
KAFR0B042505.98ON3102346441e-82
Smik_16.755.98ON3102346432e-82
TPHA0A050905.98ON3102316404e-82
Skud_7.5655.98ON3102346388e-82
Kpol_1050.615.98ON3102316371e-81
Kwal_27.127475.98ON3072316362e-81
NCAS0F006005.98ON3132316336e-81
KLTH0C01672g5.98ON3072316318e-81
NDAI0D025305.98ON3162316311e-80
TDEL0G012105.98ON3092316301e-80
KNAG0A015805.98ON2882316238e-80
ZYRO0B15136g5.98ON3102316214e-79
KLLA0E15731g5.98ON3082316189e-79
TDEL0H005207.518ON258873750.65
TPHA0D021305.363ON104676693.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D09900g
         (283 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar...   473   e-170
TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {...   421   e-150
YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}  P...   407   e-144
Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}...   407   e-144
Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}...   405   e-143
SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly ...   402   e-142
Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}...   402   e-142
KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa] ...   396   e-140
CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highl...   396   e-139
NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494     395   e-138
Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON} (19813..2...   392   e-138
Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {O...   392   e-138
TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON...   391   e-138
NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494     386   e-135
TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.49...   379   e-133
KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON...   379   e-133
KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.49...   377   e-132
KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa] ...   360   e-126
Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to...   360   e-125
AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON} ...   357   e-124
ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic hom...   259   3e-85
CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly...   258   9e-85
TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98...   254   2e-83
Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}...   254   3e-83
YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}  P...   253   3e-83
SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa] ...   253   6e-83
KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON...   252   1e-82
Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C ...   252   2e-82
TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {...   251   4e-82
Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}...   250   8e-82
Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {...   249   1e-81
Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa] ...   249   2e-81
NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98...   248   6e-81
KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly ...   247   8e-81
NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON...   247   1e-80
TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98...   247   1e-80
KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98 Y...   244   8e-80
ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} simil...   243   4e-79
KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} simil...   242   9e-79
TDEL0H00520 Chr8 complement(79507..87273) [7767 bp, 2588 aa] {ON...    33   0.65 
TPHA0D02130 Chr4 complement(435589..438723,438831..438836) [3141...    31   3.3  

>ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar to
           uniprot|P40961 Saccharomyces cerevisiae YGR132C
          Length = 283

 Score =  473 bits (1216), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 240/283 (84%), Positives = 240/283 (84%)

Query: 1   MSSRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPW 60
           MSSRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPW
Sbjct: 1   MSSRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPW 60

Query: 61  LQKAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLP 120
           LQKAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLP
Sbjct: 61  LQKAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLP 120

Query: 121 SIGNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFT 180
           SIGNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFT
Sbjct: 121 SIGNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFT 180

Query: 181 KAVELKQIAQQDAERAKFLVEKAEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRR 240
           KAVELKQIAQQDAERAKFLVEKAEQIRKVSVIR                        IRR
Sbjct: 181 KAVELKQIAQQDAERAKFLVEKAEQIRKVSVIRAEGEAEAAESISKALAKAGDGLLLIRR 240

Query: 241 LEASKDIAQTLANSSNVTYXXXXXXXXXXXXXXXXXXXNLGRT 283
           LEASKDIAQTLANSSNVTY                   NLGRT
Sbjct: 241 LEASKDIAQTLANSSNVTYLPSQQSGGGQEGTSQSLLLNLGRT 283

>TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {ON}
           Anc_3.494 YGR132C
          Length = 279

 Score =  421 bits (1083), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 207/257 (80%), Positives = 221/257 (85%)

Query: 3   SRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQ 62
           SRL E +A+VAIPLGIV SG+QYSMYDVRGGSRAVIFDRLSGVQ++VVGEGTHFLVPWLQ
Sbjct: 2   SRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQ 61

Query: 63  KAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSI 122
           KA++YD+RTKPK IATNTGTKDMQMVSLTLRVLHRP VLQLP IYQNLGLDYDERVLPSI
Sbjct: 62  KAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSI 121

Query: 123 GNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKA 182
           GNEVLKAIVA++DAAELITQRELVS  IRDELS+RASEF IRLEDVSITHMTFGPEFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKA 181

Query: 183 VELKQIAQQDAERAKFLVEKAEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLE 242
           VE KQIAQQDAERAKFLVEKAEQ+RK SVIR                        IRRLE
Sbjct: 182 VEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLE 241

Query: 243 ASKDIAQTLANSSNVTY 259
           ASK+IAQTLA SSN+TY
Sbjct: 242 ASKEIAQTLAASSNITY 258

>YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}
           PHB1Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 287

 Score =  407 bits (1046), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 197/258 (76%), Positives = 220/258 (85%)

Query: 2   SSRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWL 61
           S++L + + KVA+P+GI+ASGIQYSMYDV+GGSR VIFDR++GV+Q+VVGEGTHFLVPWL
Sbjct: 4   SAKLIDVITKVALPIGIIASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWL 63

Query: 62  QKAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPS 121
           QKA+IYDVRTKPKSIATNTGTKD+QMVSLTLRVLHRP+VLQLP IYQNLGLDYDERVLPS
Sbjct: 64  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPS 123

Query: 122 IGNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTK 181
           IGNEVLK+IVA++DAAELITQRE++S  IR ELS RA+EF I+LEDVSITHMTFGPEFTK
Sbjct: 124 IGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTK 183

Query: 182 AVELKQIAQQDAERAKFLVEKAEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRL 241
           AVE KQIAQQDAERAKFLVEKAEQ R+ SVIR                        IRRL
Sbjct: 184 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRL 243

Query: 242 EASKDIAQTLANSSNVTY 259
           EASKDIAQTLANSSNV Y
Sbjct: 244 EASKDIAQTLANSSNVVY 261

>Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  407 bits (1045), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 198/257 (77%), Positives = 219/257 (85%)

Query: 3   SRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQ 62
           SRL + + KVA+P+GIVASGIQYSMYDV+GGSR VIFDR++GV+Q+VVGEGTHFLVPWLQ
Sbjct: 5   SRLIDIITKVALPIGIVASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 63  KAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSI 122
           KA+IYDVRTKPKSIATNTGT+D+QMVSLTLRVLHRP+VLQLP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSI 124

Query: 123 GNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKA 182
           GNEVLK+IVA++DAAELITQRE++S  IR ELS RA+EF I+LEDVSITHMTFGPEFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 183 VELKQIAQQDAERAKFLVEKAEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLE 242
           VE KQIAQQDAERAKFLVEKAEQ R+ SVIR                        IRRLE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 243 ASKDIAQTLANSSNVTY 259
           ASKDIAQTLANSSNV Y
Sbjct: 245 ASKDIAQTLANSSNVVY 261

>Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  405 bits (1040), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 195/258 (75%), Positives = 220/258 (85%)

Query: 2   SSRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWL 61
           +SRL + + KVA+P+GI+A+GIQY+MYDV+GGSR VIFDR++GV+Q+VVGEGTHFLVPWL
Sbjct: 4   ASRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWL 63

Query: 62  QKAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPS 121
           QKA+IYDVRTKPKSIATNTGT+D+QMVSLTLRVLHRP+VLQLP IYQNLGLDYDERVLPS
Sbjct: 64  QKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPS 123

Query: 122 IGNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTK 181
           IGNEVLK+IVA++DAAELITQRE++S  IR ELS RA+EF I+LEDVSITHMTFGPEFTK
Sbjct: 124 IGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTK 183

Query: 182 AVELKQIAQQDAERAKFLVEKAEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRL 241
           AVE KQIAQQDAERAKFLVEKAEQ R+ SVIR                        IRRL
Sbjct: 184 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRL 243

Query: 242 EASKDIAQTLANSSNVTY 259
           EASKDIAQTLANSSNV Y
Sbjct: 244 EASKDIAQTLANSSNVVY 261

>SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 282

 Score =  402 bits (1033), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 194/257 (75%), Positives = 222/257 (86%)

Query: 3   SRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQ 62
           S+LA+++A++A+P+GI  S +QYSMYDV+GG+RAVIFDRLSGVQQ+V+GEGTHFLVPWLQ
Sbjct: 2   SKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQ 61

Query: 63  KAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSI 122
           +A++YDVRTKPK+IATNTGTKD+QMVSLTLRVLHRP+VLQLPHIYQNLGLDYDERVLPSI
Sbjct: 62  RAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSI 121

Query: 123 GNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKA 182
           GNEVLKAIVA++DAAELITQRE+VS  IR ELS RA+EF+IRLEDVSITHMTFG EFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKA 181

Query: 183 VELKQIAQQDAERAKFLVEKAEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLE 242
           VE KQIAQQDAERAKFLVE+AEQ R+ +VIR                        IRRLE
Sbjct: 182 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLE 241

Query: 243 ASKDIAQTLANSSNVTY 259
           ASK+IAQTLANSSNVTY
Sbjct: 242 ASKEIAQTLANSSNVTY 258

>Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  402 bits (1033), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 194/257 (75%), Positives = 218/257 (84%)

Query: 3   SRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQ 62
           SR  + + KVA+P+G+VASG+QYSMYDV+GGSR VIFDR++GV+Q+VVGEGTHFLVPWLQ
Sbjct: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 63  KAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSI 122
           KA+IYDVRTKPKSIATNTGT+D+QMVSLTLRVLHRP+VLQLP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 123 GNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKA 182
           GNEVLK+IVA++DAAELITQRE++S  IR ELS RA+EF I+LEDVSITHMTFGPEFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 183 VELKQIAQQDAERAKFLVEKAEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLE 242
           VE KQIAQQDAERAKF+VEKAEQ R+ SVIR                        IRRLE
Sbjct: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244

Query: 243 ASKDIAQTLANSSNVTY 259
           ASKDIAQTLANSSNV Y
Sbjct: 245 ASKDIAQTLANSSNVIY 261

>KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa]
           {ON} highly similar to uniprot|P40961 Saccharomyces
           cerevisiae YGR132C
          Length = 280

 Score =  396 bits (1018), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 195/257 (75%), Positives = 219/257 (85%)

Query: 3   SRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQ 62
           SRLA+++AK+A+PLG+ AS +QYSMYDV+GGSRAVIFDRLSGVQQ+VVGEGTHFLVPWLQ
Sbjct: 2   SRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQ 61

Query: 63  KAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSI 122
           KAV+YDVRTKPK+IATNTGTKD+QMVSLTLRVLHRP V++LP IYQNLGLDYDERVLPSI
Sbjct: 62  KAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSI 121

Query: 123 GNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKA 182
           GNEVLKAIVA++DAAELITQRE VS  IR ELS RASEF+IRLEDVSITHMTFG EFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKA 181

Query: 183 VELKQIAQQDAERAKFLVEKAEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLE 242
           VE KQIAQQDAERA+++VE AEQ R+ SVIR                        IRR+E
Sbjct: 182 VEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIE 241

Query: 243 ASKDIAQTLANSSNVTY 259
           ASK+IA+TLANSSNVTY
Sbjct: 242 ASKEIAKTLANSSNVTY 258

>CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132c prohibitin antiproliferative protein
          Length = 288

 Score =  396 bits (1017), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 193/251 (76%), Positives = 212/251 (84%)

Query: 9   VAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYD 68
           + KVAIP+GI  SG+QYSMYDV+GGSR VIFDRL GV+ +VVGEGTHFLVPWLQKA+IYD
Sbjct: 12  ITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYD 71

Query: 69  VRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLK 128
           VRTKPKSIATNTGTKD+QMVSLTLRVLHRP V+QLP IYQNLGLDYDERVLPSIGNEVLK
Sbjct: 72  VRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLK 131

Query: 129 AIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQI 188
           +IVA++DAAELITQRE+VS  IR ELSNRA+EF IRLEDVSITHMTFGPEFTKAVE KQI
Sbjct: 132 SIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQI 191

Query: 189 AQQDAERAKFLVEKAEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEASKDIA 248
           AQQDAERA+FLVEKAEQ R+ SVIR                        IRRLEASK+IA
Sbjct: 192 AQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIA 251

Query: 249 QTLANSSNVTY 259
           QTLANS+N+TY
Sbjct: 252 QTLANSNNITY 262

>NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494
          Length = 327

 Score =  395 bits (1014), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 191/258 (74%), Positives = 214/258 (82%)

Query: 2   SSRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWL 61
            ++L   + +VA+PLGI+A+G++YSMYDV+GGSR VIFDRLSGVQ+ V+GEGTHFLVPWL
Sbjct: 46  GTKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWL 105

Query: 62  QKAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPS 121
           QKAVIYDVRTKPKSIATNTGTKD+QMVSLTLRVLHRP + +LP IYQNLGLDYDE+VLPS
Sbjct: 106 QKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPS 165

Query: 122 IGNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTK 181
           IGNEVLK+IVA++DAAELITQRE+VS  I+ ELS RA EF IRLEDVSITHMTFGPEFTK
Sbjct: 166 IGNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTK 225

Query: 182 AVELKQIAQQDAERAKFLVEKAEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRL 241
           AVE KQIAQQDAERAKFLVEKAEQ R+ SVIR                        IRRL
Sbjct: 226 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRL 285

Query: 242 EASKDIAQTLANSSNVTY 259
           EASKDIAQTLANS N+TY
Sbjct: 286 EASKDIAQTLANSPNITY 303

>Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON}
           (19813..20664) [852 nt, 284 aa]
          Length = 283

 Score =  392 bits (1008), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 192/257 (74%), Positives = 217/257 (84%)

Query: 3   SRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQ 62
           S++ +TVAKVA+P+GIV SGIQ+SMYDV+GGSRAVIFDR+SGV+Q ++GEGTHFL+PWLQ
Sbjct: 2   SKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQ 61

Query: 63  KAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSI 122
           KA+IYDVRTKPKSIATNTGTKD+QMVSLTLRVLHRP V+QLP IYQNLGLDYDERVLPSI
Sbjct: 62  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSI 121

Query: 123 GNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKA 182
            NEVLKAIVA++DAAELITQRE+VS+ IR EL  R++EF IRLEDVSITHMTFG EFTKA
Sbjct: 122 SNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKA 181

Query: 183 VELKQIAQQDAERAKFLVEKAEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLE 242
           VELKQIAQQDAERAKFLVEKAEQ R+ +VIR                        IRRLE
Sbjct: 182 VELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLE 241

Query: 243 ASKDIAQTLANSSNVTY 259
           ASK+IA TL+ SSNVTY
Sbjct: 242 ASKEIAATLSQSSNVTY 258

>Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {ON}
           YGR132C (PHB1) - mitochondrial protein, prohibitin
           homolog; similar to S. cerevisiae Phb2p [contig 130]
           FULL
          Length = 283

 Score =  392 bits (1007), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 191/257 (74%), Positives = 218/257 (84%)

Query: 3   SRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQ 62
           SR A+++AK+A+PLG+ AS +QYSMYDV+GGSRAVIFDRLSGVQQ+VVGEGTHFL+PWLQ
Sbjct: 2   SRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQ 61

Query: 63  KAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSI 122
           KAV++DVRTKPK+IATNTGTKD+QMVSLTLRVLHRP V++LP IYQNLGLDYDERVLPSI
Sbjct: 62  KAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSI 121

Query: 123 GNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKA 182
           GNEVLK+IVA++DAAELITQRE VS  IR ELS RASEF+IRLEDVSITHMTFG +FTKA
Sbjct: 122 GNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKA 181

Query: 183 VELKQIAQQDAERAKFLVEKAEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLE 242
           VE KQIAQQDAERA+F+VE AEQ R+ SVIR                        IRR+E
Sbjct: 182 VEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIE 241

Query: 243 ASKDIAQTLANSSNVTY 259
           ASK+IA+TLANSSNVTY
Sbjct: 242 ASKEIAKTLANSSNVTY 258

>TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON}
           Anc_3.494 YGR132C
          Length = 285

 Score =  391 bits (1005), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 189/259 (72%), Positives = 218/259 (84%)

Query: 1   MSSRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPW 60
           MS+++ + + K+A+PLGI  SGIQY+MYDV+GGSRAVIFDRLSGV+Q+V+GEGTHFL PW
Sbjct: 1   MSTKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPW 60

Query: 61  LQKAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLP 120
           LQKA+++DVRTKPKSIATNTGTKD+QMVSLTLRVLHRP V QLP IYQNLGLDYDERVLP
Sbjct: 61  LQKAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLP 120

Query: 121 SIGNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFT 180
           SIGNEVLKAIVA++DAAELITQRE+VSN IR+ELS R++EF I+LEDVSITHMTFG EFT
Sbjct: 121 SIGNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFT 180

Query: 181 KAVELKQIAQQDAERAKFLVEKAEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRR 240
           KAVE KQIAQQDAERAKFLVE+AEQ R+ +VIR                        IRR
Sbjct: 181 KAVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISKALAKAGDGLLLIRR 240

Query: 241 LEASKDIAQTLANSSNVTY 259
           LEASK+IA+TL+ SSNVTY
Sbjct: 241 LEASKEIAKTLSQSSNVTY 259

>NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494
          Length = 296

 Score =  386 bits (991), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 189/251 (75%), Positives = 209/251 (83%)

Query: 9   VAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYD 68
           + KVA+P+G++ +G+ YSMYDV+GGSR VIFDRLSGV+  VVGEGTHFLVPWLQKAVIYD
Sbjct: 18  LTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYD 77

Query: 69  VRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLK 128
           VRTKPKSIATNTGTKD+QMVSLTLRVLHRP V +LP IYQNLGLDYDE+VLPSIGNEVLK
Sbjct: 78  VRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLK 137

Query: 129 AIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQI 188
           +IVA++DAAELITQRE+VS  I+ ELS RA+EF +RLEDVSITHMTFGPEFTKAVE KQI
Sbjct: 138 SIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQI 197

Query: 189 AQQDAERAKFLVEKAEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEASKDIA 248
           AQQDAERAKFLVEKAEQ R+ SVIR                        IRRLEASKDIA
Sbjct: 198 AQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIA 257

Query: 249 QTLANSSNVTY 259
           QTLANS NVTY
Sbjct: 258 QTLANSPNVTY 268

>TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.494
           YGR132C
          Length = 282

 Score =  379 bits (973), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 183/256 (71%), Positives = 212/256 (82%)

Query: 4   RLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQK 63
           ++AE +AK+AIPLG+  S + YSMYDV+GGSRAVIFDR+ GV+Q VVGEGTHFLVPWLQK
Sbjct: 5   KIAEKLAKIAIPLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQK 64

Query: 64  AVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIG 123
           +VI+D+RTKPK+I TNTGT+D+QMVSLTLR+LHRP ++QLP IYQNLGLDYDERVLPSIG
Sbjct: 65  SVIFDIRTKPKNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIG 124

Query: 124 NEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAV 183
           NEVLK+IVA++DAAELITQRE+VS  IR EL++RA+EF IRLEDVSITHMTFGPEFTKAV
Sbjct: 125 NEVLKSIVAQFDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAV 184

Query: 184 ELKQIAQQDAERAKFLVEKAEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEA 243
           E KQIAQQDAERAKFLVEKAEQ R+ SVIR                        IRRLE 
Sbjct: 185 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLET 244

Query: 244 SKDIAQTLANSSNVTY 259
           SK+IA+TLA S +VTY
Sbjct: 245 SKEIAETLAGSPHVTY 260

>KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON}
           Anc_3.494 YGR132C
          Length = 283

 Score =  379 bits (973), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 183/259 (70%), Positives = 213/259 (82%)

Query: 1   MSSRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPW 60
           MS+R    V K+AIP G++ + + YSMYDV+GGSR VIFDR+SGV++ V+GEGTHFLVPW
Sbjct: 1   MSTRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPW 60

Query: 61  LQKAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLP 120
           LQKA+IYDVRTKPKSI+TNTGTKD+QMVSLTLR+LHRP V++LP IYQNLGLDYDERVLP
Sbjct: 61  LQKAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLP 120

Query: 121 SIGNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFT 180
           SIGNEVLK+IVA++DAAELITQRE+VS  IR E+S+RA+EF I+LEDVSITHMTFG EFT
Sbjct: 121 SIGNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFT 180

Query: 181 KAVELKQIAQQDAERAKFLVEKAEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRR 240
           KAVE KQIAQQDAERA+FLVEKAEQ R+ SVIR                        IRR
Sbjct: 181 KAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRR 240

Query: 241 LEASKDIAQTLANSSNVTY 259
           LEASKDIA+TL+ SSN+TY
Sbjct: 241 LEASKDIARTLSKSSNITY 259

>KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.494
           YGR132C
          Length = 284

 Score =  377 bits (967), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 185/257 (71%), Positives = 210/257 (81%)

Query: 3   SRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQ 62
           S+    ++K+AIP G++     Y+MYDV+GGSR VIFDR+SGVQQ VVGEGTHFLVPWLQ
Sbjct: 2   SKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQ 61

Query: 63  KAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSI 122
           KA+IYDVR+KPKSIATNTGTKD+QMVSLTLRVLHRP+V++LP IYQ+LGLDYDERVLPSI
Sbjct: 62  KAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSI 121

Query: 123 GNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKA 182
           GNEVLK+IVA++DAAELITQRE+VS  IR ELS RA EF IRLEDVSITHMTFG EFTKA
Sbjct: 122 GNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKA 181

Query: 183 VELKQIAQQDAERAKFLVEKAEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLE 242
           VE KQIAQQDAERAKFLVEKAEQ+R+ SVIR                        IRRLE
Sbjct: 182 VEQKQIAQQDAERAKFLVEKAEQMRQASVIRAEGEAESAEAISKALAKVGDGLLLIRRLE 241

Query: 243 ASKDIAQTLANSSNVTY 259
           ASK+IA+TL+ SSNVTY
Sbjct: 242 ASKEIARTLSRSSNVTY 258

>KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa]
           {ON} similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 226

 Score =  360 bits (925), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 170/211 (80%), Positives = 192/211 (90%)

Query: 3   SRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQ 62
           SR+A+ +A++AIP+G+  S IQYSMYDVRGG RAVIFDRL GVQQ V+GEGTHFLVPWLQ
Sbjct: 2   SRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQ 61

Query: 63  KAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSI 122
           K++++DVRTKPK+IATNTGTKD+QMVSLTLRVLHRP V+QLP IYQNLG+DYDERVLPSI
Sbjct: 62  KSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSI 121

Query: 123 GNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKA 182
           GNEVLKAIVA++DAAELITQRE+VS  IR ELS RA EF I+LEDVSITHMTFG EFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKA 181

Query: 183 VELKQIAQQDAERAKFLVEKAEQIRKVSVIR 213
           VE KQIAQQDAERA+FLVEKAEQ RK +VIR
Sbjct: 182 VEQKQIAQQDAERARFLVEKAEQERKAAVIR 212

>Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to
           Ashbya gossypii AFR313C
          Length = 283

 Score =  360 bits (923), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 176/257 (68%), Positives = 202/257 (78%)

Query: 3   SRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQ 62
           SR  E +A +A+P+G+     Q  +YDVRGG+RAVIFDRLSGVQQ+VVGEGTHFL+PWLQ
Sbjct: 2   SRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQ 61

Query: 63  KAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSI 122
           KAVIYDVRTKPK+IATNTGTKD+Q+V+LTLRVLHRP V+ LP IYQ LGLDYDERVLPSI
Sbjct: 62  KAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSI 121

Query: 123 GNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKA 182
           GNEVLKAIVA++DAAELITQRELVS  IR EL+ RA  F I+LEDV+ITHM FG EFTK+
Sbjct: 122 GNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKS 181

Query: 183 VELKQIAQQDAERAKFLVEKAEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLE 242
           VE KQIAQQ++ERAK+LV+ AEQ R  +VIR                        IRRLE
Sbjct: 182 VEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLE 241

Query: 243 ASKDIAQTLANSSNVTY 259
           ASK IAQTLA SSN+TY
Sbjct: 242 ASKKIAQTLAGSSNITY 258

>AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR132C
           (PHB1)
          Length = 283

 Score =  357 bits (915), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 175/260 (67%), Positives = 212/260 (81%), Gaps = 3/260 (1%)

Query: 3   SRLAETVAKVAIPLGIVA---SGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVP 59
           SRLA+++ ++ +PL  +A   S +Q+SMYDVRGG+RA+IFDR+SGV+ +VVGEGTHFL+P
Sbjct: 2   SRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIP 61

Query: 60  WLQKAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVL 119
           WLQKA+I+DVRTKP++IATNTGTKD+QMVSLTLRVLHRP V+ L  IY+ LG DYDERVL
Sbjct: 62  WLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVL 121

Query: 120 PSIGNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEF 179
           PSIGNEVLKAIVA+++A+ELITQRELVS  IR+EL+ RASEF+IRLEDVSITHMTFG EF
Sbjct: 122 PSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEF 181

Query: 180 TKAVELKQIAQQDAERAKFLVEKAEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIR 239
           TKAVE KQIAQQ+++RAKF+VE+AEQ R+ +VIR                        IR
Sbjct: 182 TKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIR 241

Query: 240 RLEASKDIAQTLANSSNVTY 259
           RLEASK IA+TLANS NVTY
Sbjct: 242 RLEASKGIAETLANSPNVTY 261

>ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR231C (PHB2)
          Length = 307

 Score =  259 bits (661), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 128/231 (55%), Positives = 167/231 (72%), Gaps = 1/231 (0%)

Query: 26  SMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDM 85
           S+++V GG RA+++ RLSGVQQ V GEGTHF++PWL+  V+YDVR+KP+++++ TGT D+
Sbjct: 57  SLFNVDGGHRAIVYSRLSGVQQSVYGEGTHFVIPWLETPVLYDVRSKPRTVSSLTGTNDL 116

Query: 86  QMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVARYDAAELITQREL 145
           QMV++T RVL RP V  LP IY+ LG DYDERVLPSI NEVLKA+VA+++A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVQHLPLIYRTLGTDYDERVLPSIVNEVLKAVVAQFNASQLITQRES 176

Query: 146 VSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDAERAKFLVEKAEQ 205
           VS  IRD L  RAS F+I L+DVSIT+MTF PEFT AVE KQ+AQQDA+RA F VEKA+Q
Sbjct: 177 VSRLIRDNLVRRASRFNIMLDDVSITYMTFSPEFTSAVEAKQVAQQDAQRASFYVEKAKQ 236

Query: 206 IRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEASKDIAQTLANSSN 256
             K S+I                         ++RL+ +++IA  LA S N
Sbjct: 237 -EKQSMIVKAQGEAKSAELIGEAIKKSKDYVELKRLDTAREIAGILAASPN 286

>CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231c PHB2 or uniprot|P40961 Saccharomyces cerevisiae
           YGR132c PHB1
          Length = 313

 Score =  258 bits (658), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 126/241 (52%), Positives = 172/241 (71%), Gaps = 1/241 (0%)

Query: 16  LGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKPKS 75
           LG  A     ++++V GG RA+++ R+ GV Q++  EGTH ++PW++  ++YDVR KP++
Sbjct: 49  LGAGALFFNNALFNVDGGHRAIVYSRIGGVSQKIFSEGTHIIIPWIETPIVYDVRAKPRN 108

Query: 76  IATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVARYD 135
           +A+ TGTKD+QMV++T RVL RP V QLP IY+ LG DYDERVLPSI NEVLKA+VA+++
Sbjct: 109 VASLTGTKDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFN 168

Query: 136 AAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDAER 195
           A++LITQRE VS  IRD L  RAS F+I L+DVSIT+MTF PEFT+AVE KQIAQQDA+R
Sbjct: 169 ASQLITQREKVSRLIRDNLVRRASGFNILLDDVSITYMTFSPEFTQAVEAKQIAQQDAQR 228

Query: 196 AKFLVEKAEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEASKDIAQTLANSS 255
           A F+V+KA Q ++  V++                        ++RL+ +KDIA+ LANS 
Sbjct: 229 AAFIVDKARQEKQGMVVK-AQGEAKSAELIGDAIKKSRDYVELKRLDTAKDIAKILANSP 287

Query: 256 N 256
           N
Sbjct: 288 N 288

>TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98
           YGR231C
          Length = 307

 Score =  254 bits (649), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 167/231 (72%), Gaps = 1/231 (0%)

Query: 26  SMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDM 85
           S+++V GG RA+++ RLSGV  ++  EGTHF++PWLQ  +IYDVR KP+++A+ TGTKD+
Sbjct: 55  SLFNVDGGHRAILYSRLSGVSSKIYNEGTHFVIPWLQTPIIYDVRAKPRNVASLTGTKDL 114

Query: 86  QMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVARYDAAELITQREL 145
           QMV++T RVL RP +  LP IY+ LG DYDERVLPSI NEVLKA+VA+++A++LITQR+ 
Sbjct: 115 QMVNITCRVLSRPDIPSLPLIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 174

Query: 146 VSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDAERAKFLVEKAEQ 205
           VS  IR+ L  RA +F+I L+DVSIT MTF PEFT AVE KQIAQQDA+RA FLV++A Q
Sbjct: 175 VSRLIRENLVRRAGKFNIALDDVSITFMTFSPEFTNAVESKQIAQQDAQRAAFLVDRARQ 234

Query: 206 IRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEASKDIAQTLANSSN 256
            ++  V++                        ++RL+ SKDIA+ LA SSN
Sbjct: 235 EKQGMVVK-AQGEAKSAELIGEAIKKSKDYVELKRLDISKDIAKILATSSN 284

>Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  254 bits (648), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 124/234 (52%), Positives = 167/234 (71%), Gaps = 1/234 (0%)

Query: 23  IQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGT 82
           +  ++++V GG RA+++ RL+GV   +  EGTHF+ PW+   +IYDVR KP+++A+ TGT
Sbjct: 54  VNNALFNVDGGHRAIVYSRLNGVSARIFNEGTHFIFPWIDTPIIYDVRAKPRNVASLTGT 113

Query: 83  KDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVARYDAAELITQ 142
           KD+QMV++T RVL RP V QLP IY+ LG DYDERVLPSI NEVLKA+VA+++A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 143 RELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDAERAKFLVEK 202
           RE VS  IR+ L  RAS FSI L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASRFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 203 AEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEASKDIAQTLANSSN 256
           A Q ++  V++                        ++RL+ ++DIA+ LANS N
Sbjct: 234 ARQEKQGMVVK-AQGEAKSAELIGEAIKKSKDYVELKRLDTARDIAKILANSPN 286

>YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}
           PHB2Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 310

 Score =  253 bits (647), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 124/234 (52%), Positives = 168/234 (71%), Gaps = 1/234 (0%)

Query: 23  IQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGT 82
           I  ++++V GG RA+++ R+ GV   +  EGTHF+ PWL   +IYDVR KP+++A+ TGT
Sbjct: 54  INNALFNVDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGT 113

Query: 83  KDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVARYDAAELITQ 142
           KD+QMV++T RVL RP V+QLP IY+ LG DYDERVLPSI NEVLKA+VA+++A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 143 RELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDAERAKFLVEK 202
           RE VS  IR+ L  RAS+F+I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 203 AEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEASKDIAQTLANSSN 256
           A Q ++  V+R                        ++RL+ ++DIA+ LA+S N
Sbjct: 234 ARQEKQGMVVR-AQGEAKSAELIGEAIKKSRDYVELKRLDTARDIAKILASSPN 286

>SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P50085 Saccharomyces
           cerevisiae YGR231C PHB2 Possible role in aging
           mitochondrial protein prohibitin homolog homolog of
           mammalian BAP37 and S. cerevisiae Phb1p
          Length = 308

 Score =  253 bits (645), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 121/234 (51%), Positives = 170/234 (72%), Gaps = 1/234 (0%)

Query: 23  IQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGT 82
           +  ++++V GG RA+++ R+ G+QQ +  EGTHF VPWL+  ++YDVR KP+++A+ TGT
Sbjct: 55  VNSALFNVDGGHRAILYSRVGGIQQRIYNEGTHFAVPWLETPIVYDVRAKPRNVASLTGT 114

Query: 83  KDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVARYDAAELITQ 142
           KD+QMV++T RVL RP+V QLP IY+ LG DYDERVLPSI NEVLKA+VA+++A++LITQ
Sbjct: 115 KDLQMVNITCRVLSRPEVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 174

Query: 143 RELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDAERAKFLVEK 202
           RE VS  IR+ L  RAS+F+I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 175 RERVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 234

Query: 203 AEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEASKDIAQTLANSSN 256
           A Q ++  V++                        ++RL+ +++IA+ L+ S N
Sbjct: 235 ARQEKQGMVVK-AQGEAQSAELIGEAIKKSKDYVELKRLDTAREIAEILSKSPN 287

>KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  252 bits (644), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 170/234 (72%), Gaps = 1/234 (0%)

Query: 23  IQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGT 82
           +Q S+++V GG RA+++ R++GV   +  EGTHF++PWL+  ++YDVR KP+++A+ TGT
Sbjct: 53  LQQSLFNVDGGHRAIVYSRINGVSSRIYNEGTHFILPWLETPIVYDVRAKPRNVASLTGT 112

Query: 83  KDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVARYDAAELITQ 142
           KD+QMV++T RVL RP V  LP IY+ LG DYDERVLPSI NEVLKA+VA+++A++LITQ
Sbjct: 113 KDLQMVNITCRVLSRPDVRSLPIIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 172

Query: 143 RELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDAERAKFLVEK 202
           RE VS  IR+ L  RAS+F+I L+DVSIT MTF PEFT+AVE KQIAQQDA+RA F+V+K
Sbjct: 173 REKVSKLIRENLVRRASKFNIMLDDVSITFMTFSPEFTQAVEAKQIAQQDAQRAAFIVDK 232

Query: 203 AEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEASKDIAQTLANSSN 256
           A Q ++  V++                        ++RL+ +++IA+ LANS N
Sbjct: 233 ARQEKQGMVVK-AQGEAKSAELIGEAIKKSRDYVELKRLDTAREIARILANSPN 285

>Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C
           (REAL)
          Length = 310

 Score =  252 bits (643), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 169/234 (72%), Gaps = 1/234 (0%)

Query: 23  IQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGT 82
           I  ++++V GG RA+++ R+ GV  ++  EGTHF+ PWL   ++YDVR KP+++A+ TGT
Sbjct: 54  INNALFNVDGGHRAIVYSRIHGVSTKIFNEGTHFIFPWLDTPIVYDVRAKPRNVASLTGT 113

Query: 83  KDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVARYDAAELITQ 142
           KD+QMV++T RVL RP V+QLP IY+ LG DYDERVLPSI NEVLKA+VA+++A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 143 RELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDAERAKFLVEK 202
           RE VS  IR+ L  RAS+F+I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 203 AEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEASKDIAQTLANSSN 256
           A Q ++  V++                        ++RL+ ++DIA+ LA+S N
Sbjct: 234 ARQEKQGMVVK-AQGEAKSAELIGEAIKKSRDYVELKRLDTARDIAKILASSPN 286

>TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  251 bits (640), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 122/231 (52%), Positives = 166/231 (71%), Gaps = 1/231 (0%)

Query: 26  SMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDM 85
           ++++V GG RA+++ R+ GV  ++  EGTHF++PW++  VIYDVR KP+++A+ TGTKD+
Sbjct: 58  ALFNVDGGHRAIVYSRIGGVSNKIYTEGTHFVIPWIETPVIYDVRAKPRNVASLTGTKDL 117

Query: 86  QMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVARYDAAELITQREL 145
           QMV++T RVL RP V QLP IY+ LG DYDERVLPSI NEVLKA+VA+++A++LITQR+ 
Sbjct: 118 QMVNITCRVLSRPNVTQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 177

Query: 146 VSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDAERAKFLVEKAEQ 205
           VS  IRD L  RA +F+I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 178 VSRLIRDNLVLRAQKFNITLDDVSITYMTFSPEFTTAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 206 IRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEASKDIAQTLANSSN 256
            ++  V++                        ++RL+ +KDIA  LA S N
Sbjct: 238 EKQGMVVK-AQGEAKSAELIGEAIKKSKDYVELKRLDTAKDIADILAKSPN 287

>Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  250 bits (638), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 121/234 (51%), Positives = 167/234 (71%), Gaps = 1/234 (0%)

Query: 23  IQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGT 82
           +  ++++V GG RA+++ R+ GV  ++  EGTHF+ PWL   +IYDVR KP+++A+ TGT
Sbjct: 54  VNNALFNVDGGHRAIVYSRIHGVSSKIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGT 113

Query: 83  KDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVARYDAAELITQ 142
           KD+QMV++T RVL RP V QLP IY+ LG DYDERVLPSI NEVLK++VA+++A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVAQLPIIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQ 173

Query: 143 RELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDAERAKFLVEK 202
           RE VS  IR+ L  RA+ F+I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRATRFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 203 AEQIRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEASKDIAQTLANSSN 256
           A Q ++  V++                        ++RL+ ++DIA+ LANS N
Sbjct: 234 ARQEKQGMVVK-AQGEAKSAELIGEAIKKSRDYVELKRLDTARDIAKILANSPN 286

>Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {ON}
           complement(135758..136690) [933 nt, 311 aa]
          Length = 310

 Score =  249 bits (637), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 120/231 (51%), Positives = 167/231 (72%), Gaps = 1/231 (0%)

Query: 26  SMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDM 85
           ++++V GG RA+++ R+ GV  ++  EGTHF++PWL+  V+YDVR KP+++A+ TGTKD+
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSKIYNEGTHFVLPWLETPVVYDVRAKPRNVASLTGTKDL 119

Query: 86  QMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVARYDAAELITQREL 145
           QMV++T RVL RP V QLP IY+ LG DYDERVLPSI NEVLKA+VA+++A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 146 VSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDAERAKFLVEKAEQ 205
           VS  IR+ L NRA  F++ L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA+Q
Sbjct: 180 VSRLIRENLVNRAGRFNLILDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAKQ 239

Query: 206 IRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEASKDIAQTLANSSN 256
            ++  V++                        ++RL+ +++IA  LA S N
Sbjct: 240 EKQGMVVK-AQGEAKSAELIGEAIKKSKDYVELKRLDTAREIADILAKSPN 289

>Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa]
           {ON} YGR231C (PHB2) - mitochondrial protein, prohibitin
           homolog; homolog of mammalian BAP37 and S. cerevisiae
           Phb1p [contig 260] FULL
          Length = 307

 Score =  249 bits (636), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 168/231 (72%), Gaps = 1/231 (0%)

Query: 26  SMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDM 85
           S+++V GG RA+++ RL+GVQ  +  EGTHF +PWL+  ++YDVR KP+++A+ TGTKD+
Sbjct: 57  SLFNVDGGHRAIVYSRLNGVQSRIFAEGTHFAIPWLETPIVYDVRAKPRNVASLTGTKDL 116

Query: 86  QMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVARYDAAELITQREL 145
           QMV++T RVL RP V QLP +++ LG DYDERVLPSI NEVLK++VA+++A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVTQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 146 VSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDAERAKFLVEKAEQ 205
           VS  IR+ L  RAS+F++ L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNVLLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 206 IRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEASKDIAQTLANSSN 256
            ++  V++                        ++RL+ +++IA  L++S N
Sbjct: 237 EKQGMVVK-AQGEAKSAELIGEAIKKSKDYVELKRLDTAREIATILSSSPN 286

>NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98
           YGR231C
          Length = 313

 Score =  248 bits (633), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 120/231 (51%), Positives = 166/231 (71%), Gaps = 1/231 (0%)

Query: 26  SMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDM 85
           S+++V GG RA+++ R+SGV  ++  EGTHF++PW++  +IYDVR KP+++A+ TGTKD+
Sbjct: 59  SLFNVDGGHRAIVYSRISGVSPKIYPEGTHFIIPWIETPIIYDVRAKPRNVASLTGTKDL 118

Query: 86  QMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVARYDAAELITQREL 145
           QMV++T RVL RP V  LP+IY+ LG DYDERVLPSI NEVLK++VA+++A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVENLPNIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 178

Query: 146 VSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDAERAKFLVEKAEQ 205
           VS  IR+ L  R+S F+I L+DVSIT MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 179 VSKLIRENLMGRSSRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 206 IRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEASKDIAQTLANSSN 256
            ++  V+R                        ++RL+ +++IA  LA S N
Sbjct: 239 EKQGMVVR-AQGEAKSAELIGEAIKKSKDYVELKRLDTAREIATILAKSPN 288

>KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231C PHB2 Possible role in aging mitochondrial
           protein prohibitin homolog homolog of mammalian BAP37
           and S. cerevisiae Phb1p
          Length = 307

 Score =  247 bits (631), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 119/231 (51%), Positives = 166/231 (71%), Gaps = 1/231 (0%)

Query: 26  SMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDM 85
           S+++V GG RA+I+ RL+GVQ  +  EGTHF +PW +  ++YDVR KP+++A+ TGTKD+
Sbjct: 57  SLFNVDGGHRAIIYSRLNGVQSRIFAEGTHFAIPWFETPIVYDVRAKPRNVASLTGTKDL 116

Query: 86  QMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVARYDAAELITQREL 145
           QMV++T RVL RP V QLP +++ LG DYDERVLPSI NEVLK++VA+++A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPNVSQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 146 VSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDAERAKFLVEKAEQ 205
           VS  IR+ L  RAS+F+I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTYAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 206 IRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEASKDIAQTLANSSN 256
            ++  V++                        ++RL+ +++IA  L+ S N
Sbjct: 237 EKQGMVVK-AQGEAKSAELIGEAIKKSKDYVELKRLDTAREIATILSQSPN 286

>NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON}
           Anc_5.98
          Length = 316

 Score =  247 bits (631), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 165/231 (71%), Gaps = 1/231 (0%)

Query: 26  SMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDM 85
           ++++V GG RA+++ R+SGV   +  EGTHF +PW++  +IYDVR KP+++A+ TGTKD+
Sbjct: 62  ALFNVDGGHRAIVYSRISGVSPRIYPEGTHFAIPWIETPIIYDVRAKPRNVASLTGTKDL 121

Query: 86  QMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVARYDAAELITQREL 145
           QMV++T RVL RP V QLP IY+ LG DYDERVLPSI NEVLKA+VA+++A++LITQRE 
Sbjct: 122 QMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 181

Query: 146 VSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDAERAKFLVEKAEQ 205
           VS  IR+ L  RA+ F+I L+DVSIT MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 182 VSKLIRENLMGRANRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 241

Query: 206 IRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEASKDIAQTLANSSN 256
            ++  V+R                        ++RL+ +++IA+ LA S N
Sbjct: 242 EKQGMVVR-AQGEAKSAELIGDAIKKSKDYVELKRLDTAREIARILAKSPN 291

>TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98
           YGR231C
          Length = 309

 Score =  247 bits (630), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 164/231 (70%), Gaps = 1/231 (0%)

Query: 26  SMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDM 85
           ++++V GG RA+++ R+ GV   +  EGTH ++PWL+  V+YDVR KP+++A+ TGTKD+
Sbjct: 59  ALFNVDGGHRAIVYSRIGGVSSRIYNEGTHVIIPWLETPVVYDVRAKPRNVASLTGTKDL 118

Query: 86  QMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVARYDAAELITQREL 145
           QMV++T RVL RP V QLP IY+ LG DY ERVLPSI NEVLKA+VA+++A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVEQLPTIYRTLGQDYGERVLPSIVNEVLKAVVAQFNASQLITQREK 178

Query: 146 VSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDAERAKFLVEKAEQ 205
           VS  IR+ L  RAS FSI L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 179 VSRLIRENLVRRASNFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 206 IRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEASKDIAQTLANSSN 256
            ++  V++                        ++RL+ +++IAQ LA S N
Sbjct: 239 EKQGMVVK-AQGEAKSAELIGEAIKKSKDYVELKRLDTAREIAQILARSPN 288

>KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98
           YGR231C
          Length = 288

 Score =  244 bits (623), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 165/231 (71%), Gaps = 1/231 (0%)

Query: 26  SMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDM 85
           ++++V GG RA+++ R+ GV   +  EGTHF++PWL+  ++YDVR KP+++A+ TGTKD+
Sbjct: 35  ALFNVDGGHRAIVYSRIGGVLPRIYNEGTHFVLPWLETPIVYDVRAKPRNVASLTGTKDL 94

Query: 86  QMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVARYDAAELITQREL 145
           QMV++T RVL RP V QLP +Y+ LG DYD+RVLPSI NEVLK++VA+++A++LITQRE 
Sbjct: 95  QMVNITCRVLSRPDVTQLPTLYRTLGQDYDDRVLPSIVNEVLKSVVAQFNASQLITQREK 154

Query: 146 VSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDAERAKFLVEKAEQ 205
           VS  IR+ L  RAS F+I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 155 VSRLIRENLVRRASRFNIMLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFIVDKARQ 214

Query: 206 IRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEASKDIAQTLANSSN 256
            ++  V++                        ++RL+ +K+IA  LA S N
Sbjct: 215 EKQGMVVK-AVGEAKSAELIGEAIKKSKDYVELKRLDTAKEIATILAASPN 264

>ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 310

 Score =  243 bits (621), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 120/231 (51%), Positives = 165/231 (71%), Gaps = 1/231 (0%)

Query: 26  SMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDM 85
           ++++V GG RA+++ R+ GV   +  EGTH L+PW +  V+YDVR KP+++A+ TGTKD+
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSRIYPEGTHLLLPWFETPVVYDVRAKPRNVASLTGTKDL 119

Query: 86  QMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVARYDAAELITQREL 145
           QMV++T RVL RP V QLP IY+ LGLDYDERVLPSI NEVLKA+VA+++A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVGQLPVIYRTLGLDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 146 VSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDAERAKFLVEKAEQ 205
           VS  IR+ L  RAS F+I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 180 VSRLIRENLVRRASRFNILLDDVSITYMTFSPEFTAAVESKQIAQQDAQRAAFVVDRALQ 239

Query: 206 IRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEASKDIAQTLANSSN 256
            ++  V++                        ++RL+ +++IAQ L+ S N
Sbjct: 240 EKQGLVVK-AQGDAKSAELIGEAIRKSKDYVELKRLDTAREIAQILSRSPN 289

>KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 308

 Score =  242 bits (618), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 116/231 (50%), Positives = 164/231 (70%), Gaps = 1/231 (0%)

Query: 26  SMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDM 85
           ++++V GG RA+++ R++GVQ  +  EGTHF++PW++  V+YDVR KP+++++ TGTKD+
Sbjct: 58  ALFNVDGGHRAIVYSRINGVQPRIYPEGTHFIIPWVENPVVYDVRAKPRNVSSLTGTKDL 117

Query: 86  QMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVARYDAAELITQREL 145
           QMV++T RVL RP V  LP IY+ LG+DYDERVLPSI NEVLKA+VA+++A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPNVENLPMIYRTLGVDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 146 VSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDAERAKFLVEKAEQ 205
           VS  IR+ L  RA  F+I L+DVSIT+MTF PEFT +VE KQIAQQDA++A F+V+KA Q
Sbjct: 178 VSRLIRENLVRRAKHFNIMLDDVSITYMTFSPEFTNSVEAKQIAQQDAQKAAFVVDKATQ 237

Query: 206 IRKVSVIRXXXXXXXXXXXXXXXXXXXXXXXXIRRLEASKDIAQTLANSSN 256
             K  +I                         ++RL+ +++IA  L+ S N
Sbjct: 238 -EKQGMIVKAQGEAKSAELIGEAIKKSKDYVELKRLDTAREIASILSRSPN 287

>TDEL0H00520 Chr8 complement(79507..87273) [7767 bp, 2588 aa] {ON}
            Anc_7.518 YLR454W
          Length = 2588

 Score = 33.5 bits (75), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 35/73 (47%), Gaps = 9/73 (12%)

Query: 31   RGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDMQMVSL 90
            R G   V F  LSG  QE   + T +  PWL   + YD    P+ +A+N   K++  VSL
Sbjct: 2092 REGFHEVFFS-LSGYGQE---DETQW-PPWLSLDLCYD----PEPLASNAVVKELSAVSL 2142

Query: 91   TLRVLHRPQVLQL 103
               V  RP +  +
Sbjct: 2143 YDNVSQRPTLYNM 2155

>TPHA0D02130 Chr4 complement(435589..438723,438831..438836) [3141
           bp, 1046 aa] {ON} Anc_5.363 YHR077C
          Length = 1046

 Score = 31.2 bits (69), Expect = 3.3,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 41/76 (53%), Gaps = 5/76 (6%)

Query: 108 QNLGLDYDERVLPSIGNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLED 167
           + L L   +  LPS+  ++ + ++++Y +  +IT  E +SN     L+N+  +    +E 
Sbjct: 42  KKLKLGITKENLPSLVKDLSEVLLSKYLSEIIITSNEALSN-----LNNKNDDIIAAVEV 96

Query: 168 VSITHMTFGPEFTKAV 183
           +SI H  F  +F++ +
Sbjct: 97  ISILHQRFKSQFSEKL 112

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.132    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,125,453
Number of extensions: 712675
Number of successful extensions: 2097
Number of sequences better than 10.0: 45
Number of HSP's gapped: 2117
Number of HSP's successfully gapped: 45
Length of query: 283
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 175
Effective length of database: 41,097,471
Effective search space: 7192057425
Effective search space used: 7192057425
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)