Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D09878g3.495ON1531538211e-114
NDAI0G009103.495ON1631594623e-59
TDEL0D056303.495ON1501544501e-57
NCAS0E007803.495ON1711634312e-54
TPHA0D042603.495ON1581544102e-51
SAKL0F02706g3.495ON1611564061e-50
CAGL0I10450g3.495ON1621594052e-50
Kpol_480.133.495ON1571534008e-50
YGR133W (PEX4)3.495ON1831563983e-49
Suva_7.4213.495ON1651563912e-48
Skud_7.4443.495ON1621563861e-47
Smik_6.2293.495ON1651563861e-47
Kwal_55.212463.495ON1601523809e-47
KAFR0C019903.495ON1511543651e-44
KLTH0F14894g3.495ON1661503625e-44
TBLA0C045003.495ON1651523322e-39
AFR314W3.495ON1551533182e-37
KNAG0B007803.495ON1531492878e-33
Ecym_12343.495ON1611522852e-32
KLLA0E04027g3.495ON1581542531e-27
NDAI0E038707.54ON1641122271e-23
TDEL0H039707.54ON1561472182e-22
TPHA0J017506.109ON169992183e-22
TBLA0F024406.109ON1741122183e-22
Smik_15.5177.54ON1561052164e-22
Kpol_461.86.109ON1671042174e-22
ZYRO0C04950g6.109ON1681042165e-22
YGL058W (RAD6)6.109ON172992165e-22
TDEL0G036106.109ON1691042166e-22
Smik_7.2226.109ON1711042166e-22
AAR156C6.109ON1701042166e-22
Suva_7.2136.109ON1731042166e-22
SAKL0A07260g6.109ON1691042166e-22
Ecym_30776.109ON1701042166e-22
NCAS0D032206.109ON1711042167e-22
KLTH0H06732g6.109ON1601042157e-22
KNAG0F025706.109ON1511042131e-21
YOR339C (UBC11)7.54ON1561102131e-21
Skud_15.5047.54ON1561102122e-21
CAGL0I00352g6.109ON1671042132e-21
KAFR0A047006.109ON1531042112e-21
KLLA0C05632g6.109ON164992122e-21
Kwal_14.18286.109ON1521042112e-21
Suva_8.3897.54ON1561142113e-21
NDAI0I016506.109ON1761042114e-21
AGR121C8.230ON1541232086e-21
Kpol_1065.127.54ON1591032087e-21
ZYRO0D04466g7.54ON1591122087e-21
Skud_7.2226.109ON1701042088e-21
SAKL0B10582g7.54ON1611092071e-20
Ecym_55638.230ON1641402052e-20
CAGL0G08063g8.230ON1491232033e-20
NCAS0B040108.230ON1531332024e-20
KLTH0D01760g7.54ON1611142035e-20
Kwal_26.70097.54ON1611142019e-20
KNAG0H029808.230ON1521231991e-19
ZYRO0B11682g8.230ON1511231973e-19
TPHA0B034108.230ON1521331973e-19
KLLA0C17622g8.230ON1591231973e-19
SAKL0H17930g8.230ON1531231964e-19
CAGL0M03399g1.436ON2141091995e-19
Kpol_1075.1b8.230ON1521231946e-19
NDAI0J015408.230ON1541231947e-19
YDR092W (UBC13)8.230ON1531331948e-19
KLTH0G14366g8.230ON1491231938e-19
TDEL0A013408.230ON1571231922e-18
ZYRO0E06358g2.569ON1651521922e-18
KLLA0A11198g1.436ON2021111933e-18
TPHA0O009201.436ON2261201927e-18
Suva_2.2183.308ON1481381878e-18
Skud_4.3143.308ON1481381878e-18
YDR059C (UBC5)3.308ON1481381878e-18
TBLA0F037908.230ON1511331861e-17
KNAG0H018701.436ON2101111901e-17
Smik_4.2973.308ON1481381851e-17
Kwal_26.82242.569ON1651521852e-17
TDEL0B056701.436ON2031201872e-17
Suva_2.2538.230ON1431291832e-17
Smik_4.3358.230ON1431291833e-17
CAGL0M07568g2.569ON1651521843e-17
AEL045W1.436ON2111071873e-17
Kpol_1030.181.436ON2231091873e-17
TBLA0H031308.375ON2141321873e-17
Kwal_56.234828.230ON1491201833e-17
SAKL0A00396g8.375ON2151321873e-17
Skud_4.4418.375ON2151321864e-17
YDR177W (UBC1)8.375ON2151321865e-17
Suva_2.3438.375ON2151321855e-17
Smik_4.4258.375ON2151321855e-17
KLTH0H13816g1.436ON2331071865e-17
Suva_4.3263.308ON1481381816e-17
Skud_2.2073.308ON1481381816e-17
Smik_2.2193.308ON1481381816e-17
YBR082C (UBC4)3.308ON1481381816e-17
NDAI0D011401.436ON2451091866e-17
SAKL0D13552g2.569ON1651481826e-17
Suva_5.531.436ON2151091857e-17
KLTH0D07986g2.569ON1651441827e-17
ABR059W2.569ON1651521827e-17
NCAS0G031301.436ON2311091857e-17
Skud_4.3528.230ON1431291808e-17
Ecym_13481.436ON2111401848e-17
KNAG0M021502.569ON1701541818e-17
Smik_5.981.436ON2151091848e-17
Ecym_45782.569ON1651481818e-17
Kpol_1056.52.569ON1651481818e-17
YEL012W (UBC8)1.436ON2181091831e-16
TDEL0B065702.569ON1651481801e-16
KAFR0A021602.569ON1651541801e-16
KAFR0C002703.308ON1471061791e-16
NCAS0A108003.308ON1481381791e-16
CAGL0E00671g8.375ON2131331831e-16
NDAI0A011608.375ON2161331831e-16
KAFR0A024208.230ON1471201791e-16
NCAS0B031508.375ON2141331821e-16
NDAI0A054903.308ON1471061782e-16
CAGL0E04752g3.308ON1471061782e-16
KAFR0H029601.436ON1871201802e-16
Skud_5.871.436ON2101091812e-16
KNAG0J023403.308ON1611061782e-16
Kwal_34.161741.436ON2131041812e-16
ZYRO0E03806g1.436ON2091201812e-16
ADR169C8.375ON2111321803e-16
KLTH0E14300g3.308ON1471061763e-16
SAKL0B06512g3.308ON1471061763e-16
AER173C3.308ON1471061763e-16
Ecym_60388.375ON2111321803e-16
ZYRO0C03784g8.375ON2181331803e-16
TBLA0A012901.436ON2191091803e-16
Ecym_74313.308ON1471061763e-16
SAKL0D10560g1.436ON2071051785e-16
KLLA0C18656g8.375ON2281321796e-16
TDEL0F049908.375ON2171331787e-16
TBLA0I021303.308ON1481061738e-16
KLTH0A07546g8.375ON2151321779e-16
TDEL0F021003.308ON1471061739e-16
TBLA0H026102.569ON1651461749e-16
KAFR0B060608.375ON2131321761e-15
Kwal_27.124013.308ON2361061771e-15
TPHA0I024602.569ON1671481731e-15
ZYRO0G12870g3.308ON1471061721e-15
TPHA0A038503.308ON1481061712e-15
Kpol_1052.23.308ON1481061702e-15
Smik_4.1714.249ON1571061703e-15
KLLA0E12563g3.308ON1481061703e-15
YDL064W (UBC9)4.249ON1571061703e-15
Kwal_23.64858.375ON2151321733e-15
Suva_4.1864.249ON1571061694e-15
TPHA0L008508.375ON2161321725e-15
NDAI0B015202.569ON1651481696e-15
Kpol_1030.108.375ON2151321717e-15
KNAG0A048108.375ON2141321709e-15
NCAS0A127402.569ON1651481661e-14
Suva_13.1892.569ON1651541661e-14
Smik_13.1862.569ON1651541652e-14
Skud_13.1762.569ON1651541652e-14
YMR022W (UBC7)2.569ON1651541652e-14
Skud_4.1914.249ON1571061642e-14
KLLA0E07745g2.569ON1651481625e-14
CAGL0D00814g4.249ON1571061616e-14
Kpol_483.164.249ON122941571e-13
TPHA0B007704.249ON157941581e-13
Kwal_23.42274.249ON122941526e-13
KAFR0H012303.308ON110951517e-13
KNAG0D043904.249ON157941547e-13
KLTH0D14344g4.249ON157941521e-12
ZYRO0B12386g4.249ON157941521e-12
KAFR0G032404.249ON157941512e-12
KLLA0E05039g4.249ON157941502e-12
TDEL0E012204.249ON157941502e-12
TBLA0I029604.249ON157941503e-12
NCAS0A059404.49ON1931081497e-12
NDAI0D043804.249ON157941469e-12
TPHA0F003904.49ON1931091471e-11
SAKL0H03058g4.249ON157941451e-11
NCAS0A024904.249ON157941442e-11
KLLA0D09196g3.301ON2921001474e-11
NDAI0A055303.301ON2731001455e-11
NCAS0A107703.301ON2731001455e-11
TDEL0D032603.301ON2891001456e-11
KLTH0C04818g3.301ON2751001448e-11
Kwal_27.104443.301ON2781001448e-11
ZYRO0G12650g3.301ON2851001448e-11
CAGL0E04598g3.301ON2951001448e-11
Ecym_32704.249ON157941409e-11
KNAG0H010403.301ON2961001449e-11
Ecym_26693.301ON2681001431e-10
AGL203C3.301ON2701001431e-10
SAKL0D02530g3.301ON2721001431e-10
TPHA0M012803.301ON435941441e-10
AER056C4.249ON157941391e-10
TBLA0G032703.301ON3301001431e-10
KAFR0H012703.301ON2871001421e-10
Kpol_1065.453.301ON323941422e-10
KAFR0F030404.49ON1691151382e-10
CAGL0D06468g4.49ON187961383e-10
Skud_4.3063.301ON2971001403e-10
Smik_4.2903.301ON2971001403e-10
YDR054C (CDC34)3.301ON2951001403e-10
Suva_2.2113.301ON2971001403e-10
NCAS0I014303.301ON258941385e-10
ZYRO0G19910g4.49ON179921348e-10
TDEL0E055604.49ON1871081349e-10
Kpol_414.2singletonOFF1921001331e-09
Kpol_YGOB_414.24.49ON1931001331e-09
KNAG0I029404.49ON197861313e-09
TBLA0E015704.49ON194941295e-09
KLLA0C17248g4.49ON184861286e-09
NDAI0A075703.301ON239941298e-09
Smik_12.3894.49ON187861261e-08
YLR306W (UBC12)4.49ON1881001252e-08
ADL035C4.49ON200861242e-08
KLTH0H09504g4.49ON184951233e-08
NDAI0D029104.49ON189991216e-08
Ecym_46837.392ON2431151227e-08
Skud_12.3894.49ON187901181e-07
KNAG0J022803.301ON2171131182e-07
KLLA0E20395g7.392ON2511281173e-07
CAGL0I05478g7.392ON2461291157e-07
SAKL0H24112g4.49ON185741138e-07
KAFR0L017507.392ON2511361131e-06
Skud_5.2257.392ON2501261131e-06
ZYRO0B03344g7.392ON2501151131e-06
Smik_5.2467.392ON2501291131e-06
KNAG0B023607.392ON2511311122e-06
Suva_10.4014.49ON187951102e-06
NDAI0A016507.392ON2511161112e-06
AGR372W7.392ON2421271112e-06
NDAI0E041707.392ON2571361103e-06
NCAS0A143907.392ON2401291103e-06
KLTH0C06688g7.392ON2461201103e-06
Ecym_83714.49ON267861103e-06
YER100W (UBC6)7.392ON2501071094e-06
TBLA0D006007.392ON2561131087e-06
SAKL0F12474g7.392ON2511561078e-06
Suva_5.2197.392ON2491071042e-05
TDEL0C015507.392ON2481231032e-05
NCAS0E026007.392ON2551451006e-05
Kwal_27.108377.392ON2461151006e-05
TPHA0K008207.392ON2571111006e-05
Kpol_1045.397.392ON253123981e-04
Suva_7.1826.187ON137128870.002
YGL087C (MMS2)6.187ON137128850.004
Smik_7.1966.187ON10090800.011
Suva_3.111.412ON379133790.041
Skud_7.1956.187ON10090750.056
Ecym_22306.187ON138113730.14
KNAG0F021306.187ON138129720.19
ZYRO0G08228g6.187ON13891720.24
KAFR0C021406.187ON13896700.42
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D09878g
         (153 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {O...   320   e-114
NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON...   182   3e-59
TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3....   177   1e-57
NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON...   170   2e-54
TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.49...   162   2e-51
SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {O...   160   1e-50
CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa] ...   160   2e-50
Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON} ...   158   8e-50
YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}  PEX4Peroxis...   157   3e-49
Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W (...   155   2e-48
Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W (...   153   1e-47
Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W (...   153   1e-47
Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W...   150   9e-47
KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.49...   145   1e-44
KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} simil...   144   5e-44
TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3....   132   2e-39
AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic h...   127   2e-37
KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON...   115   8e-33
Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON} ...   114   2e-32
KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {O...   102   1e-27
NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON...    92   1e-23
TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON...    89   2e-22
TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {O...    89   3e-22
TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON...    89   3e-22
Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {O...    88   4e-22
Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..148...    88   4e-22
ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 a...    88   5e-22
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    88   5e-22
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    88   6e-22
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    88   6e-22
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    88   6e-22
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    88   6e-22
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    88   6e-22
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    88   6e-22
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      88   7e-22
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    87   7e-22
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    87   1e-21
YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}  ...    87   1e-21
Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {O...    86   2e-21
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    87   2e-21
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    86   2e-21
KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {O...    86   2e-21
Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W ...    86   2e-21
Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}...    86   3e-21
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      86   4e-21
AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, ...    85   6e-21
Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON} (25814.....    85   7e-21
ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {O...    85   7e-21
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    85   8e-21
SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {O...    84   1e-20
Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 ...    84   2e-20
CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly ...    83   3e-20
NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 ...    82   4e-20
KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly ...    83   5e-20
Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C ...    82   9e-20
KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa...    81   1e-19
ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly ...    80   3e-19
TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON...    80   3e-19
KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 1...    80   3e-19
SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741) ...    80   4e-19
CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {...    81   5e-19
Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..195...    79   6e-19
NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465...    79   7e-19
YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {O...    79   8e-19
KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 1...    79   8e-19
TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 ...    79   2e-18
ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly ...    79   2e-18
KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609...    79   3e-18
TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.4...    79   7e-18
Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 b...    77   8e-18
Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 b...    77   8e-18
YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, ...    77   8e-18
TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49...    76   1e-17
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    78   1e-17
Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 b...    76   1e-17
Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W ...    76   2e-17
TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1....    77   2e-17
Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W (...    75   2e-17
Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W (...    75   3e-17
CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {...    75   3e-17
AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {O...    77   3e-17
Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa] ...    77   3e-17
TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.37...    77   3e-17
Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {O...    75   3e-17
SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}...    77   3e-17
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    76   4e-17
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    76   5e-17
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    76   5e-17
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    76   5e-17
KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012) ...    76   5e-17
Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 b...    74   6e-17
Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 b...    74   6e-17
Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 b...    74   6e-17
YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, ...    74   6e-17
NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa...    76   6e-17
SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highl...    75   6e-17
Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 21...    76   7e-17
KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly ...    75   7e-17
ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic hom...    75   7e-17
NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON}                76   7e-17
Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W (...    74   8e-17
Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp...    75   8e-17
KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.5...    74   8e-17
Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa] ...    75   8e-17
Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON...    74   8e-17
Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON} c...    74   8e-17
YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {O...    75   1e-16
TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2....    74   1e-16
KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.56...    74   1e-16
KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {O...    74   1e-16
NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [...    74   1e-16
CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}...    75   1e-16
NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON}      75   1e-16
KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON...    74   1e-16
NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON}      75   1e-16
NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 14...    73   2e-16
CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {O...    73   2e-16
KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON...    74   2e-16
Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W (R...    74   2e-16
KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {O...    73   2e-16
Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W...    74   2e-16
ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 a...    74   2e-16
ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON} ...    74   3e-16
KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936) ...    72   3e-16
SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444...    72   3e-16
AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON} Sy...    72   3e-16
Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to A...    74   3e-16
ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly ...    74   3e-16
TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 ...    74   3e-16
Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON} ...    72   3e-16
SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {O...    73   5e-16
KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highl...    74   6e-16
TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.37...    73   7e-16
TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 ...    71   8e-16
KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly ...    73   9e-16
TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa...    71   9e-16
TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON...    72   9e-16
KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8....    72   1e-15
Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa] ...    73   1e-15
TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.56...    71   1e-15
ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431) ...    71   1e-15
TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa...    70   2e-15
Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON} ...    70   2e-15
Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]...    70   3e-15
KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 1...    70   3e-15
YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {O...    70   3e-15
Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177...    71   3e-15
Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]...    70   4e-15
TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.3...    71   5e-15
NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON...    70   6e-15
Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON...    70   7e-15
KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON...    70   9e-15
NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2....    69   1e-14
Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W...    69   1e-14
Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W...    68   2e-14
Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W...    68   2e-14
YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiqui...    68   2e-14
Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]...    68   2e-14
KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {O...    67   5e-14
CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly si...    67   6e-14
Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON} ...    65   1e-13
TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.24...    65   1e-13
Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W ...    63   6e-13
KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.30...    63   7e-13
KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON...    64   7e-13
KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413) ...    63   1e-12
ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa] ...    63   1e-12
KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON...    63   2e-12
KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly ...    62   2e-12
TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.24...    62   2e-12
TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 ...    62   3e-12
NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49     62   7e-12
NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 15...    61   9e-12
TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, ...    61   1e-11
SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 a...    60   1e-11
NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 ...    60   2e-11
KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar...    61   4e-11
NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3....    60   5e-11
NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {...    60   5e-11
TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.30...    60   6e-11
KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly ...    60   8e-11
Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C...    60   8e-11
ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa] ...    60   8e-11
CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {O...    60   8e-11
Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa] ...    59   9e-11
KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON}                60   9e-11
Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar ...    60   1e-10
AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON} Sy...    60   1e-10
SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly ...    60   1e-10
TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {...    60   1e-10
AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, ...    58   1e-10
TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON...    60   1e-10
KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON}                59   1e-10
Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON} (12142...    59   2e-10
KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON...    58   2e-10
CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar...    58   3e-10
Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}...    59   3e-10
Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}...    59   3e-10
YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}  C...    59   3e-10
Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}...    59   3e-10
NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON}                58   5e-10
ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} simil...    56   8e-10
TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [...    56   9e-10
Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF} co...    56   1e-09
Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, ...    56   1e-09
KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa...    55   3e-09
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    54   5e-09
KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa] ...    54   6e-09
NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {...    54   8e-09
Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W...    53   1e-08
YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {...    53   2e-08
ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, ...    52   2e-08
KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555...    52   3e-08
NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49       51   6e-08
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    52   7e-08
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    50   1e-07
KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {O...    50   2e-07
KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} simil...    50   3e-07
CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {O...    49   7e-07
SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 1...    48   8e-07
KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.3...    48   1e-06
Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W (...    48   1e-06
ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar...    48   1e-06
Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W (...    48   1e-06
KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON...    48   2e-06
Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W...    47   2e-06
NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON...    47   2e-06
AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic h...    47   2e-06
NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON...    47   3e-06
NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7....    47   3e-06
KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {O...    47   3e-06
Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to...    47   3e-06
YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}  UBC6Ubiquit...    47   4e-06
TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON...    46   7e-06
SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar...    46   8e-06
Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W (...    45   2e-05
TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON...    44   2e-05
NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON...    43   6e-05
Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {O...    43   6e-05
TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {O...    43   6e-05
Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON...    42   1e-04
Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 b...    38   0.002
YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, ...    37   0.004
Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}...    35   0.011
Suva_3.11 Chr3 complement(15902..17041) [1140 bp, 379 aa] {ON} Y...    35   0.041
Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}...    33   0.056
Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa] ...    33   0.14 
KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.18...    32   0.19 
ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417...    32   0.24 
KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 ...    32   0.42 
NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 ...    31   0.56 
TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa...    30   0.95 
Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {O...    30   1.1  
CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420...    30   1.1  
SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 a...    30   1.5  
Smik_3.74 Chr3 complement(104188..105348) [1161 bp, 386 aa] {ON}...    30   1.6  
KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236) ...    30   1.6  
KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 a...    29   2.8  
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    30   2.9  
AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {O...    29   3.7  
Skud_12.483 Chr12 complement(855363..859226) [3864 bp, 1287 aa] ...    29   5.4  
TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414...    28   6.5  
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    29   7.0  
NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa...    28   7.1  
Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON} (17656...    27   7.4  
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    28   8.0  
KLTH0B02442g Chr2 (193387..196533) [3147 bp, 1048 aa] {ON} simil...    28   9.4  
Ecym_4263 Chr4 (557123..557911) [789 bp, 262 aa] {ON} similar to...    28   9.4  

>ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 153

 Score =  320 bits (821), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 153/153 (100%), Positives = 153/153 (100%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS
Sbjct: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE
Sbjct: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120

Query: 121 PVSSSPLNVDIANILKANDMNAYYGLVHYYIKS 153
           PVSSSPLNVDIANILKANDMNAYYGLVHYYIKS
Sbjct: 121 PVSSSPLNVDIANILKANDMNAYYGLVHYYIKS 153

>NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON}
           Anc_3.495
          Length = 163

 Score =  182 bits (462), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 82/159 (51%), Positives = 117/159 (73%), Gaps = 7/159 (4%)

Query: 1   MSRAAKEYKTITKVLKEG----DEVYSQLIVGM---EPKEDLTRWEALIRGPSGTPYEGC 53
           MSR  KEYKTI K L       D+ ++ +IV +   +P +DLT+WEA+I+GP GTPY G 
Sbjct: 1   MSRIIKEYKTIQKQLNNNRNNQDDEFNNIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60

Query: 54  NFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQA 113
           NF L++++PQEYP  PP+ +F+P +MPH NV++ TGEICLDIL + HW+P W+L+  ++A
Sbjct: 61  NFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKA 120

Query: 114 IGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYIK 152
           I  LL +PV  SPLNVD+AN+L+  D++AY GL++YY+ 
Sbjct: 121 IWLLLKDPVPESPLNVDLANLLRFGDLSAYNGLINYYLN 159

>TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3.495
           YGR133W
          Length = 150

 Score =  177 bits (450), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 112/154 (72%), Gaps = 5/154 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKE-DLTRWEALIRGPSGTPYEGCNFRLHL 59
           M+R A+EYK I   L  G E  S L+V +EP + DL+RW   IRGP+GTPYEG  F L L
Sbjct: 1   MARIAREYKHIQATL--GSE--SSLVVSLEPIDGDLSRWAGEIRGPTGTPYEGHTFSLRL 56

Query: 60  SLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLD 119
            L   YP +PP V F   +MPH NV++ TG ICL+ILT +HWSPAWDLLHV++AI QLL 
Sbjct: 57  VLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLS 116

Query: 120 EPVSSSPLNVDIANILKANDMNAYYGLVHYYIKS 153
           +P   SPL++D+ANIL+A D +AYYGLV+YY++S
Sbjct: 117 DPEPDSPLDIDLANILRAQDRSAYYGLVNYYLQS 150

>NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON}
           Anc_3.495
          Length = 171

 Score =  170 bits (431), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 81/163 (49%), Positives = 108/163 (66%), Gaps = 10/163 (6%)

Query: 1   MSRAAKEYKTITKVL--------KEGDEVYSQLIVGMEP--KEDLTRWEALIRGPSGTPY 50
           MSR  KEYK I   L           D+ ++Q+I  + P    DLT W+A I+GP GTPY
Sbjct: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60

Query: 51  EGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHV 110
               F+L +  P  YP+ PP + F+P +MPH NV+F+TG ICLDIL KQHW+PAW+L+  
Sbjct: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120

Query: 111 VQAIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYIKS 153
           ++AI  LL +PV  SPLNVDIANIL+ ND +AY GL++YY+ +
Sbjct: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSA 163

>TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.495
           YGR133W
          Length = 158

 Score =  162 bits (410), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 109/154 (70%), Gaps = 6/154 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPK--EDLTRWEALIRGPSGTPYEGCNFRLH 58
           + R  KE + I K L      YS+ I  +EP   E+  +W A+++GP  TPY   +F+L 
Sbjct: 3   LKRLLKEKRLIEKELSG----YSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLL 58

Query: 59  LSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLL 118
           + LP EYP+ PP + FEPY+MPH NV+F TG+ICL+IL  +HWSP W+L++V+ A+ QLL
Sbjct: 59  IELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLL 118

Query: 119 DEPVSSSPLNVDIANILKANDMNAYYGLVHYYIK 152
            EPV  SPLN+D+ANIL+A D +AY+GL++YY++
Sbjct: 119 QEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQ 152

>SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 161

 Score =  160 bits (406), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 84/156 (53%), Positives = 107/156 (68%), Gaps = 7/156 (4%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKE--DLTRWEALIRGPSGTPYEGCNFRLH 58
           + R  KE+K++ K L E D  Y+  I+ +EPK+  ++  W A I GP  TPY    F L 
Sbjct: 3   LQRITKEFKSVRKTLAE-DPSYNH-ILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60

Query: 59  LSLPQEYPMSPPYVKFEPYA---MPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIG 115
           + LP +YP+ PP VKF P +   + H NVDF+TGEICLDILT++HWSP WDL+HV+ AI 
Sbjct: 61  VELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIW 120

Query: 116 QLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
            LL EPV  SPLNVDIAN+LKA D+ AY GL+ YYI
Sbjct: 121 ILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156

>CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa]
           {ON} similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133w ubiquitin-conjugating enzyme - peroxin
          Length = 162

 Score =  160 bits (405), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 107/159 (67%), Gaps = 11/159 (6%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKED--LTRWEALIRGPSGTPYEGCNFRLH 58
           M+R +KE   I K L+ GD   S+ +V + P +D  L+RW A+I+GP+ TPY    F+L 
Sbjct: 1   MARISKELLKIRKALEHGD---SEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLA 57

Query: 59  LSLPQEYPMSPPYVKFEPYAM------PHANVDFRTGEICLDILTKQHWSPAWDLLHVVQ 112
           + +P  YPM PP +KF   A       PH NVD RTGEICLDIL  + WSP WD+LHVVQ
Sbjct: 58  IEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQ 117

Query: 113 AIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
           AI  LL EPV  SPL+VD+ANILK NDM+AY G++ Y++
Sbjct: 118 AIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFL 156

>Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON}
           complement(27113..27586) [474 nt, 158 aa]
          Length = 157

 Score =  158 bits (400), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 76/153 (49%), Positives = 101/153 (66%), Gaps = 6/153 (3%)

Query: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEP--KEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           R  KEY+ + K L      +  +I  +EP   +DLT W A I GP  TPY G +F L + 
Sbjct: 5   RLLKEYQVVKKELGN----HKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           L  EYP+ PP V F  Y MPH N++F+TG+ICL+IL   +WSP W+LL VV AI QLL +
Sbjct: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSD 120

Query: 121 PVSSSPLNVDIANILKANDMNAYYGLVHYYIKS 153
           PV+ SPLN+D++NILK  D +AYYGL+ YY+ +
Sbjct: 121 PVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNN 153

>YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}
           PEX4Peroxisomal ubiquitin conjugating enzyme required
           for peroxisomal matrix protein import and peroxisome
           biogenesis
          Length = 183

 Score =  157 bits (398), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 76/156 (48%), Positives = 101/156 (64%), Gaps = 5/156 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEV---YSQLIVGMEP--KEDLTRWEALIRGPSGTPYEGCNF 55
           MSR  KEYK I K L   D +   Y  +I  + P  + DL++WEA+I GPS TPYE   F
Sbjct: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78

Query: 56  RLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIG 115
           R+ + +P  YPM+PP + F    + H NV   TGEICL+IL  + W+P WDLLH V A+ 
Sbjct: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVW 138

Query: 116 QLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
           +LL EPV  SPL+VDI NI++  DM+AY G+V Y++
Sbjct: 139 RLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL 174

>Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  155 bits (391), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 99/156 (63%), Gaps = 5/156 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEV---YSQLIVGMEPKE--DLTRWEALIRGPSGTPYEGCNF 55
           MSR  KEY+ I K L   D     Y  +I  + P +  DL++WEA I GP  TPYE   F
Sbjct: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60

Query: 56  RLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIG 115
           R+ + +P  YPM+PP + FE  A+ H N++  TGEICLDIL  Q W+P WDLLH V A+ 
Sbjct: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120

Query: 116 QLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
           +LL EPV  SPL+VD+ NI++  D  AY G+V Y++
Sbjct: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFL 156

>Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W
           (REAL)
          Length = 162

 Score =  153 bits (386), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 101/156 (64%), Gaps = 5/156 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEV---YSQLIVGMEP--KEDLTRWEALIRGPSGTPYEGCNF 55
           MSR AKEY  I K L   D +   Y  LI  + P  + DL++WEA+I GP+ TPYE   F
Sbjct: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60

Query: 56  RLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIG 115
           R+ + +P  YPM+PP ++F+   + H N+   TGEICLDIL  + W+P WDLLH V AI 
Sbjct: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120

Query: 116 QLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
           +LL EPV  SPL+VD+ NI++  D  AY G++ Y++
Sbjct: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156

>Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  153 bits (386), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 99/156 (63%), Gaps = 5/156 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEV---YSQLIVGMEP--KEDLTRWEALIRGPSGTPYEGCNF 55
           MSR  KEY+ I K L   D +   Y  +I  + P  + DL+RWEA I GPS TPYE   F
Sbjct: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60

Query: 56  RLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIG 115
            + + +P  YPM+PP + FE   + H NV   TGEICLDIL  + W+P WDLLH V A+ 
Sbjct: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120

Query: 116 QLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
           +LL EPV  SPL+VD+ NI++  D +AY G+V Y++
Sbjct: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFL 156

>Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W
           (PEX4) - Member of ubiquitin-conjugating protein family
           [contig 130] FULL
          Length = 160

 Score =  150 bits (380), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 100/152 (65%), Gaps = 4/152 (2%)

Query: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKED--LTRWEALIRGPSGTPYEGCNFRLHLS 60
           R AKEYKT+ K LKE D  YS  I  + P  D  L  WEA I GPS TPY+G  F L ++
Sbjct: 4   RLAKEYKTLLKTLKE-DPAYSH-IRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLIT 61

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P  YP+ PP V+F    +PH NVDF +G IC+++L + HWSPAWDLLH+V AI  LL  
Sbjct: 62  IPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDLLHLVHAIWLLLAN 121

Query: 121 PVSSSPLNVDIANILKANDMNAYYGLVHYYIK 152
           P   SPL+VD+A + +A D +A+ GLV YY+ 
Sbjct: 122 PEPDSPLDVDLACLRRAGDYSAHNGLVAYYLN 153

>KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.495
           YGR133W
          Length = 151

 Score =  145 bits (365), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 69/154 (44%), Positives = 104/154 (67%), Gaps = 10/154 (6%)

Query: 2   SRAAKEYKTITKVLKEGDEVYSQLIVGMEP--KEDLTRWEALIRGPSGTPYEGCNFRLHL 59
           SR  KEYK       +   + SQ I+ ++P   +DLT WE  I+GP  +P+    F+L +
Sbjct: 3   SRILKEYK-------DSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRI 55

Query: 60  SLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLD 119
            +PQ YP++ P  KFEP+AMPH NV+F TGEICLDIL   +WSP +++ ++V+AI  LL+
Sbjct: 56  DIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDIL-DTNWSPVFNIQYIVEAIVWLLN 114

Query: 120 EPVSSSPLNVDIANILKANDMNAYYGLVHYYIKS 153
           EP   SPLN+D+AN+L+ +D+ AY+ L+ Y++ +
Sbjct: 115 EPNFKSPLNLDLANLLRFDDLKAYHDLISYHLNN 148

>KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} similar
           to uniprot|P29340 Saccharomyces cerevisiae YGR133W PEX4
           Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 166

 Score =  144 bits (362), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 94/150 (62%)

Query: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLP 62
           R AKEY+ ++K L    E    + +    +E+L +WE+LI GP  TPY G  F L +   
Sbjct: 4   RLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEAS 63

Query: 63  QEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPV 122
           + YP+ PP V+F+   MPH NVDF +G ICL +L   HW+PAWDLLHVV AI  LL  P 
Sbjct: 64  EAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPE 123

Query: 123 SSSPLNVDIANILKANDMNAYYGLVHYYIK 152
             SPL+VD+A +++A D +A+  L+ YY+ 
Sbjct: 124 PDSPLDVDLACLVRAGDRSAHNSLIAYYLN 153

>TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3.495
           YGR133W
          Length = 165

 Score =  132 bits (332), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 68/152 (44%), Positives = 93/152 (61%), Gaps = 2/152 (1%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSR  KEY  I K+    D + +   V      DL+ W ++I GP  +PY   +F L + 
Sbjct: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVS-NATSDLSNWHSIILGPKDSPYHNKSFLLEIH 59

Query: 61  LPQEYPMSPPYVKFEPYAMP-HANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLD 119
           +P EYP  PP +KF   ++P H NV+F TGEICL+IL  ++WSP W+LL+ VQAI QLL 
Sbjct: 60  IPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLA 119

Query: 120 EPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
            P  SSPLN+D++ +L   D  AY  L+ YY+
Sbjct: 120 YPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151

>AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR133W (PEX4)
          Length = 155

 Score =  127 bits (318), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 67/153 (43%), Positives = 92/153 (60%), Gaps = 2/153 (1%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           M R  +EYK + K L     V S   VG E   DL RWEA  +GP  TPY G  F L ++
Sbjct: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEE-NGDLHRWEAHFQGPENTPYAGFTFTLRIN 59

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P+ YP  PP   F P+ + H N+ + TGE+CLD+L  + WSP ++LL VV+AI  LL E
Sbjct: 60  VPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAE 119

Query: 121 PVSSSPLNVDIANILKANDMNAYYGLVHYYIKS 153
           P   SPL+VD++  L   D  AY G+V+Y +++
Sbjct: 120 PGVDSPLDVDLSR-LYTTDRAAYDGVVNYRLRT 151

>KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON}
           Anc_3.495 YGR133W
          Length = 153

 Score =  115 bits (287), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 87/149 (58%), Gaps = 5/149 (3%)

Query: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLP 62
           R  +EY+   +++  G       +   +P  DLT WEA + GP GTPYEG +F L +++P
Sbjct: 4   RVLREYR---RLVAAGGAANESNLHPTDPA-DLTHWEATLEGPQGTPYEGHSFPLRVTVP 59

Query: 63  QEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPV 122
            +YP  PP V F    MPH NV + TGE+CLD L    W+P  DL + V A+ +LL EP 
Sbjct: 60  DKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGG-WTPVMDLQYAVMAVRRLLAEPN 118

Query: 123 SSSPLNVDIANILKANDMNAYYGLVHYYI 151
             SPLN+++A + +  D  AY G++ Y +
Sbjct: 119 PESPLNLELAALSRLGDHKAYDGIIKYRL 147

>Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON}
           similar to Ashbya gossypii AFR314W
          Length = 161

 Score =  114 bits (285), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 62/152 (40%), Positives = 85/152 (55%), Gaps = 3/152 (1%)

Query: 2   SRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSL 61
           SR   EYK I + L+  + +      G      L++WEA   GP  TPY    F L + +
Sbjct: 10  SRMLAEYKQIREQLQSHESILMLCPAG--DGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67

Query: 62  PQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEP 121
           P+ YP  PP  +F P  + H N+ + TGE+CLD+L  + WSP ++LL VV+AI  LL EP
Sbjct: 68  PEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEP 127

Query: 122 VSSSPLNVDIANILKANDMNAYYGLVHYYIKS 153
              SPL+VD+A +    D  AY GLV Y + S
Sbjct: 128 GVDSPLDVDLAKLYSV-DKQAYQGLVTYRLCS 158

>KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 158

 Score =  102 bits (253), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/154 (40%), Positives = 91/154 (59%), Gaps = 5/154 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSR  KEY  + K L+  +  +   +  ++  +DL+ W    +GPS +P+EG    L+++
Sbjct: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVD-DDDLSEWVCRFQGPSESPFEGFELGLNIT 59

Query: 61  LPQE-YPMSP-PYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLL 118
           +  E YP+S  P V FEP  + H NV + TGEICLD+L K  W+P + LL VV AI  LL
Sbjct: 60  IDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLL-KDAWTPIYTLLDVVGAIRDLL 118

Query: 119 DEPVSSSPLNVDIANILKANDMNAYYGLVHYYIK 152
            +P   SPL++DIA I  A D  AY  +V Y ++
Sbjct: 119 ADPGLDSPLDLDIAQIYDA-DYEAYVQIVRYRLE 151

>NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON}
           Anc_7.54
          Length = 164

 Score = 92.0 bits (227), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 69/112 (61%), Gaps = 4/112 (3%)

Query: 32  KEDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEI 91
           +EDLT W A+I GP  TPY+G  F+L       YP +PP VKF    M H NVD  +G I
Sbjct: 43  EEDLTHWSAIITGPKDTPYDGLRFKLSFQFSDSYPYAPPLVKFI-SPMWHPNVDM-SGNI 100

Query: 92  CLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKANDMNAY 143
           CLDIL K  WS  +++  ++ ++  LL+EP +SSPLN  +A  L  +DMN Y
Sbjct: 101 CLDIL-KDQWSAVYNVETILLSLQALLEEPNNSSPLNA-VAAELWDDDMNEY 150

>TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON}
           Anc_7.54 YOR339C
          Length = 156

 Score = 88.6 bits (218), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 81/147 (55%), Gaps = 8/147 (5%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEP----KEDLTRWEALIRGPSGTPYEGCNFR 56
           M+ AA+ +  + ++  E  ++      G+      ++DLT+W  +I GP GTPYE   FR
Sbjct: 1   MTTAAEGHSVVKRLQNELVQLMMSPTPGLSAFPASEDDLTQWFGVIVGPEGTPYENLKFR 60

Query: 57  LHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQ 116
           L L    +YP  PP V F    M H NVD  +G ICLDIL K  WS  +++  ++ ++  
Sbjct: 61  LSLKFTDQYPYQPPKVTFVS-PMWHPNVDM-SGNICLDIL-KDQWSAVYNVQTILLSLQA 117

Query: 117 LLDEPVSSSPLNVDIANILKANDMNAY 143
           LL+EP + SPLN  IA  L   DM+ Y
Sbjct: 118 LLEEPNNGSPLNA-IAAELWDTDMDEY 143

>TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {ON}
           Anc_6.109 YGL058W
          Length = 169

 Score = 88.6 bits (218), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 62/99 (62%), Gaps = 3/99 (3%)

Query: 38  WEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILT 97
           W A+I GPS TPYE   FRL L   +EYP  PP+VKF    M H NV +  GEICLDIL 
Sbjct: 36  WNAMIIGPSDTPYEDGTFRLLLEFDEEYPNKPPHVKFI-SEMFHPNV-YANGEICLDIL- 92

Query: 98  KQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILK 136
           +  W+P +D+  ++ +I  L ++P  +SP NV+ A + K
Sbjct: 93  QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON}
           Anc_6.109 YGL058W
          Length = 174

 Score = 88.6 bits (218), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 68/112 (60%), Gaps = 5/112 (4%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  W A+I GPS TPYE   FRL L   +EYP  PP+VKF    M H NV +  GEIC
Sbjct: 31  DNVMLWNAMIIGPSDTPYEDGTFRLVLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEIC 88

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKANDMNAYY 144
           LDIL +  W+P +D+  ++ +I  L ++P  +SP NV+ A + K  D  A Y
Sbjct: 89  LDIL-QNRWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK--DHRAQY 137

>Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 87.8 bits (216), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 63/105 (60%), Gaps = 3/105 (2%)

Query: 34  DLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICL 93
           DLT W   I GP GTPY G  F++ L+ P+ YP  PP +KF    M H NVD ++G ICL
Sbjct: 37  DLTYWVGYITGPQGTPYSGLKFKISLNFPENYPFHPPKIKFVS-PMWHPNVD-KSGNICL 94

Query: 94  DILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           DIL K+ WS  +++  ++ ++  LL EP + SPLN   A +   N
Sbjct: 95  DIL-KEKWSAVYNVETILLSLQSLLGEPNNKSPLNAVAAELWDTN 138

>Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..14809)
           [504 nt, 168 aa]
          Length = 167

 Score = 88.2 bits (217), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 65/104 (62%), Gaps = 3/104 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  W A+I GP+ TPYE   FRL L   +EYP  PP+VKF    M H NV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFV-SEMFHPNV-YANGEIC 88

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILK 136
           LDIL +  W+P +D+  ++ +I  L ++P  +SP NV+ A + K
Sbjct: 89  LDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 aa]
           {ON} similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058W RAD6 Ubiquitin-conjugating enzyme (E2) involved
           in postreplication repair (with Rad18p) sporulation
           telomere silencing and ubiquitin-mediated N-end rule
           protein degradation (with Ubr1p)
          Length = 168

 Score = 87.8 bits (216), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 65/104 (62%), Gaps = 3/104 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  W A+I GP+ TPYE   FRL L   +EYP  PP+VKF    M H NV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEIC 88

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILK 136
           LDIL +  W+P +D+  ++ +I  L ++P  +SP NV+ A + K
Sbjct: 89  LDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 87.8 bits (216), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 62/99 (62%), Gaps = 3/99 (3%)

Query: 38  WEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILT 97
           W A+I GP+ TPYE   FRL L   +EYP  PP+VKF    M H NV +  GEICLDIL 
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEICLDIL- 92

Query: 98  KQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILK 136
           +  W+P +D+  ++ +I  L ++P  +SP NV+ A + K
Sbjct: 93  QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 87.8 bits (216), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 65/104 (62%), Gaps = 3/104 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  W A+I GP+ TPYE   FRL L   +EYP  PP+VKF    M H NV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEIC 88

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILK 136
           LDIL +  W+P +D+  ++ +I  L ++P  +SP NV+ A + K
Sbjct: 89  LDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 87.8 bits (216), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 65/104 (62%), Gaps = 3/104 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  W A+I GP+ TPYE   FRL L   +EYP  PP+VKF    M H NV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEIC 88

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILK 136
           LDIL +  W+P +D+  ++ +I  L ++P  +SP NV+ A + K
Sbjct: 89  LDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 87.8 bits (216), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 65/104 (62%), Gaps = 3/104 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  W A+I GP+ TPYE   FRL L   +EYP  PP+VKF    M H NV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEIC 88

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILK 136
           LDIL +  W+P +D+  ++ +I  L ++P  +SP NV+ A + K
Sbjct: 89  LDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 87.8 bits (216), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 65/104 (62%), Gaps = 3/104 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  W A+I GP+ TPYE   FRL L   +EYP  PP+VKF    M H NV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEIC 88

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILK 136
           LDIL +  W+P +D+  ++ +I  L ++P  +SP NV+ A + K
Sbjct: 89  LDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 87.8 bits (216), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 65/104 (62%), Gaps = 3/104 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  W A+I GP+ TPYE   FRL L   +EYP  PP+VKF    M H NV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEIC 88

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILK 136
           LDIL +  W+P +D+  ++ +I  L ++P  +SP NV+ A + K
Sbjct: 89  LDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 87.8 bits (216), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 65/104 (62%), Gaps = 3/104 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  W A+I GP+ TPYE   FRL L   +EYP  PP+VKF    M H NV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEIC 88

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILK 136
           LDIL +  W+P +D+  ++ +I  L ++P  +SP NV+ A + K
Sbjct: 89  LDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 87.8 bits (216), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 65/104 (62%), Gaps = 3/104 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  W A+I GP+ TPYE   FRL L   +EYP  PP+VKF    M H NV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEIC 88

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILK 136
           LDIL +  W+P +D+  ++ +I  L ++P  +SP NV+ A + K
Sbjct: 89  LDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 87.4 bits (215), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 65/104 (62%), Gaps = 3/104 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  W A+I GP+ TPYE   FRL L   +EYP  PP+VKF    M H NV +  GEIC
Sbjct: 27  DNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEIC 84

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILK 136
           LDIL +  W+P +D+  ++ +I  L ++P  +SP NV+ A + K
Sbjct: 85  LDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 127

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 86.7 bits (213), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 65/104 (62%), Gaps = 3/104 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  W A+I GP+ TPYE   FRL L   ++YP  PP+VKF    M H NV +  GEIC
Sbjct: 16  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFL-SEMFHPNV-YANGEIC 73

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILK 136
           LDIL +  W+P +D+  ++ +I  L ++P  +SP NV+ A + K
Sbjct: 74  LDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}
           UBC11Ubiquitin-conjugating enzyme most similar in
           sequence to Xenopus ubiquitin-conjugating enzyme E2-C,
           but not a true functional homolog of this E2; unlike
           E2-C, not required for the degradation of mitotic cyclin
           Clb2
          Length = 156

 Score = 86.7 bits (213), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/110 (44%), Positives = 64/110 (58%), Gaps = 4/110 (3%)

Query: 34  DLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICL 93
           DLT W   I GP  TPY G  F++ L  PQ YP  PP +KF    M H NVD ++G ICL
Sbjct: 37  DLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKFLS-PMWHPNVD-KSGNICL 94

Query: 94  DILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKANDMNAY 143
           DIL K+ WS  +++  ++ ++  LL EP + SPLN   A +  A DM  Y
Sbjct: 95  DIL-KEKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAELWDA-DMEEY 142

>Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 86.3 bits (212), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 49/110 (44%), Positives = 65/110 (59%), Gaps = 4/110 (3%)

Query: 34  DLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICL 93
           DLT W   I GP GTPY    F++ L+ P+ YP  PP VKF    M H NVD ++G ICL
Sbjct: 37  DLTYWTGYIMGPQGTPYSDLKFKISLNFPENYPFHPPKVKFVS-PMWHPNVD-KSGNICL 94

Query: 94  DILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKANDMNAY 143
           DIL K+ WS  +++  ++ ++  LL EP + SPLN  +A  L   DM  Y
Sbjct: 95  DIL-KEKWSAVYNVETILLSLQSLLGEPNNRSPLNA-VAAELWDKDMEGY 142

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 86.7 bits (213), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 65/104 (62%), Gaps = 3/104 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  W A+I GP+ TPYE   FRL L   ++YP  PP+VKF    M H NV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFL-SEMFHPNV-YANGEIC 88

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILK 136
           LDIL +  W+P +D+  ++ +I  L ++P  +SP NV+ A + K
Sbjct: 89  LDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 85.9 bits (211), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 65/104 (62%), Gaps = 3/104 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  W A+I GP+ TPYE   FRL L   ++YP  PP+VKF    M H NV +  GEIC
Sbjct: 16  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFL-SEMFHPNV-YANGEIC 73

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILK 136
           LDIL +  W+P +D+  ++ +I  L ++P  +SP NV+ A + K
Sbjct: 74  LDIL-QNRWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 116

>KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 164

 Score = 86.3 bits (212), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 62/99 (62%), Gaps = 3/99 (3%)

Query: 38  WEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILT 97
           W A+I GP+ TPYE   FRL L   +EYP  PP+VKF    M H NV +  GEICLDIL 
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEICLDIL- 92

Query: 98  KQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILK 136
           +  W+P +D+  ++ +I  L ++P  +SP NV+ A + +
Sbjct: 93  QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFQ 131

>Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W
           (RAD6) - Ubiquitin conjugating (E2) enzyme. The
           C-terminal 23 residues are critical for sporulation and
           histone polyubiquitinating activity, but not UV repair
           or induced mutagenesis. [contig 237] FULL
          Length = 152

 Score = 85.9 bits (211), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 64/104 (61%), Gaps = 3/104 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  W A+I GP+ TPYE   FRL L   +EYP  PP+VKF      H NV +  GEIC
Sbjct: 16  DNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSEIF-HPNV-YANGEIC 73

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILK 136
           LDIL +  W+P +D+  ++ +I  L ++P  +SP NV+ A + K
Sbjct: 74  LDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 85.9 bits (211), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 50/114 (43%), Positives = 65/114 (57%), Gaps = 4/114 (3%)

Query: 30  EPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTG 89
           E   DLT W   I GP GTPY    F++ L+ P+ YP  PP VKF    M H NVD  +G
Sbjct: 33  EDDNDLTYWTGYITGPQGTPYSDLKFKISLNFPESYPFHPPKVKFVS-PMWHPNVDM-SG 90

Query: 90  EICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKANDMNAY 143
            ICLDIL K+ WS  +++  ++ ++  LL EP + SPLN  +A  L   DM  Y
Sbjct: 91  NICLDIL-KEKWSAVYNVETILLSLQSLLGEPNNRSPLNA-VAAELWDKDMEEY 142

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 85.9 bits (211), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 66/104 (63%), Gaps = 3/104 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  W A+I GP+ TPYE   FRL L   +EYP++ P+VKF    M H NV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPINRPHVKFL-SEMFHPNV-YANGEIC 88

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILK 136
           LDIL +  W+P +D+  ++ +I  L ++P  +SP NV+ A + K
Sbjct: 89  LDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, 154
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR092W (UBC13); 1-intron
          Length = 154

 Score = 84.7 bits (208), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 73/123 (59%), Gaps = 6/123 (4%)

Query: 13  KVLKEGDEVYSQLIVGM--EPKEDLTRW-EALIRGPSGTPYEGCNFRLHLSLPQEYPMSP 69
           +++KE + + S  + G+  EP ED  R+ +  I GP  +PYE   FRL L LP EYPM P
Sbjct: 7   RIIKETERLVSDPVPGISAEPHEDNLRYFDVSIEGPQQSPYEHGVFRLELFLPDEYPMEP 66

Query: 70  PYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNV 129
           P V+F    + H N+D R G ICLD+L K +WSPA  +  V+ +I  LL  P  + PL  
Sbjct: 67  PKVRFL-TKIYHPNID-RLGRICLDVL-KTNWSPALQIRTVLLSIQALLATPNPNDPLAN 123

Query: 130 DIA 132
           D+A
Sbjct: 124 DVA 126

>Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON}
           (25814..26293) [480 nt, 160 aa]
          Length = 159

 Score = 84.7 bits (208), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 63/103 (61%), Gaps = 3/103 (2%)

Query: 32  KEDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEI 91
           +E+LT+W   I GP  +PY G  F++ L+ P  YP  PP VKF    M H NVD  +G I
Sbjct: 39  EENLTKWSGTITGPDDSPYAGLRFKISLTFPDRYPYEPPKVKFV-SPMWHPNVDL-SGNI 96

Query: 92  CLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANI 134
           CLD+L K+ WS  +++  ++ ++  LL EP +SSPLN   A +
Sbjct: 97  CLDVL-KEKWSAVYNVQTILLSLQALLGEPNNSSPLNAIAAEL 138

>ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 159

 Score = 84.7 bits (208), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 65/112 (58%), Gaps = 4/112 (3%)

Query: 32  KEDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEI 91
           ++DL  W  +I GP GTPYE   F++ L  P  YP  PP VKF    M H NVD  +G I
Sbjct: 39  EDDLRDWSGMIVGPEGTPYESLKFKISLHFPDSYPYVPPKVKFI-SPMWHPNVDM-SGNI 96

Query: 92  CLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKANDMNAY 143
           CLDIL K  WS  +++  ++ ++  L +EP +SSPLN  +A  L   DM  Y
Sbjct: 97  CLDIL-KDQWSAVYNVQTILLSLQSLFEEPNNSSPLNA-VAAELWDKDMVEY 146

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 84.7 bits (208), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 64/104 (61%), Gaps = 3/104 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  W A+I GP+ T YE   FRL L   +EYP  PP+VKF    M H NV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPADTSYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEIC 88

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILK 136
           LDIL +  W+P +D+  ++ +I  L ++P  +SP NV+ A + K
Sbjct: 89  LDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 161

 Score = 84.3 bits (207), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/109 (44%), Positives = 67/109 (61%), Gaps = 3/109 (2%)

Query: 30  EPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTG 89
           E ++DLT+W  +I GP GTPYEG  F++ L  PQ YP + P V F    M H NVD  +G
Sbjct: 39  ENEDDLTKWSGIITGPDGTPYEGLRFKISLQFPQSYPYTAPRVTFV-SPMWHPNVDM-SG 96

Query: 90  EICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
            ICLDIL K  WS  +++  ++ ++  LL+EP +SSPLN   A +   N
Sbjct: 97  NICLDIL-KDQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAELWDKN 144

>Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 aa]
           {ON} similar to Ashbya gossypii AGR121C
          Length = 164

 Score = 83.6 bits (205), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 78/140 (55%), Gaps = 6/140 (4%)

Query: 13  KVLKEGDEVYSQLIVGM--EPKEDLTRW-EALIRGPSGTPYEGCNFRLHLSLPQEYPMSP 69
           +++KE + + S  + G+  EP ED  R+ +  I GP  + YE   FRL L LP EYPM P
Sbjct: 7   RIIKETERLVSDPVPGISAEPHEDNLRYFDVSIEGPQQSAYENGVFRLELFLPDEYPMEP 66

Query: 70  PYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNV 129
           P V+F    + H N+D R G ICLD+L K +WSPA  +  V+ +I  LL  P  + PL  
Sbjct: 67  PKVRFL-TKIYHPNID-RLGRICLDVL-KTNWSPALQIRTVLLSIQALLATPNPNDPLAN 123

Query: 130 DIANILKANDMNAYYGLVHY 149
           D+A    A++  A     H+
Sbjct: 124 DVAEDWIADEDAAIAKAKHW 143

>CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092w UBC13 E2 ubiquitin-conjugating enzyme
          Length = 149

 Score = 82.8 bits (203), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 74/123 (60%), Gaps = 6/123 (4%)

Query: 13  KVLKEGDEVYSQLIVGM--EPKEDLTRW-EALIRGPSGTPYEGCNFRLHLSLPQEYPMSP 69
           +++KE + + S  + G+  EP ED  R+ +  I GPS +PYE   F+L L LP++YPM  
Sbjct: 7   RIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEA 66

Query: 70  PYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNV 129
           P V+F    + H N+D R G ICLD+L K +WSPA  +  V+ +I  LL  P  + PL  
Sbjct: 67  PKVRFL-TKIYHPNID-RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLAN 123

Query: 130 DIA 132
           D+A
Sbjct: 124 DVA 126

>NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 bp,
           153 aa] {ON} Anc_8.230
          Length = 153

 Score = 82.4 bits (202), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 76/133 (57%), Gaps = 6/133 (4%)

Query: 13  KVLKEGDEVYSQLIVGM--EPKEDLTRW-EALIRGPSGTPYEGCNFRLHLSLPQEYPMSP 69
           +++KE + + S  + G+  EP ED  R+    + GP+G+PYE   F+L L LP +YPM  
Sbjct: 7   RIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEA 66

Query: 70  PYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNV 129
           P V+F    + H N+D R G ICLD+L K +WSPA  +  V+ ++  LL  P  + PL  
Sbjct: 67  PKVRFL-TKIYHPNID-RLGRICLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLAN 123

Query: 130 DIANILKANDMNA 142
           D+A     N+  A
Sbjct: 124 DVAEEWIQNEAGA 136

>KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly
           similar to uniprot|P52492 Saccharomyces cerevisiae
           YOR339C
          Length = 161

 Score = 82.8 bits (203), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 52/114 (45%), Positives = 70/114 (61%), Gaps = 4/114 (3%)

Query: 30  EPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTG 89
           E +EDLT+W  +I GP GTPYEG  F++ L   Q YP + P V+F    M H NVD  +G
Sbjct: 39  EDEEDLTKWCGIITGPDGTPYEGMRFKIALEFAQTYPYTAPKVRFV-SPMWHPNVDM-SG 96

Query: 90  EICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKANDMNAY 143
            ICLDIL K  WS  +++  ++ ++  LL+EP +SSPLN  +A  L   DM  Y
Sbjct: 97  NICLDIL-KDQWSAVYNVQTILLSLQSLLEEPNNSSPLNA-VAAELWDKDMREY 148

>Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C
           (UBC11) - homolog of ubiquitin carrier protein E2-C
           [contig 46] FULL
          Length = 161

 Score = 82.0 bits (201), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 51/114 (44%), Positives = 70/114 (61%), Gaps = 4/114 (3%)

Query: 30  EPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTG 89
           E ++DLT+W  +I GP GTPYEG  F++ L   Q YP + P V+F    M H NVD  +G
Sbjct: 39  ESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQTYPYTAPKVRFVS-PMWHPNVDM-SG 96

Query: 90  EICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKANDMNAY 143
            ICLDIL K  WS  +++  ++ ++  LL+EP +SSPLN  +A  L   DM  Y
Sbjct: 97  NICLDIL-KDQWSAVYNVQTILLSLQSLLEEPNNSSPLNA-VAAELWDTDMQEY 148

>KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa]
           {ON} Anc_8.230 YDR092W
          Length = 152

 Score = 81.3 bits (199), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/123 (39%), Positives = 73/123 (59%), Gaps = 6/123 (4%)

Query: 13  KVLKEGDEVYSQLIVGM--EPKEDLTRW-EALIRGPSGTPYEGCNFRLHLSLPQEYPMSP 69
           +++KE + + +  + G+  EP +D  R+ E  + GP G+PYE   F+L L LP +YPM  
Sbjct: 7   RIIKETERLITDPVPGITAEPHDDNLRYFEVTVEGPVGSPYENGIFQLELYLPDDYPMEA 66

Query: 70  PYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNV 129
           P V+F    + H N+D R G ICLD+L K +WSPA  +  V+ +I  LL  P  + PL  
Sbjct: 67  PKVRFL-TKIYHPNID-RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLAN 123

Query: 130 DIA 132
           D+A
Sbjct: 124 DVA 126

>ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092W UBC13 Ubiquitin-conjugating enzyme involved in
           the error-free DNA postreplication repair pathway
           interacts with Mms2p to assemble ubiquitin chains at the
           Ub Lys-63 residue DNA damage triggers redistribution
           from the cytoplasm to the nucleus
          Length = 151

 Score = 80.5 bits (197), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 72/123 (58%), Gaps = 6/123 (4%)

Query: 13  KVLKEGDEVYSQLIVGM--EPKEDLTRWEAL-IRGPSGTPYEGCNFRLHLSLPQEYPMSP 69
           +++KE + + S  + G+  EP ED  R+ A+ I GP  +PYE   F L L LP +YPM  
Sbjct: 7   RIIKETERLASDPVPGISAEPHEDNLRYFAVTIEGPEESPYENGVFELELYLPDDYPMEA 66

Query: 70  PYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNV 129
           P V+F    + H N+D R G ICLD+L K +WSPA  +  V+ +I  LL  P  + PL  
Sbjct: 67  PKVRFL-TRIYHPNID-RLGRICLDVL-KNNWSPALQIRTVLLSIQALLASPNPNDPLAN 123

Query: 130 DIA 132
           D+A
Sbjct: 124 DVA 126

>TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON}
           Anc_8.230 YDR092W
          Length = 152

 Score = 80.5 bits (197), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 76/133 (57%), Gaps = 6/133 (4%)

Query: 13  KVLKEGDEVYSQLIVGM--EPKEDLTRWEAL-IRGPSGTPYEGCNFRLHLSLPQEYPMSP 69
           +++KE + + S  + G+  EP +D  R+ ++ I GP G+PYE   F L L LP +YPM  
Sbjct: 7   RIIKETERLVSDPVPGITAEPHDDNLRYFSVTIEGPEGSPYEHGIFDLELFLPDDYPMES 66

Query: 70  PYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNV 129
           P V+F    + H N+D R G ICLD+L K +WSPA  +  V+ +I  LL  P  + PL  
Sbjct: 67  PKVRFL-TKIYHPNID-RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLAN 123

Query: 130 DIANILKANDMNA 142
           D+A     N+  A
Sbjct: 124 DVAEDWIKNETGA 136

>KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 159
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus ,
          Length = 159

 Score = 80.5 bits (197), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/123 (39%), Positives = 72/123 (58%), Gaps = 6/123 (4%)

Query: 13  KVLKEGDEVYSQLIVGM--EPKEDLTRW-EALIRGPSGTPYEGCNFRLHLSLPQEYPMSP 69
           +++KE + + S  + G+  EP ED  R+ +  I GP  +PYE   F+L L LP +YPM  
Sbjct: 7   RIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEA 66

Query: 70  PYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNV 129
           P V+F    + H N+D R G ICLD+L K +WSPA  +  V+ ++  LL  P  + PL  
Sbjct: 67  PKVRFL-TKIYHPNID-RLGRICLDVL-KNNWSPALQIRTVLLSVQALLASPNPNDPLAN 123

Query: 130 DIA 132
           D+A
Sbjct: 124 DVA 126

>SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741)
           [462 bp, 153 aa] {ON} highly similar to uniprot|P52490
           Saccharomyces cerevisiae YDR092W UBC13
           Ubiquitin-conjugating enzyme involved in the error-free
           DNA postreplication repair pathway interacts with Mms2p
           to assemble ubiquitin chains at the Ub Lys-63 residue
           DNA damage triggers redistribution from the cytoplasm to
           the nucleus
          Length = 153

 Score = 80.1 bits (196), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 49/123 (39%), Positives = 72/123 (58%), Gaps = 6/123 (4%)

Query: 13  KVLKEGDEVYSQLIVGM--EPKEDLTRW-EALIRGPSGTPYEGCNFRLHLSLPQEYPMSP 69
           +++KE + + S  + G+  EP +D  R+ +  I GP  +PYE   F L L LP++YPM  
Sbjct: 7   RIIKETERLVSDPVPGISAEPHDDNLRYFQVTIEGPQQSPYENGVFELELFLPEDYPMEA 66

Query: 70  PYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNV 129
           P V+F    + H N+D R G ICLD+L K +WSPA  +  V+ +I  LL  P  + PL  
Sbjct: 67  PKVRFL-TKIYHPNID-RLGRICLDVL-KNNWSPALQIRTVLLSIQALLASPNPNDPLAN 123

Query: 130 DIA 132
           D+A
Sbjct: 124 DVA 126

>CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme
          Length = 214

 Score = 81.3 bits (199), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 62/109 (56%), Gaps = 4/109 (3%)

Query: 44  GPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSP 103
           GP  TPYEG  +RLH+ LP  YP   P + F    + H N+D  +G ICLD++    WSP
Sbjct: 39  GPKDTPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVINST-WSP 96

Query: 104 AWDLLHVVQ-AIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
            +DLL++V+  +  LL EP  S PLN + AN L+  D   Y   V  YI
Sbjct: 97  LYDLLNIVEWMLPGLLKEPNGSDPLNNEAAN-LQLKDKKVYEEKVREYI 144

>Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..1958)
           [459 nt, 153 aa]
          Length = 152

 Score = 79.3 bits (194), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 71/123 (57%), Gaps = 6/123 (4%)

Query: 13  KVLKEGDEVYSQLIVGM--EPKEDLTRW-EALIRGPSGTPYEGCNFRLHLSLPQEYPMSP 69
           +++KE + + S  + G+  EP +D  R+ E  I GP  +PYE   F L L LP +YPM  
Sbjct: 7   RIIKETERLVSDPVPGITAEPHDDNLRYFEVTIEGPQQSPYENGVFDLELFLPDDYPMEA 66

Query: 70  PYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNV 129
           P V+F    + H N+D R G ICLD+L K +WSPA  +  V+ +I  LL  P  + PL  
Sbjct: 67  PKVRFL-TKIYHPNID-RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLAN 123

Query: 130 DIA 132
           D+A
Sbjct: 124 DVA 126

>NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465
           bp, 154 aa] {ON} Anc_8.230
          Length = 154

 Score = 79.3 bits (194), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 72/123 (58%), Gaps = 6/123 (4%)

Query: 13  KVLKEGDEVYSQLIVGM--EPKEDLTRW-EALIRGPSGTPYEGCNFRLHLSLPQEYPMSP 69
           +++KE + + S  + G+  EP +D  R+    + GP+ +PYE   F+L L LP +YPM  
Sbjct: 7   RIIKETERLISDPVPGITAEPHDDNLRYFNVTVEGPTQSPYENGIFKLELYLPDDYPMEA 66

Query: 70  PYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNV 129
           P V+F    + H N+D R G ICLD+L K +WSPA  +  V+ +I  LL  P  + PL  
Sbjct: 67  PKVRFL-TKIYHPNID-RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLAN 123

Query: 130 DIA 132
           D+A
Sbjct: 124 DVA 126

>YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {ON} 
           UBC13Ubiquitin-conjugating enzyme involved in the
           error-free DNA postreplication repair pathway; interacts
           with Mms2p to assemble ubiquitin chains at the Ub Lys-63
           residue; DNA damage triggers redistribution from the
           cytoplasm to the nucleus
          Length = 153

 Score = 79.3 bits (194), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 75/133 (56%), Gaps = 6/133 (4%)

Query: 13  KVLKEGDEVYSQLIVGM--EPKEDLTRW-EALIRGPSGTPYEGCNFRLHLSLPQEYPMSP 69
           +++KE +++ S  + G+  EP +D  R+ +  I GP  +PYE   F L L LP +YPM  
Sbjct: 7   RIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEA 66

Query: 70  PYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNV 129
           P V+F    + H N+D R G ICLD+L K +WSPA  +  V+ +I  LL  P  + PL  
Sbjct: 67  PKVRFL-TKIYHPNID-RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLAN 123

Query: 130 DIANILKANDMNA 142
           D+A     N+  A
Sbjct: 124 DVAEDWIKNEQGA 136

>KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 149
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus
          Length = 149

 Score = 79.0 bits (193), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 72/123 (58%), Gaps = 6/123 (4%)

Query: 13  KVLKEGDEVYSQLIVGM--EPKEDLTRW-EALIRGPSGTPYEGCNFRLHLSLPQEYPMSP 69
           +++KE + + S  + G+  +P ED  R+ +  I GP  +PYE   F+L L LP +YPM  
Sbjct: 7   RIIKETERLVSDPVPGITAQPHEDNLRYFQVTIEGPQQSPYESGVFQLELFLPDDYPMEA 66

Query: 70  PYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNV 129
           P V+F    + H N+D R G ICLD+L K +WSPA  +  V+ ++  LL  P  + PL  
Sbjct: 67  PKVRFL-TKIYHPNID-RLGRICLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLAN 123

Query: 130 DIA 132
           D+A
Sbjct: 124 DVA 126

>TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 bp,
           157 aa] {ON} Anc_3.308 YBR082C
          Length = 157

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 71/123 (57%), Gaps = 6/123 (4%)

Query: 13  KVLKEGDEVYSQLIVGM--EPKEDLTRW-EALIRGPSGTPYEGCNFRLHLSLPQEYPMSP 69
           +++KE + + S  + G+  EP ED  R+ +  I GP  +PYE   F L L LP +YPM  
Sbjct: 7   RIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFNLELFLPDDYPMEA 66

Query: 70  PYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNV 129
           P V+F    + H N+D + G ICLD+L K +WSPA  +  V+ ++  LL  P  + PL  
Sbjct: 67  PKVRFL-TKIYHPNID-KLGRICLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLAN 123

Query: 130 DIA 132
           D+A
Sbjct: 124 DVA 126

>ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 79/152 (51%), Gaps = 19/152 (12%)

Query: 1   MSRAAKE--YKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLH 58
           MS+ A++   K + +++K+     + ++ G   + DL  W+ LI+GP  TPYEG  F   
Sbjct: 1   MSKTAQKRLLKELQQLMKDSS---TGIVAGPRSENDLFVWDCLIQGPPDTPYEGGIFNAK 57

Query: 59  LSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDI------------LTKQHWSPAWD 106
           L  P++YP+SPP + F P  + H N+ +  GE+C+ I            L ++ WSP   
Sbjct: 58  LEFPKDYPLSPPKLTFTPSIL-HPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQS 115

Query: 107 LLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           +  ++ ++  +L EP   S  NVD   + + N
Sbjct: 116 VEKILLSVMSMLSEPNVESGANVDACILWRDN 147

>KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609
           bp, 202 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 202

 Score = 79.0 bits (193), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 62/111 (55%), Gaps = 4/111 (3%)

Query: 42  IRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHW 101
             GP  TPYE   +RLH+ LP  YP   P + F    + H N+D  +G ICLD++    W
Sbjct: 37  FHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSICLDVINST-W 94

Query: 102 SPAWDLLHVVQ-AIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
           SP +DLL++V+  I  LL EP  S PLN + A  L+  D + Y   +H YI
Sbjct: 95  SPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLKDKDMYEQKIHEYI 144

>TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.436
           YEL012W
          Length = 226

 Score = 78.6 bits (192), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 66/120 (55%), Gaps = 4/120 (3%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  +     GP  TPYEG  +RLH+ LP  YP   P + F    + H N+D  +G IC
Sbjct: 29  DNMQEFYVKFHGPKDTPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSIC 87

Query: 93  LDILTKQHWSPAWDLLHVVQ-AIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
           LD++    WSP +DLL++++  I  LL EP  S PLN + A  L+ +D   Y   +  YI
Sbjct: 88  LDVINST-WSPLYDLLNIIEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKKIYEEKIKEYI 145

>Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 76.6 bits (187), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 72/138 (52%), Gaps = 7/138 (5%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MS + +  K ++ + ++     S   VG    +DL  W+A I GPS +PY G  F L + 
Sbjct: 1   MSSSKRIAKELSDLGRDPPASCSAGPVG----DDLYHWQASIMGPSDSPYAGGVFFLSIH 56

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
            P +YP  PP V F    + H N++  +G ICLDIL K  WSPA  L  V+ +I  LL +
Sbjct: 57  FPTDYPFKPPKVNFT-TKIYHPNIN-SSGNICLDIL-KDQWSPALTLSKVLLSICSLLTD 113

Query: 121 PVSSSPLNVDIANILKAN 138
                PL  +IA I K +
Sbjct: 114 ANPDDPLVPEIAQIYKTD 131

>Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 76.6 bits (187), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 72/138 (52%), Gaps = 7/138 (5%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MS + +  K ++ + ++     S   VG    +DL  W+A I GPS +PY G  F L + 
Sbjct: 1   MSSSKRIAKELSDLGRDPPASCSAGPVG----DDLYHWQASIMGPSDSPYAGGVFFLSIH 56

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
            P +YP  PP V F    + H N++  +G ICLDIL K  WSPA  L  V+ +I  LL +
Sbjct: 57  FPTDYPFKPPKVNFT-TKIYHPNIN-SSGNICLDIL-KDQWSPALTLSKVLLSICSLLTD 113

Query: 121 PVSSSPLNVDIANILKAN 138
                PL  +IA I K +
Sbjct: 114 ANPDDPLVPEIAQIYKTD 131

>YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, 148
           aa] {ON}  UBC5Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived, abnormal, or
           excess proteins, including histone H3; central component
           of the cellular stress response; expression is heat
           inducible
          Length = 148

 Score = 76.6 bits (187), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 72/138 (52%), Gaps = 7/138 (5%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MS + +  K ++ + ++     S   VG    +DL  W+A I GPS +PY G  F L + 
Sbjct: 1   MSSSKRIAKELSDLGRDPPASCSAGPVG----DDLYHWQASIMGPSDSPYAGGVFFLSIH 56

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
            P +YP  PP V F    + H N++  +G ICLDIL K  WSPA  L  V+ +I  LL +
Sbjct: 57  FPTDYPFKPPKVNFT-TKIYHPNIN-SSGNICLDIL-KDQWSPALTLSKVLLSICSLLTD 113

Query: 121 PVSSSPLNVDIANILKAN 138
                PL  +IA I K +
Sbjct: 114 ANPDDPLVPEIAQIYKTD 131

>TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49
           YLR306W
          Length = 151

 Score = 76.3 bits (186), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 74/133 (55%), Gaps = 6/133 (4%)

Query: 13  KVLKEGDEVYSQLIVGM--EPKEDLTRWEAL-IRGPSGTPYEGCNFRLHLSLPQEYPMSP 69
           +++KE + + S  + G+  +P ED  R+ ++ I GP  + YE   F L L LP +YPM  
Sbjct: 7   RIIKETERLISDPVPGITAQPHEDNLRYFSVTIEGPKDSAYENGVFELELFLPDDYPMEA 66

Query: 70  PYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNV 129
           P V+F    + H N+D R G ICLD+L K +WSPA  +  V+ +I  LL  P  + PL  
Sbjct: 67  PKVRFL-TKIYHPNID-RLGRICLDVL-KNNWSPALQIRTVLLSIQALLASPNPNDPLAN 123

Query: 130 DIANILKANDMNA 142
           D+A     N+  A
Sbjct: 124 DVAEDWIKNEKGA 136

>KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON}
           Anc_1.436 YEL012W
          Length = 210

 Score = 77.8 bits (190), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/111 (40%), Positives = 60/111 (54%), Gaps = 4/111 (3%)

Query: 42  IRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHW 101
             GP  TPYE   +RLH+ LP  YP   P + F    + H N+D  +G ICLD++    W
Sbjct: 37  FHGPKDTPYENGVWRLHVELPDNYPFKSPSIGF-VNKIYHPNIDIASGSICLDVINST-W 94

Query: 102 SPAWDLLHVVQ-AIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
           SP +DLL++V+  I  LL EP  S PLN + A  L+  D   Y   +  YI
Sbjct: 95  SPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKMYEEKIKEYI 144

>Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 75.9 bits (185), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 72/138 (52%), Gaps = 7/138 (5%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MS + +  K ++ + ++     S   VG    +DL  W+A I GPS +PY G  F L + 
Sbjct: 1   MSSSKRIAKELSDLGRDPPASCSAGPVG----DDLYHWQASIMGPSDSPYAGGVFFLSIH 56

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
            P +YP  PP V F    + H N++  +G ICLDIL K  WSPA  L  V+ ++  LL +
Sbjct: 57  FPTDYPFKPPKVNFT-TKIYHPNIN-SSGNICLDIL-KDQWSPALTLSKVLLSVCSLLTD 113

Query: 121 PVSSSPLNVDIANILKAN 138
                PL  +IA I K +
Sbjct: 114 ANPDDPLVPEIAQIYKTD 131

>Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W
           (QRI8) - ubiquitin conjugating enzyme [contig 58] FULL
          Length = 165

 Score = 75.9 bits (185), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 81/152 (53%), Gaps = 19/152 (12%)

Query: 1   MSRAAKE--YKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLH 58
           MS+ A++  +K + ++LK+  E    ++ G + +++L  W+ LI GP  +PY+G  F   
Sbjct: 1   MSKTAQKRLFKELQQLLKDSPE---GIVAGPKSEDNLFVWDCLISGPPDSPYQGGVFNAT 57

Query: 59  LSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDI------------LTKQHWSPAWD 106
           L  P++YP+SPP + F P  + H N+ +  GE+C+ I            L ++ WSP   
Sbjct: 58  LEFPKDYPLSPPKLLFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQS 115

Query: 107 LLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           +  ++ ++  +L EP   S  N+D   + + N
Sbjct: 116 VEKILLSVMSMLSEPNVESGANIDACILWRDN 147

>TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1.436
           YEL012W
          Length = 203

 Score = 76.6 bits (187), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 64/120 (53%), Gaps = 4/120 (3%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  +    RGP  TPYE   +RLH+ LP  YP   P + F    + H N+D  +G IC
Sbjct: 15  DNMQEFHVKFRGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIL-HPNIDVASGSIC 73

Query: 93  LDILTKQHWSPAWDLLHVVQ-AIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
           LD++    WSP +DL ++V+  I  LL EP  S PLN + A  L+  D   Y   +  YI
Sbjct: 74  LDVINST-WSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYI 131

>Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 75.1 bits (183), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/129 (38%), Positives = 72/129 (55%), Gaps = 6/129 (4%)

Query: 17  EGDEVYSQLIVGM--EPKEDLTRW-EALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVK 73
           E +++ S  + G+  EP +D  R+ +  I GP  +PYE   F+L L LP +YPM  P V+
Sbjct: 1   ETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGVFKLELFLPDDYPMEAPKVR 60

Query: 74  FEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIAN 133
           F    + H N+D R G ICLD+L K +WSPA  +  V+ +I  LL  P  + PL  D+A 
Sbjct: 61  FL-TKIYHPNID-RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 117

Query: 134 ILKANDMNA 142
               N+  A
Sbjct: 118 DWIKNEEGA 126

>Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 75.1 bits (183), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/129 (38%), Positives = 72/129 (55%), Gaps = 6/129 (4%)

Query: 17  EGDEVYSQLIVGM--EPKEDLTRW-EALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVK 73
           E +++ S  + G+  EP +D  R+ +  I GP  +PYE   F L L LP +YPM  P V+
Sbjct: 1   ETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVR 60

Query: 74  FEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIAN 133
           F    + H N+D R G ICLD+L K +WSPA  +  V+ +I  LL  P  + PL  D+A 
Sbjct: 61  FL-TKIYHPNID-RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 117

Query: 134 ILKANDMNA 142
               N++ A
Sbjct: 118 DWIKNEVGA 126

>CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022w E2 ubiquitin-conjugation enzyme
          Length = 165

 Score = 75.5 bits (184), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 79/152 (51%), Gaps = 19/152 (12%)

Query: 1   MSRAAKE--YKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLH 58
           MS+ A++  YK + +++K+       ++ G +  ++L  W+ LI+GP  TPY G  F   
Sbjct: 1   MSKTAQKRLYKELQQLIKDSP---PGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQ 57

Query: 59  LSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDIL------------TKQHWSPAWD 106
           L  P++YP+SPP + F P  + H N+ +  GE+C+ IL             ++ WSP   
Sbjct: 58  LEFPKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYESAEERWSPVQS 115

Query: 107 LLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           +  ++ ++  +L EP   S  N+D   + + N
Sbjct: 116 VEKILLSVMSMLSEPNIESGANIDACILWRDN 147

>AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL012W
           (UBC8); 1-intron
          Length = 211

 Score = 76.6 bits (187), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 60/107 (56%), Gaps = 3/107 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  +     GP GTPYE   +RLH+ LP  YP   P + F    + H N+D  +G IC
Sbjct: 27  DNMQEFHVKFHGPKGTPYERGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSIC 85

Query: 93  LDILTKQHWSPAWDLLHVVQ-AIGQLLDEPVSSSPLNVDIANILKAN 138
           LD++    WSP +DLL++V+  I  LL EP  S PLN + A +   N
Sbjct: 86  LDVINST-WSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLKN 131

>Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa]
           {ON} (30890..30894,31122..31788) [672 nt, 224 aa]
          Length = 223

 Score = 76.6 bits (187), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 61/109 (55%), Gaps = 4/109 (3%)

Query: 44  GPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSP 103
           GP  TPYE   +RLH+ LP  YP   P + F    + H N+D  +G ICLD++    WSP
Sbjct: 39  GPKDTPYENGCWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVINST-WSP 96

Query: 104 AWDLLHVVQ-AIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
            +DLL++V+  I  LL EP  S PLN + A  L+ +D   Y   +  YI
Sbjct: 97  LYDLLNIVEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKTLYEQKIKEYI 144

>TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.375
           YDR177W
          Length = 214

 Score = 76.6 bits (187), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 67/132 (50%), Gaps = 5/132 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSRA +  K +  V    D+  + + +    + D+   +    GP GTPYEG  F + + 
Sbjct: 1   MSRAKRIMKEMQAV---KDDPAANITLDFVNESDIHHLKGSFLGPPGTPYEGGRFMIDIE 57

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P EYP  PP +KF+     H N+   TG ICLDIL K  WSP   L   + ++  LL  
Sbjct: 58  VPMEYPFKPPKMKFDTKVY-HPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALLQS 115

Query: 121 PVSSSPLNVDIA 132
           P  + P + ++A
Sbjct: 116 PEPNDPQDAEVA 127

>Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {ON}
           YDR092W (UBC13) - ubiquitin-conjugating enzyme [contig
           176] FULL
          Length = 149

 Score = 75.1 bits (183), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 70/120 (58%), Gaps = 6/120 (5%)

Query: 16  KEGDEVYSQLIVGM--EP-KEDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYV 72
           +E + + S  + G+  EP +E+L  ++  I GP  +PYE   F+L L LP +YPM  P V
Sbjct: 10  QETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKV 69

Query: 73  KFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIA 132
           +F    + H N+D R G ICLD+L K +WSPA  +  V+ ++  LL  P  + PL  D+A
Sbjct: 70  RFL-TKIYHPNID-RLGRICLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme
           that mediates selective degradation of short-lived and
           abnormal proteins plays a role in vesicle biogenesis and
           ER- associated protein degradation (ERAD) component of
           the cellular stress response
          Length = 215

 Score = 76.6 bits (187), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 68/132 (51%), Gaps = 5/132 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSRA +    I ++    D+  + + +    + D+   +    GP GTPYEG NF + + 
Sbjct: 1   MSRAKR---IIKEIQAAKDDPEANITLSFVSESDIHHLKGSFYGPPGTPYEGGNFIVDIQ 57

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P EYP  PP ++F+     H N+   TG ICLDIL K  WSP   L   + ++  LL  
Sbjct: 58  VPLEYPFKPPKMQFDTKVY-HPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALLQS 115

Query: 121 PVSSSPLNVDIA 132
           P  + P + ++A
Sbjct: 116 PEPNDPQDAEVA 127

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 76.3 bits (186), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 67/132 (50%), Gaps = 5/132 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSRA +  K I  V    D+  + + +    + D+   +    GP GTPYEG  F + + 
Sbjct: 1   MSRAKRIMKEIQAV---KDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIE 57

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P EYP  PP ++F+     H N+   TG ICLDIL K  WSP   L   + ++  LL  
Sbjct: 58  VPMEYPFKPPKMQFDTKVY-HPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALLQS 115

Query: 121 PVSSSPLNVDIA 132
           P  + P + ++A
Sbjct: 116 PEPNDPQDAEVA 127

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 76.3 bits (186), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 67/132 (50%), Gaps = 5/132 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSRA +  K I  V    D+  + + +    + D+   +    GP GTPYEG  F + + 
Sbjct: 1   MSRAKRIMKEIQAV---KDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIE 57

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P EYP  PP ++F+     H N+   TG ICLDIL K  WSP   L   + ++  LL  
Sbjct: 58  VPMEYPFKPPKMQFDTKVY-HPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALLQS 115

Query: 121 PVSSSPLNVDIA 132
           P  + P + ++A
Sbjct: 116 PEPNDPQDAEVA 127

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 75.9 bits (185), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 67/132 (50%), Gaps = 5/132 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSRA +  K I  V    D+  + + +    + D+   +    GP GTPYEG  F + + 
Sbjct: 1   MSRAKRIMKEIQAV---KDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIE 57

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P EYP  PP ++F+     H N+   TG ICLDIL K  WSP   L   + ++  LL  
Sbjct: 58  VPMEYPFKPPKMQFDTKVY-HPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALLQS 115

Query: 121 PVSSSPLNVDIA 132
           P  + P + ++A
Sbjct: 116 PEPNDPQDAEVA 127

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 75.9 bits (185), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 67/132 (50%), Gaps = 5/132 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSRA +  K I  V    D+  + + +    + D+   +    GP GTPYEG  F + + 
Sbjct: 1   MSRAKRIMKEIQAV---KDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIE 57

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P EYP  PP ++F+     H N+   TG ICLDIL K  WSP   L   + ++  LL  
Sbjct: 58  VPMEYPFKPPKMQFDTKVY-HPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALLQS 115

Query: 121 PVSSSPLNVDIA 132
           P  + P + ++A
Sbjct: 116 PEPNDPQDAEVA 127

>KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012)
           [702 bp, 233 aa] {ON} highly similar to uniprot|P28263
           Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin-conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6- bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 233

 Score = 76.3 bits (186), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 60/107 (56%), Gaps = 3/107 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  +     GP GTPYE   +RLH+ LP  YP   P + F    + H N+D  +G IC
Sbjct: 27  DNMQEFHIKFHGPQGTPYEAGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSIC 85

Query: 93  LDILTKQHWSPAWDLLHVVQ-AIGQLLDEPVSSSPLNVDIANILKAN 138
           LD++    WSP +DL+++V+  I  LL EP  S PLN + A +   N
Sbjct: 86  LDVINST-WSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLKN 131

>Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 74.3 bits (181), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 72/138 (52%), Gaps = 7/138 (5%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MS + +  K ++ + ++     S   VG    +DL  W+A I GP+ +PY G  F L + 
Sbjct: 1   MSSSKRIAKELSDLERDPPTSCSAGPVG----DDLYHWQASIMGPADSPYAGGVFFLSIH 56

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
            P +YP  PP + F    + H N++   G ICLDIL K  WSPA  L  V+ +I  LL +
Sbjct: 57  FPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDIL-KDQWSPALTLSKVLLSICSLLTD 113

Query: 121 PVSSSPLNVDIANILKAN 138
                PL  +IA+I K +
Sbjct: 114 ANPDDPLVPEIAHIYKTD 131

>Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 74.3 bits (181), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 72/138 (52%), Gaps = 7/138 (5%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MS + +  K ++ + ++     S   VG    +DL  W+A I GP+ +PY G  F L + 
Sbjct: 1   MSSSKRIAKELSDLERDPPTSCSAGPVG----DDLYHWQASIMGPADSPYAGGVFFLSIH 56

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
            P +YP  PP + F    + H N++   G ICLDIL K  WSPA  L  V+ +I  LL +
Sbjct: 57  FPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDIL-KDQWSPALTLSKVLLSICSLLTD 113

Query: 121 PVSSSPLNVDIANILKAN 138
                PL  +IA+I K +
Sbjct: 114 ANPDDPLVPEIAHIYKTD 131

>Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 74.3 bits (181), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 72/138 (52%), Gaps = 7/138 (5%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MS + +  K ++ + ++     S   VG    +DL  W+A I GP+ +PY G  F L + 
Sbjct: 1   MSSSKRIAKELSDLERDPPTSCSAGPVG----DDLYHWQASIMGPADSPYAGGVFFLSIH 56

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
            P +YP  PP + F    + H N++   G ICLDIL K  WSPA  L  V+ +I  LL +
Sbjct: 57  FPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDIL-KDQWSPALTLSKVLLSICSLLTD 113

Query: 121 PVSSSPLNVDIANILKAN 138
                PL  +IA+I K +
Sbjct: 114 ANPDDPLVPEIAHIYKTD 131

>YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, 148
           aa] {ON}  UBC4Ubiquitin-conjugating enzyme (E2),
           mediates degradation of abnormal or excess proteins,
           including calmodulin and histone H3; interacts with many
           SCF ubiquitin protein ligases; component of the cellular
           stress response
          Length = 148

 Score = 74.3 bits (181), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 72/138 (52%), Gaps = 7/138 (5%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MS + +  K ++ + ++     S   VG    +DL  W+A I GP+ +PY G  F L + 
Sbjct: 1   MSSSKRIAKELSDLERDPPTSCSAGPVG----DDLYHWQASIMGPADSPYAGGVFFLSIH 56

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
            P +YP  PP + F    + H N++   G ICLDIL K  WSPA  L  V+ +I  LL +
Sbjct: 57  FPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDIL-KDQWSPALTLSKVLLSICSLLTD 113

Query: 121 PVSSSPLNVDIANILKAN 138
                PL  +IA+I K +
Sbjct: 114 ANPDDPLVPEIAHIYKTD 131

>NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa]
           {ON} 
          Length = 245

 Score = 76.3 bits (186), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 60/109 (55%), Gaps = 4/109 (3%)

Query: 44  GPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSP 103
           GP  TPYE   +RLH+ LP  YP   P + F    + H N+D  +G ICLD++    WSP
Sbjct: 56  GPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVINST-WSP 113

Query: 104 AWDLLHVVQ-AIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
            +DLL++V+  I  LL EP  S PLN + A  L+  D   Y   +  YI
Sbjct: 114 LYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLELKDKKLYEERIKEYI 161

>SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 74.7 bits (182), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 74/148 (50%), Gaps = 20/148 (13%)

Query: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLP 62
           R  KE + + +   EG      ++ G + +++L  W+ LI GP  +PYEG  F   L  P
Sbjct: 8   RLLKELQQLARDSPEG------IVAGPKSEDNLFLWDCLITGPPDSPYEGGVFNAMLEFP 61

Query: 63  QEYPMSPPYVKFEPYAMPHANVDFRTGEICLDI------------LTKQHWSPAWDLLHV 110
           ++YP+SPP + F P  + H N+ +  GE+C+ I            L ++ WSP   +  +
Sbjct: 62  KDYPLSPPRLTFTPSIL-HPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEKI 119

Query: 111 VQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + ++  +L EP   S  N+D   + + N
Sbjct: 120 LLSVTSMLSEPNVESGANIDACILWRDN 147

>Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 215
           aa] {ON} YEL012W (REAL)
          Length = 215

 Score = 75.9 bits (185), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 60/109 (55%), Gaps = 4/109 (3%)

Query: 44  GPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSP 103
           GP  TPYE   +RLH+ LP  YP   P + F    + H N+D  +G ICLD++    WSP
Sbjct: 38  GPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVINST-WSP 95

Query: 104 AWDLLHVVQ-AIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
            +DL+++V+  I  LL EP  S PLN + A  L+  D   Y   +  YI
Sbjct: 96  LYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYI 143

>KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 74.7 bits (182), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 77/144 (53%), Gaps = 19/144 (13%)

Query: 1   MSRAAKE--YKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLH 58
           MS+ A++  +K + ++LK+  E    ++ G   +++L  W+ LI GP  +PY+G  F   
Sbjct: 1   MSKTAQKRLFKELQQLLKDSPE---GIVAGPRSEDNLFLWDCLISGPPDSPYQGGVFNAT 57

Query: 59  LSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDI------------LTKQHWSPAWD 106
           L  P++YP+SPP + F P  + H N+ +  GE+C+ I            L ++ WSP   
Sbjct: 58  LEFPKDYPLSPPKLLFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQS 115

Query: 107 LLHVVQAIGQLLDEPVSSSPLNVD 130
           +  ++ ++  +L EP   S  N+D
Sbjct: 116 VEKILLSVMSMLSEPNVESGANID 139

>ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR022W (QRI8)
          Length = 165

 Score = 74.7 bits (182), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 79/152 (51%), Gaps = 19/152 (12%)

Query: 1   MSRAAKE--YKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLH 58
           MS+ A++   K + ++L++  +    ++ G   +++L  W+ LI GP+ +PYEG  F   
Sbjct: 1   MSKTAQKRLMKELQQLLRDSPD---GIVAGPVSEDNLFLWDCLIEGPADSPYEGGVFNAR 57

Query: 59  LSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDIL------------TKQHWSPAWD 106
           L  P++YP+SPP + F P  + H NV +  GE+C+ IL              + WSP   
Sbjct: 58  LQFPRDYPLSPPKLTFTPSIL-HPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQS 115

Query: 107 LLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           +  ++ ++  +L EP   S  N+D   + + N
Sbjct: 116 VEKILLSVMSMLSEPNVESGANIDACILWRDN 147

>NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON} 
          Length = 231

 Score = 75.9 bits (185), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 60/109 (55%), Gaps = 4/109 (3%)

Query: 44  GPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSP 103
           GP  TPYE   +RLH+ LP  YP   P + F    + H N+D  +G ICLD++    WSP
Sbjct: 61  GPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVINST-WSP 118

Query: 104 AWDLLHVVQ-AIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
            +DLL++V+  I  LL EP  S PLN + A  L+  D   Y   +  YI
Sbjct: 119 LYDLLNIVEWMIPGLLKEPNGSDPLNNEAAT-LELRDKKLYEEKIREYI 166

>Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 73.9 bits (180), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 50/129 (38%), Positives = 71/129 (55%), Gaps = 6/129 (4%)

Query: 17  EGDEVYSQLIVGM--EPKEDLTRW-EALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVK 73
           E +++ S  + G+  EP +D  R+ +  I GP  +PYE   F L L LP +YPM  P V+
Sbjct: 1   ETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGVFELELYLPDDYPMEAPKVR 60

Query: 74  FEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIAN 133
           F    + H N+D R G ICLD+L K +WSPA  +  V+ +I  LL  P  + PL  D+A 
Sbjct: 61  FL-TRIYHPNID-RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 117

Query: 134 ILKANDMNA 142
               N+  A
Sbjct: 118 DWIKNEEGA 126

>Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp,
           211 aa] {ON} similar to Ashbya gossypii AEL045W
           1-intron
          Length = 211

 Score = 75.5 bits (184), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 75/140 (53%), Gaps = 11/140 (7%)

Query: 1   MSRAAKEYKT-ITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHL 59
           MS + +  +T + K+L    EV  +L+      +++  +     GP GTPYE   +RLH+
Sbjct: 1   MSNSKRRIETDVMKLLMSDHEV--ELV-----DDNMQEFHVKFLGPRGTPYERGVWRLHV 53

Query: 60  SLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQ-AIGQLL 118
            LP  YP   P + F    + H N+D  +G ICLD++    WSP +DL+++V+  I  LL
Sbjct: 54  ELPDNYPYKSPSIGF-VNKIFHPNIDAASGSICLDVINST-WSPLYDLINIVEWMIPGLL 111

Query: 119 DEPVSSSPLNVDIANILKAN 138
            EP  S PLN + A +   N
Sbjct: 112 KEPNGSDPLNNEAATLQLKN 131

>KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.569
           YMR022W
          Length = 170

 Score = 74.3 bits (181), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 78/154 (50%), Gaps = 23/154 (14%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQ----LIVGMEPKEDLTRWEALIRGPSGTPYEGCNFR 56
           MS+ A+      ++LKE  ++       ++ G + + DL  W+ L++GP  +PYEG  F 
Sbjct: 1   MSKTAQR-----RLLKELQQLMRDPPPGIVAGPQDESDLFLWDCLVQGPPDSPYEGGVFE 55

Query: 57  LHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDI------------LTKQHWSPA 104
             L  P++YP+SPP + F P  + H NV +  GE+C+ I            L ++ WSP 
Sbjct: 56  AQLRFPRDYPLSPPKLTFVPSVL-HPNV-YPNGEVCISILHAPGEDPNQYELAEERWSPV 113

Query: 105 WDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
             +  ++ ++  +L EP   S  N+D   + + N
Sbjct: 114 QSVEKILLSVVSMLSEPNVESGANIDACVLWRDN 147

>Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa]
           {ON} YEL012W (REAL)
          Length = 215

 Score = 75.5 bits (184), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 60/109 (55%), Gaps = 4/109 (3%)

Query: 44  GPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSP 103
           GP  TPYE   +RLH+ LP  YP   P + F    + H N+D  +G ICLD++    WSP
Sbjct: 38  GPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVINST-WSP 95

Query: 104 AWDLLHVVQ-AIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
            +DL+++V+  I  LL EP  S PLN + A  L+  D   Y   +  YI
Sbjct: 96  LYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYI 143

>Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii ABR059W
          Length = 165

 Score = 74.3 bits (181), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 71/148 (47%), Gaps = 20/148 (13%)

Query: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLP 62
           R  KE + + K   EG      ++ G   +E++  W+ LI GP  +PYEG  F   L  P
Sbjct: 8   RLMKEMQQLLKDCPEG------IVAGPVNEENMFLWDCLIAGPPDSPYEGGIFNARLQFP 61

Query: 63  QEYPMSPPYVKFEPYAMPHANVDFRTGEICLDIL------------TKQHWSPAWDLLHV 110
            +YP+SPP + F P  + H NV +  GE+C+ IL              + WSP   +  +
Sbjct: 62  TDYPLSPPKLTFTPSIL-HPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEKI 119

Query: 111 VQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + ++  +L EP   S  N+D   + + N
Sbjct: 120 LLSVMSMLSEPNVESGANIDACILWRDN 147

>Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON}
           complement(8947..9444) [498 nt, 166 aa]
          Length = 165

 Score = 74.3 bits (181), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 73/148 (49%), Gaps = 20/148 (13%)

Query: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLP 62
           R  KEY+ + +    G      ++ G   + DL  W+ LI+GP  TPYE   F   L  P
Sbjct: 8   RLFKEYQQLIRDSPPG------IVAGPANENDLFLWDCLIQGPPDTPYEHGVFNAQLRFP 61

Query: 63  QEYPMSPPYVKFEPYAMPHANVDFRTGEICLDI------------LTKQHWSPAWDLLHV 110
           ++YP+SPP + F P A+ H N+ +  GE+C+ I            L ++ WSP   +  +
Sbjct: 62  RDYPLSPPTLTFTP-AILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 111 VQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + ++  +L EP   S  N+D   + + N
Sbjct: 120 LLSVMSMLSEPNVESGANIDACILWRDN 147

>YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {ON} 
           UBC8Ubiquitin-conjugating enzyme that negatively
           regulates gluconeogenesis by mediating the
           glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 218

 Score = 75.1 bits (183), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 60/109 (55%), Gaps = 4/109 (3%)

Query: 44  GPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSP 103
           GP  TPYE   +RLH+ LP  YP   P + F    + H N+D  +G ICLD++    WSP
Sbjct: 38  GPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVINST-WSP 95

Query: 104 AWDLLHVVQ-AIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
            +DL+++V+  I  LL EP  S PLN + A  L+  D   Y   +  YI
Sbjct: 96  LYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYI 143

>TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 73/148 (49%), Gaps = 20/148 (13%)

Query: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLP 62
           R  KEY+ + +    G      ++   + + +L  W+ LI+GP  TPYEG  F   L  P
Sbjct: 8   RLLKEYQQLIRDPPPG------ILAAPKSESNLFLWDCLIQGPPDTPYEGGIFNARLDFP 61

Query: 63  QEYPMSPPYVKFEPYAMPHANVDFRTGEICLDI------------LTKQHWSPAWDLLHV 110
           ++YP+SPP + F P  + H N+ +  GE+C+ I            L ++ WSP   +  +
Sbjct: 62  KDYPLSPPKLTFTPSIL-HPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 111 VQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + ++  +L EP   S  NVD   + + N
Sbjct: 120 LLSVMSMLSEPNIESGANVDACILWRDN 147

>KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 81/154 (52%), Gaps = 23/154 (14%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQ----LIVGMEPKEDLTRWEALIRGPSGTPYEGCNFR 56
           MS+ A++     ++LKE  ++       ++ G + ++++ +W+ L++GP  +PYEG  F 
Sbjct: 1   MSKTAQK-----RLLKELQQLMKDSPPGIVAGPKTEDNIFQWDCLVQGPPDSPYEGGVFN 55

Query: 57  LHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDI------------LTKQHWSPA 104
             L  P++YP+SPP + F P  + H N+ +  GE+C+ I            L ++ WSP 
Sbjct: 56  AQLDFPKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPV 113

Query: 105 WDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
             +  ++ ++  +L EP   S  N+D   + + N
Sbjct: 114 QSVEKILLSVMSMLSEPNIESGANIDACILWRDN 147

>KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {ON} 
          Length = 147

 Score = 73.6 bits (179), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 58/106 (54%), Gaps = 3/106 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +DL  W+A I GP  +PY G  F L +  P +YP  PP + F    + H N++   G IC
Sbjct: 28  DDLFHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNIC 85

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           LDIL K  WSPA  L  V+ +I  LL +     PL  +IA+I K +
Sbjct: 86  LDIL-KDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTD 130

>NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [447
           bp, 148 aa] {ON} Anc_3.308
          Length = 148

 Score = 73.6 bits (179), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 71/138 (51%), Gaps = 7/138 (5%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MS + +  K ++ + ++     S   VG    +DL  W+A I GP  +PY G  F L + 
Sbjct: 1   MSSSKRITKELSDMGRDPPTSCSAGPVG----DDLYHWQASIMGPPDSPYAGGVFFLSIH 56

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
            P +YP  PP + F    + H N++   G ICLDIL K  WSPA  L  V+ +I  LL +
Sbjct: 57  FPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDIL-KDQWSPALTLSKVLLSICSLLTD 113

Query: 121 PVSSSPLNVDIANILKAN 138
                PL  +IA+I K +
Sbjct: 114 ANPDDPLVPEIAHIYKTD 131

>CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177w E2 ubiquitin-conjugating enzyme
          Length = 213

 Score = 75.1 bits (183), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 67/133 (50%), Gaps = 5/133 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSRA +  K +  V    D+  + + +    + D+   +    GP GTPYEG  F + + 
Sbjct: 1   MSRAKRIMKELQAV---KDDPEANISLEFVSESDIHHLKGSFLGPPGTPYEGGKFIVDIE 57

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P EYP  PP +KF+     H N+   TG ICLDIL K  WSP   L   + ++  LL  
Sbjct: 58  VPMEYPFKPPKMKFDSKVY-HPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALLQS 115

Query: 121 PVSSSPLNVDIAN 133
           P  + P + ++A 
Sbjct: 116 PEPNDPQDAEVAQ 128

>NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON} 
          Length = 216

 Score = 75.1 bits (183), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 68/133 (51%), Gaps = 5/133 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSRA +  K +  V    D+  +++ +    + D+   +    GP GTPYEG  F + + 
Sbjct: 1   MSRAKRIMKELQAV---KDDPTAKIGLEFVNESDIHHLKGSFFGPPGTPYEGGQFIIDIE 57

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P EYP  PP +KF+     H N+   TG ICLDIL K  WSP   L   + ++  LL  
Sbjct: 58  VPMEYPFKPPKMKFDTKVY-HPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALLQS 115

Query: 121 PVSSSPLNVDIAN 133
           P  + P + ++A 
Sbjct: 116 PEPNDPQDAEVAQ 128

>KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON}
           Anc_8.230 YDR092W
          Length = 147

 Score = 73.6 bits (179), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 69/120 (57%), Gaps = 6/120 (5%)

Query: 16  KEGDEVYSQLIVGM--EPKEDLTRW-EALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYV 72
           +E + + S  + G+  EP +D  R+ +  I GP  +PYE   F+L L LP +YPM  P V
Sbjct: 6   QETERLISDPVPGITAEPHDDNLRYFKVSIEGPEQSPYEKGIFQLELYLPDDYPMEAPKV 65

Query: 73  KFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIA 132
           +F    + H N+D R G ICLDIL K +WSPA  +  V+ ++  LL  P  + PL  D+A
Sbjct: 66  RFL-TKIYHPNID-RLGRICLDIL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 122

>NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 74.7 bits (182), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 68/133 (51%), Gaps = 5/133 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSRA +  K +  V    D+  +++ +    + D+   +    GP GTPYEG  F + + 
Sbjct: 1   MSRAKRIMKELQAV---KDDPEARIELEFVNESDIHHLKGSFLGPPGTPYEGGQFIVDIE 57

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P EYP  PP +KF+     H N+   TG ICLDIL K  WSP   L   + ++  LL  
Sbjct: 58  VPMEYPFKPPMMKFDTKVY-HPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALLQS 115

Query: 121 PVSSSPLNVDIAN 133
           P  + P + ++A 
Sbjct: 116 PEPNDPQDAEVAQ 128

>NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 147
           aa] {ON} Anc_3.308
          Length = 147

 Score = 73.2 bits (178), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 58/106 (54%), Gaps = 3/106 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +DL  W+A I GP  +PY G  F L +  P +YP  PP + F    + H N++   G IC
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNIC 85

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           LDIL K  WSPA  L  V+ +I  LL +     PL  +IA+I K +
Sbjct: 86  LDIL-KDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTD 130

>CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {ON}
           highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082c UBC4 E2 ubiquitin-conjugating enzyme
           or uniprot|P15732 Saccharomyces cerevisiae YDR059c UBC5
          Length = 147

 Score = 73.2 bits (178), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 58/106 (54%), Gaps = 3/106 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +DL  W+A I GP  +PY G  F L +  P +YP  PP + F    + H N++   G IC
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNIC 85

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           LDIL K  WSPA  L  V+ +I  LL +     PL  +IA+I K +
Sbjct: 86  LDIL-KDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTD 130

>KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON}
           Anc_1.436 YEL012W
          Length = 187

 Score = 73.9 bits (180), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/120 (36%), Positives = 63/120 (52%), Gaps = 4/120 (3%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  +     GP  TPYE   +RLH+ LP  YP   P + F      H N+D  +G IC
Sbjct: 27  DNMQEFHVKFHGPKDTPYEHGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDVASGSIC 85

Query: 93  LDILTKQHWSPAWDLLHVVQ-AIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
           LD++    WSP +DL+++V+  I  LL EP  S PLN + A  L+  D   Y   +  YI
Sbjct: 86  LDVINST-WSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKVLYEQKIKEYI 143

>Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W
           (REAL)
          Length = 210

 Score = 74.3 bits (181), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 60/109 (55%), Gaps = 4/109 (3%)

Query: 44  GPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSP 103
           GP  TPYE   +RLH+ LP  YP   P + F    + H N+D  +G ICLD++    WSP
Sbjct: 37  GPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVINST-WSP 94

Query: 104 AWDLLHVVQ-AIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
            +DL+++++  I  LL EP  S PLN + A  L+  D   Y   +  YI
Sbjct: 95  LYDLINILEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYI 142

>KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {ON} 
          Length = 161

 Score = 73.2 bits (178), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 58/106 (54%), Gaps = 3/106 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +DL  W+A I GP  +PY G  F L +  P +YP  PP + F    + H N++   G IC
Sbjct: 42  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNIC 99

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           LDIL K  WSPA  L  V+ +I  LL +     PL  +IA+I K +
Sbjct: 100 LDIL-KDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTD 144

>Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W
           (UBC8) - ubiquitin-conjugating enzyme; ubiquitin-protein
           ligase [contig 267] FULL
          Length = 213

 Score = 74.3 bits (181), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 59/104 (56%), Gaps = 3/104 (2%)

Query: 32  KEDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEI 91
            +++  +     GP  TPYEG  +RLH+ LP  YP   P + F    + H N+D  +G I
Sbjct: 14  NDNMQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 72

Query: 92  CLDILTKQHWSPAWDLLHVVQ-AIGQLLDEPVSSSPLNVDIANI 134
           CLD++    WSP +DLL++++  I  LL EP  S PLN + A +
Sbjct: 73  CLDVINSA-WSPLYDLLNILEWMIPGLLKEPNGSDPLNNEAATL 115

>ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 aa]
           {ON} highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1 6-
           bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 209

 Score = 74.3 bits (181), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/120 (36%), Positives = 63/120 (52%), Gaps = 4/120 (3%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +++  +     GP  TPYE   +RLH+ LP  YP   P + F    + H N+D  +G IC
Sbjct: 29  DNMQEFHVKFHGPKDTPYETGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSIC 87

Query: 93  LDILTKQHWSPAWDLLHVVQ-AIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
           LD++    WSP +DL ++V+  I  LL EP  S PLN + A  L+  D   Y   +  YI
Sbjct: 88  LDVINST-WSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYI 145

>ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR177W
           (UBC1)
          Length = 211

 Score = 73.9 bits (180), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 65/132 (49%), Gaps = 5/132 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSRA +  K I  V  + D   S   V    + D+   +    GP GTPY G  F + + 
Sbjct: 1   MSRAKRLMKEIQSVKDDPDANISLAFVS---ESDIHHLKGTFLGPPGTPYHGGTFIVDIQ 57

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P EYP  PP ++F+     H N+   TG ICLDIL K  WSP   L   + ++  LL  
Sbjct: 58  VPLEYPFKPPKMQFDTKVY-HPNISSVTGAICLDIL-KNSWSPVLTLKTSLISLQALLQS 115

Query: 121 PVSSSPLNVDIA 132
           P  + P + ++A
Sbjct: 116 PEPNDPQDAEVA 127

>KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 72.4 bits (176), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 58/106 (54%), Gaps = 3/106 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +DL  W+A I GP  +PY G  F L +  P +YP  PP + F    + H N++   G IC
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNIC 85

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           LDIL K  WSPA  +  V+ +I  LL +     PL  +IA+I K +
Sbjct: 86  LDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTD 130

>SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444
           bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 72.4 bits (176), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 58/106 (54%), Gaps = 3/106 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +DL  W+A I GP  +PY G  F L +  P +YP  PP + F    + H N++   G IC
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNIC 85

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           LDIL K  WSPA  +  V+ +I  LL +     PL  +IA+I K +
Sbjct: 86  LDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTD 130

>AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR082C
           (UBC4) and YDR059C (UBC5)
          Length = 147

 Score = 72.4 bits (176), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 58/106 (54%), Gaps = 3/106 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +DL  W+A I GP  +PY G  F L +  P +YP  PP + F    + H N++   G IC
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNIC 85

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           LDIL K  WSPA  +  V+ +I  LL +     PL  +IA+I K +
Sbjct: 86  LDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTD 130

>Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to
           Ashbya gossypii ADR169C
          Length = 211

 Score = 73.9 bits (180), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 65/132 (49%), Gaps = 5/132 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSRA +  K I  V  + D   S   V    + D+   +    GP GTPY G  F + + 
Sbjct: 1   MSRAKRLMKEIQSVKDDPDANISLSFVS---ESDIHHLKGTFLGPPGTPYHGGKFVVDIQ 57

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P EYP  PP ++F+     H N+   TG ICLDIL K  WSP   L   + ++  LL  
Sbjct: 58  VPLEYPFKPPKMQFDTKVY-HPNISSVTGAICLDIL-KNSWSPVLTLKTSLISLQALLQS 115

Query: 121 PVSSSPLNVDIA 132
           P  + P + ++A
Sbjct: 116 PEPNDPQDAEVA 127

>ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 218

 Score = 73.9 bits (180), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 67/133 (50%), Gaps = 5/133 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSRA +  K +  V    D+  + + +    + D+ R +    GP  TPY+G  F + + 
Sbjct: 1   MSRAKRLMKELQAV---RDDPAANITLEFISESDIHRLKGSFLGPPETPYQGGRFIIDIE 57

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P EYP  PP +KF+     H N+   TG ICLDIL K  WSP   L   + ++  LL  
Sbjct: 58  VPMEYPFKPPKMKFDTKVY-HPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALLQS 115

Query: 121 PVSSSPLNVDIAN 133
           P  + P + ++A 
Sbjct: 116 PEPNDPQDAEVAQ 128

>TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 bp,
           219 aa] {ON} Anc_1.436 YEL012W
          Length = 219

 Score = 73.9 bits (180), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 60/109 (55%), Gaps = 4/109 (3%)

Query: 44  GPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSP 103
           GP  TPYE   +RLH+ LP  YP   P + F    + H N+D  +G ICLD++    WSP
Sbjct: 38  GPDETPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVINST-WSP 95

Query: 104 AWDLLHVVQ-AIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151
            +DL+++V+  I  LL EP  + PLN + A  L+  D   Y   +  YI
Sbjct: 96  LYDLINIVEWMIPGLLKEPNGTDPLNNEAAG-LQLRDKKLYEEKIKEYI 143

>Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON}
           similar to Ashbya gossypii AER173C
          Length = 147

 Score = 72.4 bits (176), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 58/106 (54%), Gaps = 3/106 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +DL  W+A I GP  +PY G  F L +  P +YP  PP + F    + H N++   G IC
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNIC 85

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           LDIL K  WSPA  +  V+ +I  LL +     PL  +IA+I K +
Sbjct: 86  LDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTD 130

>SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {ON}
           highly similar to gnl|GLV|KLLA0A11198g Kluyveromyces
           lactis KLLA0A11198g and similar to YEL012W
           uniprot|P28263 Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin- conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6-bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 207

 Score = 73.2 bits (178), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 57/105 (54%), Gaps = 3/105 (2%)

Query: 35  LTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLD 94
           +  +     GP  TPYE   +RLH+ LP  YP   P + F    + H N+D  +G ICLD
Sbjct: 17  MQEFHVKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSICLD 75

Query: 95  ILTKQHWSPAWDLLHVVQ-AIGQLLDEPVSSSPLNVDIANILKAN 138
           ++    WSP +DL+++V+  I  LL EP  S PLN + A +   N
Sbjct: 76  VINST-WSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLKN 119

>KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 228

 Score = 73.6 bits (179), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 69/132 (52%), Gaps = 5/132 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           M R+ +  K I  V KE  E  +Q+ +    + D+   +    GPSGTPYEG  F + ++
Sbjct: 1   MLRSKRILKEIQAV-KEDPE--AQIELKFVNESDIHHMKGSFIGPSGTPYEGGKFVVDIN 57

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P EYP  PP +KF+     H NV   TG ICLDIL K  W+P   L   + ++  LL  
Sbjct: 58  IPVEYPYKPPQMKFDTKVY-HPNVSSVTGAICLDIL-KNAWTPVITLKSALISLQALLQS 115

Query: 121 PVSSSPLNVDIA 132
           P  + P +  +A
Sbjct: 116 PEPNDPQDAQVA 127

>TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.375
           YDR177W
          Length = 217

 Score = 73.2 bits (178), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 68/133 (51%), Gaps = 5/133 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSRA +  K +  V    D+  +++ +    + D+   +    GP GTPY+G  F + + 
Sbjct: 1   MSRAKRIMKEMQAV---KDDPAAKINLEFVTESDIHHLKGSFLGPPGTPYDGGLFIVDIE 57

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P EYP  PP +KF+     H NV   TG ICLDIL K  WSP   L   + ++  LL  
Sbjct: 58  VPMEYPFKPPKMKFDTKVY-HPNVSSVTGAICLDIL-KNAWSPVITLKSALISLQALLQS 115

Query: 121 PVSSSPLNVDIAN 133
           P  + P + ++A 
Sbjct: 116 PEPNDPQDAEVAQ 128

>TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 bp,
           148 aa] {ON} 
          Length = 148

 Score = 71.2 bits (173), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 58/106 (54%), Gaps = 3/106 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +D+  W+A I GP  +PY G  F L +  P +YP  PP + F    + H N++   G IC
Sbjct: 29  DDIYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNIC 86

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           LDIL K  WSPA  +  V+ +I  LL +     PL  +IA+I K +
Sbjct: 87  LDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTD 131

>KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 215

 Score = 72.8 bits (177), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 68/132 (51%), Gaps = 5/132 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSRA +  K +  +    D+  +++ + +  + D+   +    GP GTPYE   F + + 
Sbjct: 1   MSRAKRVMKELQAI---KDDPEAKVDLQLVNENDIHLLKGSFLGPPGTPYENGKFIVDIE 57

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P EYP  PP +KF+     H NV   TG ICLDIL K  WSP   L   + ++  LL  
Sbjct: 58  VPMEYPFKPPKMKFDTKVY-HPNVSSVTGAICLDIL-KNAWSPVITLKSALISLQALLQS 115

Query: 121 PVSSSPLNVDIA 132
           P  + P + ++A
Sbjct: 116 PEPNDPQDAEVA 127

>TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa]
           {ON} 
          Length = 147

 Score = 71.2 bits (173), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 58/106 (54%), Gaps = 3/106 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +D+  W+A I GP  +PY G  F L +  P +YP  PP + F    + H N++   G IC
Sbjct: 28  DDIYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKIAFT-TKIYHPNIN-ANGNIC 85

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           LDIL K  WSPA  +  V+ +I  LL +     PL  +IA+I K +
Sbjct: 86  LDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTD 130

>TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON}
           Anc_2.569 YMR022W
          Length = 165

 Score = 71.6 bits (174), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 72/146 (49%), Gaps = 23/146 (15%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQ----LIVGMEPKEDLTRWEALIRGPSGTPYEGCNFR 56
           MSR A++     ++LKE  ++       +I   + + DL  W+ L+ GP  TPY G  F 
Sbjct: 1   MSRTAQK-----RLLKELQQLTRDPPPGIIAAPKTESDLFTWDCLVAGPPDTPYAGGLFN 55

Query: 57  LHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDI------------LTKQHWSPA 104
             L  P +YP+SPP + F P  + H NV +  GE+C+ I            L ++ WSP 
Sbjct: 56  CQLQFPTDYPLSPPTLTFTPSIL-HPNV-YPNGEVCISILHAPGSDPNMYELPEERWSPV 113

Query: 105 WDLLHVVQAIGQLLDEPVSSSPLNVD 130
             +  ++ ++  +L EP   S  N+D
Sbjct: 114 QSVEKILLSVVSMLSEPNVESGANID 139

>KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8.375
           YDR177W
          Length = 213

 Score = 72.4 bits (176), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 67/132 (50%), Gaps = 5/132 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSRA +  K +  V    D+  +++ +    + D+   +    GP GTPYE   F + + 
Sbjct: 1   MSRAKRIMKELQAV---KDDPEAKITLEFVIESDIHHLKGSFIGPPGTPYENGAFVVDIE 57

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P EYP  PP +KF+     H N+   TG ICLDIL K  WSP   L   + ++  LL  
Sbjct: 58  VPMEYPFKPPQMKFDTKVY-HPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALLQS 115

Query: 121 PVSSSPLNVDIA 132
           P  + P + ++A
Sbjct: 116 PEPNDPQDAEVA 127

>Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa]
           {ON} YBR082C (UBC4) - 1:1 [contig 457] FULL
          Length = 236

 Score = 72.8 bits (177), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 58/106 (54%), Gaps = 3/106 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +DL  W+A I GP  +PY G  F L +  P +YP  PP + F    + H N++   G IC
Sbjct: 117 DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNIC 174

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           LDIL K  WSPA  +  V+ +I  LL +     PL  +IA+I K +
Sbjct: 175 LDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTD 219

>TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.569
           YMR022W
          Length = 167

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 72/148 (48%), Gaps = 20/148 (13%)

Query: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLP 62
           R  KEY+ + +    G      ++ G   + ++  W+ LI GP  TPYE   F   L  P
Sbjct: 10  RLLKEYQQLIRESPPG------IVAGPSDENNMFEWDCLISGPPETPYENGVFNATLLFP 63

Query: 63  QEYPMSPPYVKFEPYAMPHANVDFRTGEICLDI------------LTKQHWSPAWDLLHV 110
           ++YP+SPP + F P  + H N+ +  GE+C+ I            L ++ WSP   +  +
Sbjct: 64  KDYPLSPPKLTFTPSLL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 121

Query: 111 VQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + ++  +L EP   S  N+D + + + N
Sbjct: 122 LLSVMSMLSEPNIESGANIDASILYRDN 149

>ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 70.9 bits (172), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 58/106 (54%), Gaps = 3/106 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +D+  W+A I GP  +PY G  F L +  P +YP  PP + F    + H N++   G IC
Sbjct: 28  DDVYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKIAFT-TKIYHPNIN-ANGNIC 85

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           LDIL K  WSPA  +  V+ +I  LL +     PL  +IA+I K +
Sbjct: 86  LDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTD 130

>TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa]
           {ON} Anc_3.308 YBR082C
          Length = 148

 Score = 70.5 bits (171), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 58/106 (54%), Gaps = 3/106 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +D+  W+A I GP  +PY G  F L +  P +YP  PP + F    + H N++   G IC
Sbjct: 29  DDIYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNIC 86

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           LDIL K  WSPA  +  V+ +I  LL +     PL  +IA++ K +
Sbjct: 87  LDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHLYKTD 131

>Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON}
           (6121..6167,6406..6805) [447 nt, 149 aa]
          Length = 148

 Score = 70.1 bits (170), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 58/106 (54%), Gaps = 3/106 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +D+  W+A I GP  +PY G  F L +  P +YP  PP + F    + H N++   G IC
Sbjct: 29  DDVYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNIC 86

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           LDIL K  WSPA  +  V+ +I  LL +     PL  +IA++ K +
Sbjct: 87  LDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHLYKTD 131

>Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 70.1 bits (170), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 57/106 (53%), Gaps = 3/106 (2%)

Query: 22  YSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPH 81
           Y++ +   +   DL +WEA I G  GT + G  + + +  P EYP  PP VKF P    H
Sbjct: 25  YAKPVKKSDGSMDLQKWEAGIPGKEGTNWAGGVYPISVEYPNEYPSKPPKVKF-PAGFYH 83

Query: 82  ANVDFRTGEICLDILTK-QHWSPAWDLLHVVQAIGQLLDEPVSSSP 126
            NV + +G ICL IL + Q W PA  L  +V  +  LLD P  +SP
Sbjct: 84  PNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 148
           aa] {ON} highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082C UBC4 Ubiquitin-conjugating enzyme
           that mediates degradation of short-lived and abnormal
           proteins interacts with E3-CaM in ubiquitinating
           calmodulin interacts with many SCF ubiquitin protein
           ligases component of the cellular stress response
          Length = 148

 Score = 70.1 bits (170), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 58/106 (54%), Gaps = 3/106 (2%)

Query: 33  EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEIC 92
           +D+  W+A I GP  +PY G  F L +  P +YP  PP + F    + H N++   G IC
Sbjct: 29  DDVYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNIC 86

Query: 93  LDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           LDIL K  WSPA  +  V+ +I  LL +     PL  +IA++ K +
Sbjct: 87  LDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHLYKTD 131

>YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {ON} 
           UBC9SUMO-conjugating enzyme involved in the Smt3p
           conjugation pathway; nuclear protein required for S- and
           M-phase cyclin degradation and mitotic control; involved
           in proteolysis mediated by the anaphase-promoting
           complex cyclosome (APCC)
          Length = 157

 Score = 70.1 bits (170), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 57/106 (53%), Gaps = 3/106 (2%)

Query: 22  YSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPH 81
           Y++ +   +   DL +WEA I G  GT + G  + + +  P EYP  PP VKF P    H
Sbjct: 25  YAKPVKKADGSMDLQKWEAGIPGKEGTNWAGGVYPITVEYPNEYPSKPPKVKF-PAGFYH 83

Query: 82  ANVDFRTGEICLDILTK-QHWSPAWDLLHVVQAIGQLLDEPVSSSP 126
            NV + +G ICL IL + Q W PA  L  +V  +  LLD P  +SP
Sbjct: 84  PNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177W
           (UBC1) - ubiquitin-conjugating enzyme [contig 18] FULL
          Length = 215

 Score = 71.2 bits (173), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 68/132 (51%), Gaps = 5/132 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSRA +  K +  +    D+  +++ + +  + D+   +    GP GTPYE   + + + 
Sbjct: 1   MSRAKRVMKELQAI---KDDPEARVDLQLVNENDIHLLKGSFLGPPGTPYENGKYIVDIE 57

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P EYP  PP +KF+     H NV   TG ICLDIL K  WSP   L   + ++  LL  
Sbjct: 58  VPMEYPFKPPKMKFQTKVY-HPNVSSVTGAICLDIL-KNAWSPVITLKSALISLQALLQS 115

Query: 121 PVSSSPLNVDIA 132
           P  + P + ++A
Sbjct: 116 PEPNDPQDAEVA 127

>Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 69.7 bits (169), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 57/106 (53%), Gaps = 3/106 (2%)

Query: 22  YSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPH 81
           Y++ +   +   DL +WEA I G  GT + G  + + +  P EYP  PP VKF P    H
Sbjct: 25  YAKPVKKADGSMDLQKWEAGIPGREGTNWAGGVYPITVEYPNEYPSKPPKVKF-PAGFYH 83

Query: 82  ANVDFRTGEICLDILTK-QHWSPAWDLLHVVQAIGQLLDEPVSSSP 126
            NV + +G ICL IL + Q W PA  L  +V  +  LLD P  +SP
Sbjct: 84  PNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.375
           YDR177W
          Length = 216

 Score = 70.9 bits (172), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 66/132 (50%), Gaps = 5/132 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSRA +  K +  V    D+  + + +    + D+   +    GP  TPYEG  F + + 
Sbjct: 1   MSRAKRIMKEMEAVR---DDPEANIDLEFVSEADIHHLKGSFLGPPETPYEGGKFIVDIE 57

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P EYP  PP +KF+     H N+   TG ICLDIL K  WSP   L   + ++  LL  
Sbjct: 58  VPMEYPFKPPKMKFDTKVY-HPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALLQS 115

Query: 121 PVSSSPLNVDIA 132
           P  + P + ++A
Sbjct: 116 PEPNDPQDAEVA 127

>NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON}
           Anc_2.569
          Length = 165

 Score = 69.7 bits (169), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 71/148 (47%), Gaps = 20/148 (13%)

Query: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLP 62
           R  KE + + K    G      ++ G   + +L  W+ L++GP  T YEG  F   L  P
Sbjct: 8   RLLKELQQLNKDSPPG------IVAGPANENNLFVWDCLVQGPPDTAYEGGIFNARLDFP 61

Query: 63  QEYPMSPPYVKFEPYAMPHANVDFRTGEICLDI------------LTKQHWSPAWDLLHV 110
           ++YP+SPP + F P  + H N+ +  GE+C+ I            L ++ WSP   +  +
Sbjct: 62  KDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 111 VQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + ++  +L EP   S  N+D   + + N
Sbjct: 120 LLSVMSMLSEPNIESGANIDACILWRDN 147

>Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON}
           complement(21147..21794) [648 nt, 216 aa]
          Length = 215

 Score = 70.5 bits (171), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 66/132 (50%), Gaps = 5/132 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSRA +  K +  V    D+  + + +    + D+   +    GP  TPY+G  F + + 
Sbjct: 1   MSRAKRIMKEMQAV---KDDPAANINLEFVSESDIHHLKGSFLGPPETPYQGGRFIVDIE 57

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P EYP  PP +KF+     H N+   TG ICLDIL K  WSP   L   + ++  LL  
Sbjct: 58  VPMEYPFKPPKMKFDTKVY-HPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALLQS 115

Query: 121 PVSSSPLNVDIA 132
           P  + P + ++A
Sbjct: 116 PEPNDPQDAEVA 127

>KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON}
           Anc_8.375 YDR177W
          Length = 214

 Score = 70.1 bits (170), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 66/132 (50%), Gaps = 5/132 (3%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           MSRA +  K +  V    D+  + + +    + D+   +   +GP  TPY+   F + + 
Sbjct: 1   MSRAKRIMKEMQAV---KDDPEAHITLEFVNESDIHHLKGTFQGPPETPYDRGQFVVDIE 57

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120
           +P EYP  PP +KF+     H NV   TG ICLDIL K  WSP   L   + ++  LL  
Sbjct: 58  VPMEYPFKPPKMKFDTKVY-HPNVSSVTGAICLDIL-KNAWSPVITLKSALISLQALLQS 115

Query: 121 PVSSSPLNVDIA 132
           P  + P + ++A
Sbjct: 116 PEPNDPQDAEVA 127

>NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2.569
          Length = 165

 Score = 68.6 bits (166), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 72/148 (48%), Gaps = 20/148 (13%)

Query: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLP 62
           R  KE + +TK    G      ++   + + +L  W+ L++GP  T YEG  F   L  P
Sbjct: 8   RLLKELQQLTKDSPPG------IVACPKNENNLFIWDCLVQGPPDTAYEGGIFNARLEFP 61

Query: 63  QEYPMSPPYVKFEPYAMPHANVDFRTGEICLDI------------LTKQHWSPAWDLLHV 110
           ++YP+SPP + F P  + H N+ +  GE+C+ I            L ++ WSP   +  +
Sbjct: 62  KDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSIEKI 119

Query: 111 VQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + ++  +L EP   S  N+D   + + N
Sbjct: 120 LLSVMSMLSEPNIESGANIDACILWRDN 147

>Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 68.6 bits (166), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 77/154 (50%), Gaps = 23/154 (14%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQ----LIVGMEPKEDLTRWEALIRGPSGTPYEGCNFR 56
           MS+ A++     ++LKE  ++       ++ G + + ++  W+ LI+GP  TPY    F 
Sbjct: 1   MSKTAQK-----RLLKELQQLIKDSPPGIVAGPKSENNIFVWDCLIQGPPDTPYADGVFN 55

Query: 57  LHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDI------------LTKQHWSPA 104
             L  P++YP+SPP + F P  + H N+ +  GE+C+ I            L ++ WSP 
Sbjct: 56  TKLEFPKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPV 113

Query: 105 WDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
             +  ++ ++  +L EP   S  N+D   + + N
Sbjct: 114 QSVEKILLSVMSMLSEPNIESGANIDACILWRDN 147

>Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 68.2 bits (165), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 77/154 (50%), Gaps = 23/154 (14%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQ----LIVGMEPKEDLTRWEALIRGPSGTPYEGCNFR 56
           MS+ A++     ++LKE  ++       ++ G + + ++  W+ LI+GP  TPY    F 
Sbjct: 1   MSKTAQK-----RLLKELQQLIKDSPPGIVAGPKSENNIFVWDCLIQGPPDTPYADGVFN 55

Query: 57  LHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDI------------LTKQHWSPA 104
             L  P++YP+SPP + F P  + H N+ +  GE+C+ I            L ++ WSP 
Sbjct: 56  AKLEFPKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPV 113

Query: 105 WDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
             +  ++ ++  +L EP   S  N+D   + + N
Sbjct: 114 QSVEKILLSVMSMLSEPNIESGANIDACILWRDN 147

>Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 68.2 bits (165), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 77/154 (50%), Gaps = 23/154 (14%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQ----LIVGMEPKEDLTRWEALIRGPSGTPYEGCNFR 56
           MS+ A++     ++LKE  ++       ++ G + + ++  W+ LI+GP  TPY    F 
Sbjct: 1   MSKTAQK-----RLLKELQQLIKDSPPGIVAGPKSENNIFVWDCLIQGPPDTPYADGIFN 55

Query: 57  LHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDI------------LTKQHWSPA 104
             L  P++YP+SPP + F P  + H N+ +  GE+C+ I            L ++ WSP 
Sbjct: 56  AKLEFPKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPV 113

Query: 105 WDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
             +  ++ ++  +L EP   S  N+D   + + N
Sbjct: 114 QSVEKILLSVMSMLSEPNIESGANIDACILWRDN 147

>YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiquitin
           conjugating enzyme, involved in the ER-associated
           protein degradation pathway; requires Cue1p for
           recruitment to the ER membrane; proposed to be involved
           in chromatin assembly
          Length = 165

 Score = 68.2 bits (165), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 77/154 (50%), Gaps = 23/154 (14%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQ----LIVGMEPKEDLTRWEALIRGPSGTPYEGCNFR 56
           MS+ A++     ++LKE  ++       ++ G + + ++  W+ LI+GP  TPY    F 
Sbjct: 1   MSKTAQK-----RLLKELQQLIKDSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFN 55

Query: 57  LHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDI------------LTKQHWSPA 104
             L  P++YP+SPP + F P  + H N+ +  GE+C+ I            L ++ WSP 
Sbjct: 56  AKLEFPKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPV 113

Query: 105 WDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
             +  ++ ++  +L EP   S  N+D   + + N
Sbjct: 114 QSVEKILLSVMSMLSEPNIESGANIDACILWRDN 147

>Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 67.8 bits (164), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 56/106 (52%), Gaps = 3/106 (2%)

Query: 22  YSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPH 81
           Y++ +   +   DL +WEA I G   T + G  + + +  P EYP  PP VKF P    H
Sbjct: 25  YAKPVKKADGSMDLQKWEAGIPGKDATNWAGGVYPITVEYPNEYPSKPPKVKF-PAGFYH 83

Query: 82  ANVDFRTGEICLDILTK-QHWSPAWDLLHVVQAIGQLLDEPVSSSP 126
            NV + +G ICL IL + Q W PA  L  +V  +  LLD P  +SP
Sbjct: 84  PNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
           involved in the ER-associated protein degradation
           pathway requires Cue1p for recruitment to the ER
           membrane proposed to be involved in chromatin assembly
          Length = 165

 Score = 67.0 bits (162), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 71/148 (47%), Gaps = 20/148 (13%)

Query: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLP 62
           R  KE + +TK   EG      ++       +L +W+ LI GP  + YEG  F   L  P
Sbjct: 8   RLLKELEKLTKDSPEG------ILASPIDDSNLFQWDCLIMGPPDSCYEGGVFNARLDFP 61

Query: 63  QEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTK------------QHWSPAWDLLHV 110
           ++YP++PP + F+P  + H N+ +  GE+C+ IL              + WSP   +  +
Sbjct: 62  KDYPLNPPKLTFQPSIL-HPNI-YPNGEVCISILHSPGSDPNMYEHECERWSPVQSVEMI 119

Query: 111 VQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + ++  +L EP   S  N+D   + + N
Sbjct: 120 LLSVMSILSEPNIESGANIDACILWRDN 147

>CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064w UBC9 E2 ubiquitin-conjugating enzyme
          Length = 157

 Score = 66.6 bits (161), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 57/106 (53%), Gaps = 3/106 (2%)

Query: 22  YSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPH 81
           Y++   G +   +L +WEA I G  GT ++   F + +  P EYP  PP VKF P    H
Sbjct: 25  YAKPTKGPDGTLNLQKWEAGIPGKEGTIWQDGVFPITVEYPDEYPSKPPKVKF-PAGFYH 83

Query: 82  ANVDFRTGEICLDILTK-QHWSPAWDLLHVVQAIGQLLDEPVSSSP 126
            N+ + +G +CL IL + Q W PA  L  +V  +  LLD P  +SP
Sbjct: 84  PNI-YPSGTVCLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON}
           complement(45694..46062) [369 nt, 123 aa]
          Length = 122

 Score = 65.1 bits (157), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 51/94 (54%), Gaps = 3/94 (3%)

Query: 34  DLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICL 93
           DL RWEA I G +GT +    + + +  P EYP  PP V F P    H NV + +G ICL
Sbjct: 2   DLQRWEAGIPGRTGTLWAEGVYPITIEYPDEYPSKPPKVMF-PKGFYHPNV-YPSGTICL 59

Query: 94  DILT-KQHWSPAWDLLHVVQAIGQLLDEPVSSSP 126
            IL  +Q W PA  L  +V  +  LLD P  +SP
Sbjct: 60  SILNEEQDWRPAITLKQIVLGVQDLLDSPNPNSP 93

>TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 65.5 bits (158), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 51/94 (54%), Gaps = 3/94 (3%)

Query: 34  DLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICL 93
           DL  WEA I G +GT +    + + +  P EYP  PP VKF P    H N+ + +G +CL
Sbjct: 37  DLQHWEAGIPGKAGTLWADAVYPISIEYPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 94

Query: 94  DILTK-QHWSPAWDLLHVVQAIGQLLDEPVSSSP 126
            IL + Q W PA  L  +V  +  LLD P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W
           (UBC9) - ubiquitin-conjugating enzyme [contig 1] FULL
          Length = 122

 Score = 63.2 bits (152), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 3/94 (3%)

Query: 34  DLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICL 93
           +L +WEA I G  GT ++   F + +  P +YP  PP VKF P    H N+ + +G +CL
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 59

Query: 94  DILTK-QHWSPAWDLLHVVQAIGQLLDEPVSSSP 126
            IL + Q W PA  L  +   +  LLD P  +SP
Sbjct: 60  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 93

>KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.301
           YDR054C
          Length = 110

 Score = 62.8 bits (151), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 51/95 (53%), Gaps = 3/95 (3%)

Query: 44  GPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSP 103
           GP  +PY G  F L +  P +YP  PP + F    + H N++   G ICLDIL K  WSP
Sbjct: 2   GPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDIL-KDQWSP 58

Query: 104 AWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           A  L  V+ +I  LL +     PL  +IA+I K +
Sbjct: 59  ALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTD 93

>KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 63.9 bits (154), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 34  DLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICL 93
           DL RWEA I G  GT +    + L +  P EYP  PP VK  P    H NV + +G ICL
Sbjct: 37  DLQRWEAGIPGKQGTLWADGLYPLTIEYPDEYPSKPPKVKL-PANFYHPNV-YPSGTICL 94

Query: 94  DILTK-QHWSPAWDLLHVVQAIGQLLDEPVSSSP 126
            IL + Q W PA  L  +   I  LLD P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413)
           [474 bp, 157 aa] {ON} highly similar to uniprot|P50623
           Saccharomyces cerevisiae YDL064W UBC9 SUMO-conjugating
           enzyme involved in the Smt3p conjugation pathway nuclear
           protein required for S- and M-phase cyclin degradation
           and mitotic control involved in proteolysis mediated by
           the anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 63.2 bits (152), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 3/94 (3%)

Query: 34  DLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICL 93
           +L +WEA I G  GT ++   F + +  P +YP  PP VKF P    H N+ + +G +CL
Sbjct: 37  NLQKWEAGIPGKEGTIWKDGVFPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 94

Query: 94  DILTK-QHWSPAWDLLHVVQAIGQLLDEPVSSSP 126
            IL + Q W PA  L  +   +  LLD P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 128

>ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 63.2 bits (152), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 3/94 (3%)

Query: 34  DLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICL 93
           +L +WEA I G  GT ++   + + +  P EYP  PP VKF P    H N+ + +G +CL
Sbjct: 37  NLQKWEAGIPGKEGTIWQDGVYPITIEYPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 94

Query: 94  DILTK-QHWSPAWDLLHVVQAIGQLLDEPVSSSP 126
            IL + Q W PA  L  +   +  LLD P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 128

>KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 62.8 bits (151), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 34  DLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICL 93
           +L RWEA I G  GT +    + L +  P EYP  PP VK  P    H NV + +G ICL
Sbjct: 37  NLQRWEAGIPGKEGTLWHEGVYPLTIEYPDEYPSKPPKVKL-PAGFYHPNV-YPSGTICL 94

Query: 94  DILTK-QHWSPAWDLLHVVQAIGQLLDEPVSSSP 126
            IL + Q W PA  L  +   I  LLD P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064W UBC9 SUMO-conjugating enzyme involved in the
           Smt3p conjugation pathway nuclear protein required for
           S- and M-phase cyclin degradation and mitotic control
           involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 62.4 bits (150), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 52/94 (55%), Gaps = 3/94 (3%)

Query: 34  DLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICL 93
           +L +WEA I G  GT ++   + L +  P +YP  PP VKF P    H NV + +G ICL
Sbjct: 37  NLQKWEAGIPGRDGTLWKNGLYPLTIEYPDDYPSKPPKVKF-PAGFYHPNV-YPSGTICL 94

Query: 94  DILTK-QHWSPAWDLLHVVQAIGQLLDEPVSSSP 126
            IL + Q W PA  L  ++  +  LLD P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQLLLGVQDLLDSPNPNSP 128

>TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 62.4 bits (150), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 52/94 (55%), Gaps = 3/94 (3%)

Query: 34  DLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICL 93
           +L +WEA I G  GT ++   + + +  P EYP  PP V+F P    H N+ + +G +CL
Sbjct: 37  NLQKWEAGIPGREGTLWDHGVYPISIEYPDEYPSKPPKVRF-PAGFYHPNI-YPSGTVCL 94

Query: 94  DILTK-QHWSPAWDLLHVVQAIGQLLDEPVSSSP 126
            IL + Q W PA  L  +V  +  LLD P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIVIGVQDLLDTPNPNSP 128

>TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 62.4 bits (150), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 50/94 (53%), Gaps = 3/94 (3%)

Query: 34  DLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICL 93
           +L  WEA I G   T + G  + + +  P EYP  PP VKF P    H N+ + +G +CL
Sbjct: 37  NLQLWEAGIPGKESTIWHGALYPITIEYPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 94

Query: 94  DILTK-QHWSPAWDLLHVVQAIGQLLDEPVSSSP 126
            IL + Q W PA  L  +V  +  LLD P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDTPNPNSP 128

>NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49
          Length = 193

 Score = 62.0 bits (149), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 56/108 (51%), Gaps = 4/108 (3%)

Query: 41  LIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQH 100
           +I  P    Y+  +FR  L     YPM PP V      + H N+D + G++CL+IL ++ 
Sbjct: 73  VIISPDEGYYKNGHFRFSLEFNDNYPMEPPKVVCR-NRIYHPNIDVQ-GKVCLNIL-RED 129

Query: 101 WSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVH 148
           WSPA DL  ++  +  L  EP +  PLN D A +  + D NA+   V 
Sbjct: 130 WSPALDLQSIIVGLLFLFLEPNAKDPLNTDAAAVF-SKDSNAFAKFVR 176

>NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 157
           aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 60.8 bits (146), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 34  DLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICL 93
           +L +WEA I G  GT +    + + +  P EYP  PP VK  P    H NV + +G ICL
Sbjct: 37  NLQKWEAGIPGKEGTLWAEGVYPITIEYPNEYPSKPPKVKL-PAGFYHPNV-YPSGTICL 94

Query: 94  DILT-KQHWSPAWDLLHVVQAIGQLLDEPVSSSP 126
            IL  +Q W PA  L  +   I  LLD P  +SP
Sbjct: 95  SILNEEQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, 193
           aa] {ON} Anc_4.49 YLR306W
          Length = 193

 Score = 61.2 bits (147), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 56/109 (51%), Gaps = 4/109 (3%)

Query: 40  ALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQ 99
            L   P   PY G  F+ +L   + YP+ PP        + H N+D   G+ICL+IL ++
Sbjct: 72  TLCISPREGPYLGGAFKFNLKFNEMYPIEPPSA-ICLNKIFHPNIDL-NGKICLNIL-RE 128

Query: 100 HWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVH 148
            WSPA DL  +V  +  L  +  S+ PLN   A +L AND N +  LV 
Sbjct: 129 DWSPALDLTSIVIGLLYLFLDFTSTDPLNQQAAEVL-ANDRNRFCELVQ 176

>SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 60.5 bits (145), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 3/94 (3%)

Query: 34  DLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICL 93
           +L +WEA I G  GT ++   + + +  P +YP  PP VKF P    H N+ + +G +CL
Sbjct: 37  NLQKWEAGIPGKEGTIWKEGVYPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 94

Query: 94  DILTK-QHWSPAWDLLHVVQAIGQLLDEPVSSSP 126
            IL + Q W PA  L  +V  +  LL+ P   SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLNSPNPDSP 128

>NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 60.1 bits (144), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 34  DLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICL 93
           +L +WEA I G  GT +    + + +  P EYP  PP VK  P    H NV + +G ICL
Sbjct: 37  NLQKWEAGIPGKEGTIWAEGVYPITIEYPNEYPSKPPKVKL-PANFYHPNV-YPSGTICL 94

Query: 94  DILTK-QHWSPAWDLLHVVQAIGQLLDEPVSSSP 126
            IL + Q W PA  L  +   I  LLD P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar to
           uniprot|P14682 Saccharomyces cerevisiae YDR054C CDC34
           Ubiquitin-conjugating enzyme or E2 together with Skp1p
           Rbx1p Cdc53p and an F-box protein forms a
           ubiquitin-protein ligase called the SCF complex which
           regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 292

 Score = 61.2 bits (147), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 13/100 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDIL-----------TK 98
           Y G  F+  +  P ++P SPP  +F P A+ H NV +R G +C+ IL            +
Sbjct: 54  YHGGYFKAQMKFPDDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHQSGNPTSDEPDE 111

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + WSP   +  V+ +I  LL++P  SSP NVD A   K N
Sbjct: 112 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYKKN 151

>NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3.301
           YDR054C
          Length = 273

 Score = 60.5 bits (145), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 13/100 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTK----------- 98
           Y G  F+  +  P+++P SPP  +F P A+ H NV +R G +C+ IL +           
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQGGDPMTDEPDA 112

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + WSP   +  V+ +I  LL++P  SSP NVD A   + N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {ON}
           Anc_3.301
          Length = 273

 Score = 60.5 bits (145), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 13/100 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTK----------- 98
           Y G  F+  +  P+++P SPP  +F P A+ H NV +R G +C+ IL +           
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQGGDPMTDEPDA 112

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + WSP   +  V+ +I  LL++P  SSP NVD A   + N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.301
           YDR054C
          Length = 289

 Score = 60.5 bits (145), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 13/100 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTK----------- 98
           Y G  F+  +  P+++P SPP  +F P A+ H NV +R G +C+ IL +           
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + WSP   +  V+ +I  LL++P  SSP NVD A   + N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly
           similar to uniprot|P14682 Saccharomyces cerevisiae
           YDR054C CDC34 Ubiquitin-conjugating enzyme or E2
           together with Skp1p Rbx1p Cdc53p and an F-box protein
           forms a ubiquitin-protein ligase called the SCF complex
           which regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 275

 Score = 60.1 bits (144), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 52/100 (52%), Gaps = 13/100 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDIL-----------TK 98
           Y G  F+  +  P+++P SPP  +F P A+ H NV +R G +C+ IL             
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHTSGDPTSEEPDS 112

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + WSP   +  V+ +I  LL++P  SSP NVD A   + N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C
           (CDC34) - ubiquitin-conjugating enzyme, E2 [contig 36]
           FULL
          Length = 278

 Score = 60.1 bits (144), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 52/100 (52%), Gaps = 13/100 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDIL-----------TK 98
           Y G  F+  +  P+++P SPP  +F P A+ H NV +R G +C+ IL             
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHTSGDPTSEEPDS 112

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + WSP   +  V+ +I  LL++P  SSP NVD A   + N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa]
           {ON} highly similar to uniprot|Q750Z0 Ashbya gossypii
           AGL203C AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 285

 Score = 60.1 bits (144), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 13/100 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTK----------- 98
           Y G  F+  +  P+++P SPP  +F P A+ H NV +R G +C+ IL +           
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + WSP   +  V+ +I  LL++P  SSP NVD A   + N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating enzyme
          Length = 295

 Score = 60.1 bits (144), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 52/100 (52%), Gaps = 13/100 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTK----------- 98
           Y G  F+  +  P ++P SPP  +F P A+ H NV +R G +C+ IL +           
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + WSP   +  V+ +I  LL++P  SSP NVD A   + N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDFRKN 152

>Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa]
           {ON} similar to Ashbya gossypii AER056C
          Length = 157

 Score = 58.5 bits (140), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 3/94 (3%)

Query: 34  DLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICL 93
           +L +WEA I G  GT ++   + + +  P +YP  PP VKF P    H N+ + +G +CL
Sbjct: 37  NLQKWEAGIPGREGTIWKDAVYPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 94

Query: 94  DILTK-QHWSPAWDLLHVVQAIGQLLDEPVSSSP 126
            IL + Q W PA  +  ++  +  LL  P   SP
Sbjct: 95  SILNEDQDWKPAITMKQILLGVQDLLTSPNPDSP 128

>KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 60.1 bits (144), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 13/100 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTK----------- 98
           Y G  F+  +  P+++P SPP  +F P A+ H NV +R G +C+ IL +           
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + WSP   +  V+ +I  LL++P  SSP NVD A   + N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar to
           Ashbya gossypii AGL203C
          Length = 268

 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 13/100 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTK----------- 98
           Y G  F+  +  P+++P SPP  +F P A+ H NV +R G +C+ IL +           
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPSFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDS 112

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + WSP   +  V+ +I  LL++P  SSP NVD A   + N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR054C
           (CDC34)
          Length = 270

 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 13/100 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTK----------- 98
           Y G  F+  +  P+++P SPP  +F P A+ H NV +R G +C+ IL +           
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPSFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDS 112

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + WSP   +  V+ +I  LL++P  SSP NVD A   + N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly
           similar to uniprot|Q750Z0 Ashbya gossypii AGL203C
           AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 272

 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 13/100 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTK----------- 98
           Y G  F+  +  P+++P SPP  +F P A+ H NV +R G +C+ IL +           
Sbjct: 55  YHGGYFKAQMKFPEDFPFSPPNFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDS 112

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + WSP   +  V+ +I  LL++P  SSP NVD A   + N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {ON}
           Anc_3.301 YDR054C
          Length = 435

 Score = 60.1 bits (144), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 13/94 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTK----------- 98
           Y G  F+  +  P ++P SPP  +F P A+ H NV +R G +C+ IL +           
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDELDA 112

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIA 132
           + WSP   +  V+ +I  LL++P  SSP NVD A
Sbjct: 113 ETWSPVQSVESVLISIVSLLEDPNISSPANVDAA 146

>AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, 157
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL064W (UBC9); 1-intron
          Length = 157

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 3/94 (3%)

Query: 34  DLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICL 93
           +L +WEA I G  GT ++   + + +  P +YP  PP VKF P    H N+ + +G +CL
Sbjct: 37  NLQKWEAGIPGREGTIWKDGVYPITIEYPDDYPSKPPRVKF-PAGFYHPNI-YPSGTVCL 94

Query: 94  DILTK-QHWSPAWDLLHVVQAIGQLLDEPVSSSP 126
            IL + Q W PA  +  ++  +  LL  P  +SP
Sbjct: 95  SILNEDQDWKPAITMKQILLGVQDLLTSPNPNSP 128

>TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON}
           Anc_3.301 YDR054C
          Length = 330

 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 13/100 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTK----------- 98
           Y G  F+  +  P+++P SPP  +F P A+ H NV +R G +C+ IL +           
Sbjct: 55  YHGGYFKSQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTTDEPDA 112

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + WSP   +  V+ +I  LL++P  SSP NVD A   + N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON} 
          Length = 287

 Score = 59.3 bits (142), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 52/100 (52%), Gaps = 13/100 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTK----------- 98
           Y G  F+  +  P ++P SPP  +F P A+ H NV +R G +C+ IL +           
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + WSP   +  V+ +I  LL++P  SSP NVD A   + N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON}
           (121426..122397) [972 nt, 324 aa]
          Length = 323

 Score = 59.3 bits (142), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 13/94 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTK----------- 98
           Y G  F+  +  P ++P SPP  +F P A+ H NV +R G +C+ IL +           
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDELDA 112

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIA 132
           + WSP   +  V+ +I  LL++P  SSP NVD A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON}
           Anc_4.49 YLR306W
          Length = 169

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 58/115 (50%), Gaps = 5/115 (4%)

Query: 26  IVGMEPKEDLTRWEAL--IRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHAN 83
           +  + P ED +R   L     P    Y G  F+ +L+  + YP+ PP V      + H N
Sbjct: 32  LTTLVPPEDTSRSPLLQITICPDEGFYNGGRFKFNLTTSESYPIDPPSVVCL-QKIYHPN 90

Query: 84  VDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           +D   G+ICL+IL ++ WSPA D+  V+  +  L  EP    PLN D A+ L  N
Sbjct: 91  IDL-NGKICLNIL-REDWSPALDIQSVIVGLLFLFLEPNPRDPLNKDAASTLIRN 143

>CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar to
           uniprot|P52491 Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme
          Length = 187

 Score = 57.8 bits (138), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 49/96 (51%), Gaps = 13/96 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVK-----FEPYAMPHANVDFRTGEICLDILTKQHWSPA 104
           Y+G  FR   +  + YP+ PP V      F P   PH       G+ICL+IL ++ WSPA
Sbjct: 76  YKGGKFRFTATFLETYPIDPPKVICNNKIFHPNIDPH-------GKICLNIL-REDWSPA 127

Query: 105 WDLLHVVQAIGQLLDEPVSSSPLNVDIANILKANDM 140
            DL  +V  +  L  EP  + PLN + A +L  + +
Sbjct: 128 LDLQCIVLGLLSLFQEPNGNDPLNKEAAEVLNKDKL 163

>Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 58.5 bits (140), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 13/100 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTK----------- 98
           Y G  F+  +  P+++P SPP  +F P A+ H NV +R G +C+ IL +           
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + WSP   +  V+ +I  LL++P  +SP NVD A   + N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 58.5 bits (140), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 13/100 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTK----------- 98
           Y G  F+  +  P+++P SPP  +F P A+ H NV +R G +C+ IL +           
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + WSP   +  V+ +I  LL++P  +SP NVD A   + N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}
           CDC34Ubiquitin-conjugating enzyme (E2) and catalytic
           subunit of SCF ubiquitin-protein ligase complex
           (together with Skp1p, Rbx1p, Cdc53p, and an F-box
           protein) that regulates cell cycle progression by
           targeting key substrates for degradation
          Length = 295

 Score = 58.5 bits (140), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 13/100 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTK----------- 98
           Y G  F+  +  P+++P SPP  +F P A+ H NV +R G +C+ IL +           
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + WSP   +  V+ +I  LL++P  +SP NVD A   + N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 58.5 bits (140), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 13/100 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTK----------- 98
           Y G  F+  +  P+++P SPP  +F P A+ H NV +R G +C+ IL +           
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
           + WSP   +  V+ +I  LL++P  +SP NVD A   + N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON} 
          Length = 258

 Score = 57.8 bits (138), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 13/94 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDIL-----------TK 98
           Y G  F+  +  P+++P SPP  KF P  + H NV +R G++C+ IL             
Sbjct: 62  YHGGYFQSQMKFPKDFPFSPPQFKFIP-PIYHPNV-YRDGKLCISILHQSGDAMTSEPDN 119

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIA 132
           + WSP   +  V+ +I  LL++P  SSP NVD A
Sbjct: 120 ETWSPVQSVESVLISIVSLLEDPNVSSPANVDAA 153

>ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} similar
           to uniprot|P52491 Saccharomyces cerevisiae YLR306W UBC12
           Enzyme that mediates the conjugation of Rub1p a
           ubiquitin-like protein to other proteins related to E2
           ubiquitin-conjugating enzymes
          Length = 179

 Score = 56.2 bits (134), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 46/92 (50%), Gaps = 3/92 (3%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLH 109
           Y+G NF   L   ++YPM PP VK     + H N+D   G +CL+IL +Q W+PA DL  
Sbjct: 66  YKGGNFTFELLFNEQYPMEPPKVKCL-NRIYHPNID-TDGRVCLNIL-RQDWTPALDLQS 122

Query: 110 VVQAIGQLLDEPVSSSPLNVDIANILKANDMN 141
           V+  +  L  E     PLN   A     N  N
Sbjct: 123 VIIGLLFLFLEISGVDPLNKQAAETFNRNRQN 154

>TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [564
           bp, 187 aa] {ON} Anc_4.49 YLR306W
          Length = 187

 Score = 56.2 bits (134), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 55/108 (50%), Gaps = 4/108 (3%)

Query: 41  LIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQH 100
           LI  P    Y   +F   ++  ++YP+ PP V+       H N+D + G+ICL+IL ++ 
Sbjct: 66  LIVSPDEGFYRKGHFTFEMTFTEKYPIEPPQVRCMNQIF-HPNIDLQ-GKICLNIL-RED 122

Query: 101 WSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVH 148
           WSPA DL  V+  I  L  E     PLN   A++L  N  N +  LV 
Sbjct: 123 WSPALDLQSVIIGILFLFLEVSGRDPLNKQAASLLDENP-NKFSRLVQ 169

>Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF}
           complement(6958..7536) [579 nt, 193 aa]
          Length = 192

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 3/100 (3%)

Query: 40  ALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQ 99
            L+  P    Y+   F+  L   + YP+ PP V      + H N+D   G+ICL+IL ++
Sbjct: 71  TLLISPDEGYYKSGKFKFDLKFNENYPIEPPIV-LCMNKIFHPNIDL-DGKICLNIL-RE 127

Query: 100 HWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAND 139
            WSPA DL  ++  +  L  E  +  PLN + ANIL +++
Sbjct: 128 DWSPALDLNSIIIGLLYLFLECNAKDPLNKEAANILHSDE 167

>Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, 193
           aa] {ON} ANNOTATED BY YGOB -
          Length = 193

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 3/100 (3%)

Query: 40  ALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQ 99
            L+  P    Y+   F+  L   + YP+ PP V      + H N+D   G+ICL+IL ++
Sbjct: 72  TLLISPDEGYYKSGKFKFDLKFNENYPIEPPIV-LCMNKIFHPNIDL-DGKICLNIL-RE 128

Query: 100 HWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAND 139
            WSPA DL  ++  +  L  E  +  PLN + ANIL +++
Sbjct: 129 DWSPALDLNSIIIGLLYLFLECNAKDPLNKEAANILHSDE 168

>KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa]
           {ON} Anc_4.49 YLR306W
          Length = 197

 Score = 55.1 bits (131), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 48/86 (55%), Gaps = 3/86 (3%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLH 109
           Y   +FR   ++ + YP+ PP V      + H N++ RTGEICL+IL ++ WSPA DL  
Sbjct: 86  YNLGHFRFQFTINENYPIEPPKVVCL-TKIYHPNIN-RTGEICLNIL-REDWSPALDLQS 142

Query: 110 VVQAIGQLLDEPVSSSPLNVDIANIL 135
           V+  +  L  EP    PLN   A+ L
Sbjct: 143 VIIGLLFLFIEPNPKDPLNKQAADTL 168

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 54.3 bits (129), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 45  PSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPA 104
           P    Y+   F   +     YP+ PP VKF    + H N+D   G+ICL+IL ++ WSP 
Sbjct: 75  PDEGIYKDGYFPFSMVFKDSYPIEPPVVKFL-KKIYHPNIDL-NGKICLNIL-REDWSPV 131

Query: 105 WDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
            DL  ++  +  L  EP    PLN+    +LK N
Sbjct: 132 LDLQSIIIGLMFLFLEPNPRDPLNLKAGELLKEN 165

>KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa]
           {ON} similar to uniprot|P52491 Saccharomyces cerevisiae
           YLR306W UBC12 Enzyme that mediates the conjugation of
           Rub1p a ubiquitin-like protein to other proteins related
           to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 53.9 bits (128), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 46/86 (53%), Gaps = 3/86 (3%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLH 109
           Y G  +  ++ +   YPM PP VK   + + H N+D   G +CL++L ++ W+PA D+  
Sbjct: 72  YAGGTYYFNVFIKDTYPMEPPVVKCM-HRIYHPNIDI-DGNVCLNLL-REDWTPALDIQS 128

Query: 110 VVQAIGQLLDEPVSSSPLNVDIANIL 135
           ++  I  L  EP    PLN D A  L
Sbjct: 129 IIIGILFLFHEPNGRDPLNKDAAKTL 154

>NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {ON}
          Length = 239

 Score = 54.3 bits (129), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 13/94 (13%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDIL-----------TK 98
           Y G  F+  +  P  +P SPP+ KF P  + H NV ++ G++C+ IL             
Sbjct: 56  YNGGYFKSEMKFPSNFPYSPPHFKFVP-PIYHPNV-YKDGKLCISILHQSGDSMTSEPDN 113

Query: 99  QHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIA 132
           + WSP   +  V+ +I  LL++P  SSP NVD +
Sbjct: 114 ETWSPVQSVESVLISIISLLEDPNISSPANVDAS 147

>Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 53.1 bits (126), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLH 109
           Y   +    L   + YP+ PP V        H N+DF+ G +CL+IL ++ WSPA DL  
Sbjct: 74  YTHGSINFSLDFNEVYPIEPPKVACLKRIF-HPNIDFK-GNVCLNIL-REDWSPALDLQS 130

Query: 110 VVQAIGQLLDEPVSSSPLNVDIANIL 135
           +V  +  L  EP  + PLN D A +L
Sbjct: 131 IVTGLLFLFLEPNPNDPLNKDAAKLL 156

>YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {ON}
            UBC12Enzyme that mediates the conjugation of Rub1p, a
           ubiquitin-like protein, to other proteins; related to E2
           ubiquitin-conjugating enzymes
          Length = 188

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 52/100 (52%), Gaps = 6/100 (6%)

Query: 37  RWEALIRGPSGT-PYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDI 95
           + E ++R   G   Y   NF L  +  + YP+ PP V        H N+D + G +CL+I
Sbjct: 63  KLEVIVRPDEGYYNYGSINFNLDFN--EVYPIEPPKVVCLKKIF-HPNIDLK-GNVCLNI 118

Query: 96  LTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANIL 135
           L ++ WSPA DL  ++  +  L  EP  + PLN D A +L
Sbjct: 119 L-REDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLL 157

>ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, 200
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR306W (UBC12); 1-intron
          Length = 200

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (54%), Gaps = 3/86 (3%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLH 109
           Y G +FR  +     YP+ PP VK     + H N+D+ +G ICL++L ++ WSP  DL  
Sbjct: 88  YRGGHFRFSVVFRDTYPIEPPTVKCL-NTIYHPNIDY-SGNICLNVL-REDWSPVMDLQT 144

Query: 110 VVQAIGQLLDEPVSSSPLNVDIANIL 135
           VV  +  L  EP  S PLN   A+ +
Sbjct: 145 VVLGLLFLFLEPNGSDPLNRQAADTM 170

>KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555
           bp, 184 aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 52.0 bits (123), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 51/95 (53%), Gaps = 7/95 (7%)

Query: 48  TPYEG---C-NFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSP 103
           TP EG   C +F+   +    YP+ PP V        H N+D + G +CL+IL ++ WSP
Sbjct: 67  TPDEGYYKCGHFKFCATFKDTYPIEPPKVTLLSKIF-HPNIDLQ-GNVCLNIL-REDWSP 123

Query: 104 AWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAN 138
             D+  ++  +  L  EP ++ PLN   A++L AN
Sbjct: 124 VLDVQSILIGLLMLFLEPNATDPLNKVAADVLAAN 158

>NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49
          Length = 189

 Score = 51.2 bits (121), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 54/99 (54%), Gaps = 4/99 (4%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLH 109
           Y+G +F   L     YP+ PP V      + H N+D   G++CL+IL ++ WSPA D+  
Sbjct: 78  YKGGHFTFKLEFNDAYPIEPPTV-ICTSKLYHPNIDI-DGKVCLNIL-REDWSPALDVQS 134

Query: 110 VVQAIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVH 148
           ++  +  LL EP +  PLN D A +L + D   +  LV+
Sbjct: 135 IIIGLLFLLLEPNAKDPLNKDAAMML-STDTARFASLVN 172

>Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON}
           similar to Ashbya gossypii AGR372W
          Length = 243

 Score = 51.6 bits (122), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 53/115 (46%), Gaps = 15/115 (13%)

Query: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLP 62
           R +KEYK I        E     I+ +   E++  W  +I GP  TPYEG  +   L  P
Sbjct: 9   RLSKEYKMIM-------ENTPPYIIAVPNDENILEWHYVITGPPDTPYEGGQYHGTLHFP 61

Query: 63  QEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQH---WSPAWDLLHVVQAI 114
            EYP  PP ++    + P+      T  +CL  ++  H   W+P+W +  ++  +
Sbjct: 62  PEYPFKPPAIRI---STPNGRFKQHT-RLCLS-MSDYHPDTWNPSWSVATILNGL 111

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLH 109
           Y   +    L   + YP+ PP V        H N+D + G +CL+IL ++ WSPA DL  
Sbjct: 74  YNHGSINFGLDFNEVYPIEPPKVACLKKIF-HPNIDLK-GNVCLNIL-REDWSPALDLQS 130

Query: 110 VVQAIGQLLDEPVSSSPLNVDIANILKAND 139
           ++  +  L  EP  + PLN D A +   N+
Sbjct: 131 IITGLLFLFLEPNPNDPLNKDAAKLFCQNE 160

>KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {ON} 
          Length = 217

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 51/113 (45%), Gaps = 14/113 (12%)

Query: 32  KEDLTRWE-ALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGE 90
           K ++  WE   +     + Y G      L  P+ +P SPP   F P  + H NV F  G 
Sbjct: 37  KSNIFEWEVGFMVTNEDSIYHGAYLTGLLCFPRNFPFSPPTFLFCP-PIYHPNV-FSNGS 94

Query: 91  ICLDIL-----------TKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIA 132
           +C+ IL             + WSP   +  V+ +I  LLD+P  SSP NVD A
Sbjct: 95  LCISILHECGDDTNEEPDSETWSPVQTVETVLISIISLLDDPNVSSPANVDAA 147

>KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} similar
           to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 49.7 bits (117), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 57/128 (44%), Gaps = 17/128 (13%)

Query: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLP 62
           R  KEYK I              I+    ++++  W  +I GP  TPYE   +   L+ P
Sbjct: 9   RLTKEYKNIVNNP-------PPFIIAAPHEDNILEWHYVITGPPSTPYENGQYHGTLTFP 61

Query: 63  QEYPMSPPYVKFEPYAMPHANVDFRTG-EICLDILT--KQHWSPAWDLLHVVQAIGQLL- 118
            +YP +PP ++     M   N  F+    +CL +     + W+PAW ++ ++  +   + 
Sbjct: 62  SDYPFNPPAIR-----MITPNGRFKENTRLCLSMSDYHPEAWNPAWSVVTILNGLLSFMT 116

Query: 119 -DEPVSSS 125
            DE  + S
Sbjct: 117 GDEQTTGS 124

>CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {ON}
           highly similar to uniprot|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme
          Length = 246

 Score = 48.9 bits (115), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 57/129 (44%), Gaps = 19/129 (14%)

Query: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLP 62
           R  KEYK +        E     I+    +E++  W  +I GP  TPY+G  +   L+ P
Sbjct: 9   RLTKEYKMMV-------ENPPPFIIARPNEENILEWHYVISGPPDTPYDGGQYHGTLTFP 61

Query: 63  QEYPMSPPYVKFEPYAMPHANVDFRTG-EICLDILTKQH---WSPAWDLLHVVQAIGQLL 118
            +YP  PP ++     M   N  F+    +CL  ++  H   W+P W +  ++  +   +
Sbjct: 62  SDYPYKPPAIR-----MITPNGRFKENTRLCLS-MSDYHPDTWNPGWSVATILNGLLSFM 115

Query: 119 --DEPVSSS 125
             DE  + S
Sbjct: 116 TGDESTTGS 124

>SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 185
           aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 185

 Score = 48.1 bits (113), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 39/74 (52%), Gaps = 3/74 (4%)

Query: 55  FRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAI 114
           FR  L     YP+ PP VK     + H N+D + G +CL+IL ++ WSP  DL  VV  +
Sbjct: 78  FRFSLFFKDTYPIEPPAVKCV-NKIYHPNIDTQ-GNVCLNIL-REDWSPVLDLQSVVIGL 134

Query: 115 GQLLDEPVSSSPLN 128
             L  EP    PLN
Sbjct: 135 LFLFLEPNDKDPLN 148

>KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.392
           YER100W
          Length = 251

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 59/136 (43%), Gaps = 19/136 (13%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           + R  KEYK I        E     IV    ++++  W  +I GPS TPY    +   L+
Sbjct: 7   LKRLTKEYKLIV-------ENPPPYIVARPNEDNILEWHYVITGPSDTPYSSGQYHGTLT 59

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTG-EICLDILTKQH---WSPAWDLLHVVQAIGQ 116
            P +YP  PP ++     M   N  F+    +CL  ++  H   W+P W +  ++  +  
Sbjct: 60  FPSDYPYKPPAIR-----MITPNGRFKENTRLCLS-MSDYHPDLWNPGWSVSTILTGLLS 113

Query: 117 LL--DEPVSSSPLNVD 130
            +  DE  + S +  D
Sbjct: 114 FMTGDEATTGSIVTTD 129

>Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 58/126 (46%), Gaps = 16/126 (12%)

Query: 31  PKED-LTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFR-T 88
           P ED +  W  +I GP+ TPY+G  +   L+ P +YP  PP ++     M   N  F+  
Sbjct: 29  PNEDNILEWHYIITGPAETPYKGGQYHGTLTFPSDYPYKPPAIR-----MVTPNGRFKPN 83

Query: 89  GEICLDILTKQH---WSPAWDLLHVVQAIGQLL--DEPVSSSPLNVD-IANILKANDM-- 140
             +CL  ++  H   W+P W +  ++  +   +  DE  + S    D    IL  N +  
Sbjct: 84  TRLCLS-MSDYHPDTWNPGWSVSTILNGLLSFMTSDEATTGSVTTSDHQKKILAKNSLSY 142

Query: 141 NAYYGL 146
           NA+  L
Sbjct: 143 NAFQNL 148

>ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 250

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 51/115 (44%), Gaps = 15/115 (13%)

Query: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLP 62
           R AKE+K +T       E     I+    + ++  W  +I GP GTPYE   +   L+ P
Sbjct: 9   RLAKEFKAMT-------EDPPPYIMARPNESNILDWHYIITGPPGTPYENGQYHGTLTFP 61

Query: 63  QEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQH---WSPAWDLLHVVQAI 114
            +YP  PP ++      P       T  +CL  ++  H   W+P W +  ++  +
Sbjct: 62  SDYPFQPPAIRM---VTPSGRFQENT-RLCLS-MSDYHPTTWNPGWSVSTILNGL 111

>Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 57/129 (44%), Gaps = 13/129 (10%)

Query: 31  PKED-LTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFR-T 88
           P ED +  W  +I GP+ TPY+G  +   L+ P +YP  PP ++     M   N  F+  
Sbjct: 29  PNEDNILEWHYIITGPADTPYKGGQYHGTLTFPSDYPYKPPAIR-----MVTPNGRFKPN 83

Query: 89  GEICLDILTKQH---WSPAWDLLHVVQAIGQLL--DEPVSSSPLNVDIANILKANDMNAY 143
             +CL  ++  H   W+P W +  ++  +   +  DE  + S    D    + A +  +Y
Sbjct: 84  TRLCLS-MSDYHPDTWNPGWSVSTILNGLLSFMTSDEATTGSITTSDHQKKMLARNSISY 142

Query: 144 YGLVHYYIK 152
               +   K
Sbjct: 143 NSFQNVRFK 151

>KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON}
           Anc_7.392 YER100W
          Length = 251

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 57/131 (43%), Gaps = 19/131 (14%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKED-LTRWEALIRGPSGTPYEGCNFRLHL 59
           + R  KEYK I     E    Y    V   P ED +  W  +I GP  TPYEG  +   L
Sbjct: 7   LKRLTKEYKLIV----ENPPPY----VTARPNEDNILEWHYVITGPPETPYEGGQYHGTL 58

Query: 60  SLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQH---WSPAWDLLHVVQAIGQ 116
           + P +YP  PP ++      P+      T  +CL  ++  H   W+P W +  ++  +  
Sbjct: 59  TFPSDYPYKPPAIRM---VTPNGRFKENT-RLCLS-MSDYHPDLWNPGWSVSTILTGLLS 113

Query: 117 LL--DEPVSSS 125
            +  DE  + S
Sbjct: 114 FMTGDEATTGS 124

>Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 45/95 (47%), Gaps = 3/95 (3%)

Query: 41  LIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQH 100
           ++  P    Y   +    L   + YP+ PP V        H N+D   G +CL+IL ++ 
Sbjct: 65  VVVSPDEGYYNHGSISFSLDFNEVYPIEPPKVTCLKKIF-HPNIDL-NGNVCLNIL-RED 121

Query: 101 WSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANIL 135
           WSPA DL  ++  +  L  EP  + PLN D A + 
Sbjct: 122 WSPALDLQSIIIGLLFLFLEPNPNDPLNKDAAKLF 156

>NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON}
           Anc_7.392
          Length = 251

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 52/116 (44%), Gaps = 17/116 (14%)

Query: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLP 62
           R  KEYK +        E     I+    ++++  W  +I GP  TPY+G  +   L+ P
Sbjct: 9   RLTKEYKLLV-------ESSPPFILARPNEDNILEWHYIITGPPDTPYDGGQYHGTLTFP 61

Query: 63  QEYPMSPPYVKFEPYAMPHANVDFRTG-EICLDILTKQH---WSPAWDLLHVVQAI 114
            +YP  PP ++     M   N  F+    +CL  ++  H   W+P W +  ++  +
Sbjct: 62  NDYPYKPPAIR-----MITPNGRFKENTRLCLS-MSDYHPDTWNPGWSVSTILNGL 111

>AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER100W (UBC6)
          Length = 242

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 58/127 (45%), Gaps = 12/127 (9%)

Query: 2   SRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSL 61
           SR A  YK ++K  K   E     IV    ++++  W  +I GP  TPYE   +   L  
Sbjct: 3   SRQA--YKRLSKEYKMMTENPPPYIVAAPKEDNILVWHYVITGPPETPYEDGQYHGTLVF 60

Query: 62  PQEYPMSPPYVKFEPYAMPHANVDFRTG-EICLDILTKQH---WSPAWDLLHVVQAIGQL 117
           P +YP +PP ++     M   N  FR    +CL  ++  H   W+P+W +  ++  +   
Sbjct: 61  PNDYPFNPPAIR-----MLTPNGRFRENTRLCLS-MSDYHPDTWNPSWSVATILTGLLSF 114

Query: 118 LDEPVSS 124
           +    SS
Sbjct: 115 MTTDESS 121

>NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON}
           Anc_7.392
          Length = 257

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 60/136 (44%), Gaps = 19/136 (13%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
             R  KEYKT+T       E     I+    ++++  W  +I GP  +PY    +   L+
Sbjct: 7   FKRLTKEYKTLT-------ETPPPYILARPNEDNILEWHYIITGPPDSPYSEGQYHGTLT 59

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTG-EICLDILTKQH---WSPAWDLLHVVQAIGQ 116
            P +YP  PP ++     M   N  F+    +CL  ++  H   W+P+W +  ++  +  
Sbjct: 60  FPTDYPYKPPAIR-----MITPNGRFKENTRLCLS-MSDYHPDLWNPSWSVSTILTGLLS 113

Query: 117 LL--DEPVSSSPLNVD 130
            +  DE  + S +  D
Sbjct: 114 FMTGDEATTGSIVTTD 129

>NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7.392
           YER100W
          Length = 240

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 57/129 (44%), Gaps = 19/129 (14%)

Query: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLP 62
           R +KEYK I        E  +  I+    + ++  W  +I GP  TPY G  +   L+ P
Sbjct: 9   RLSKEYKLII-------ENPTPYILARPNENNILEWHYIITGPPDTPYVGGQYHGTLTFP 61

Query: 63  QEYPMSPPYVKFEPYAMPHANVDFR-TGEICLDILTKQH---WSPAWDLLHVVQAIGQLL 118
            +YP  PP ++     M   N  F+    +CL  ++  H   W+P W +  ++  +   +
Sbjct: 62  SDYPFKPPAIR-----MITPNGRFKENTRLCLS-MSDYHPDLWNPGWSVATILNGLLSFM 115

Query: 119 --DEPVSSS 125
             DE  + S
Sbjct: 116 TGDEATTGS 124

>KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {ON}
           similar to uniprot|P33296 Saccharomyces cerevisiae
           YER100W UBC6 Ubiquitin-conjugating enzyme involved in
           ER- associated protein degradation located at the
           cytosolic side of the ER membrane tail region contains a
           transmembrane segment at the C-terminus substrate of the
           ubiquitin-proteasome pathway
          Length = 246

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 8/120 (6%)

Query: 9   KTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMS 68
           K +TK  K   E     I+    ++++  W  +I GP  TPYEG  +   L  P +YP  
Sbjct: 8   KRLTKEYKSMVENPPPFIIAQPNEDNILEWHYVITGPPDTPYEGGQYHGTLVFPSDYPFK 67

Query: 69  PPYVKFEPYAMPHANVDFRTGEICLDILTKQH---WSPAWDLLHVVQAIGQLLDEPVSSS 125
           PP ++      P       T  +CL  ++  H   W+P+W +  ++  +   +    S++
Sbjct: 68  PPAIRM---VTPSGRFKEDT-RLCLS-MSDYHPDTWNPSWSVSTILTGLLSFMTSDESTT 122

>Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to
           Ashbya gossypii ADL035C 1-intron
          Length = 267

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 50  YEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLH 109
           Y+  +F   +S    YP+ PP VK     + H N+D+  G ICL++L ++ W+P  DL  
Sbjct: 155 YKHGHFGFSVSFKDSYPIDPPIVKCL-TTIYHPNIDYN-GNICLNVL-REDWTPVLDLQT 211

Query: 110 VVQAIGQLLDEPVSSSPLNVDIANIL 135
           +V  +  L  EP    PLN   A+ +
Sbjct: 212 IVIGLLFLFLEPNPKDPLNKHAAHTM 237

>YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}
           UBC6Ubiquitin-conjugating enzyme involved in
           ER-associated protein degradation; located at the
           cytosolic side of the ER membrane; tail region contains
           a transmembrane segment at the C-terminus; substrate of
           the ubiquitin-proteasome pathway
          Length = 250

 Score = 46.6 bits (109), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 50/107 (46%), Gaps = 13/107 (12%)

Query: 31  PKED-LTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFR-T 88
           P ED +  W  +I GP+ TPY+G  +   L+ P +YP  PP ++     M   N  F+  
Sbjct: 29  PNEDNILEWHYIITGPADTPYKGGQYHGTLTFPSDYPYKPPAIR-----MITPNGRFKPN 83

Query: 89  GEICLDILTKQH---WSPAWDLLHVVQAIGQLL--DEPVSSSPLNVD 130
             +CL  ++  H   W+P W +  ++  +   +  DE  + S    D
Sbjct: 84  TRLCLS-MSDYHPDTWNPGWSVSTILNGLLSFMTSDEATTGSITTSD 129

>TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON}
           Anc_7.392 YER100W
          Length = 256

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 51/113 (45%), Gaps = 10/113 (8%)

Query: 6   KEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEY 65
           + +K +TK  K   E     I     + ++  W  +I GP  TPY+G  +   L+ P +Y
Sbjct: 5   QAHKRLTKEYKMMVETPPPYITARPNESNILEWHYIIIGPQDTPYDGGQYHGTLTFPSDY 64

Query: 66  PMSPPYVKFEPYAMPHANVDFRTG-EICLDILTKQH---WSPAWDLLHVVQAI 114
           P  PP ++     M   N  F+    +CL  ++  H   W+P W +  ++  +
Sbjct: 65  PYKPPAIR-----MITPNGRFKENTRLCLS-MSDYHPDTWNPGWSVATILNGL 111

>SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 45.8 bits (107), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 59/156 (37%), Gaps = 17/156 (10%)

Query: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLP 62
           R  KEYK I        E   Q I     ++++  W  +I GP  TPY    +   L  P
Sbjct: 9   RLTKEYKAII-------ENPPQFINAQPNEDNILEWHYIITGPPDTPYTDGQYHGTLVFP 61

Query: 63  QEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQH---WSPAWDLLHVVQAIGQLL- 118
            +YP  PP ++     M   N  F+        ++  H   W+PAW +  ++  +   + 
Sbjct: 62  ADYPFKPPAIR-----MITPNGRFKENTRLCMTMSDYHPDTWNPAWSVATILMGLLSFMT 116

Query: 119 -DEPVSSSPLNVDIANILKANDMNAYYGLVHYYIKS 153
            DE  + S    D      A     Y  L +   K+
Sbjct: 117 GDEVTTGSITTSDAYKKKMAKKSKEYNALFNARFKA 152

>Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W
           (REAL)
          Length = 249

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 13/107 (12%)

Query: 31  PKED-LTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFR-T 88
           P ED +  W  +I GP+ TPY+   +   L+ P +YP  PP ++     M   N  F+  
Sbjct: 29  PNEDNILEWHYIITGPADTPYKAGQYHGTLTFPSDYPYKPPAIR-----MITPNGRFKPN 83

Query: 89  GEICLDILTKQH---WSPAWDLLHVVQAIGQLL--DEPVSSSPLNVD 130
             +CL  ++  H   W+P W +  ++  +   +  DE  + S    D
Sbjct: 84  TRLCLS-MSDYHPDTWNPGWSVSTILNGLLSFMTSDEATTGSITTSD 129

>TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON}
           Anc_7.392 YER100W
          Length = 248

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 13/123 (10%)

Query: 26  IVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVD 85
           I+    + ++  W  +I GP+ TPY    +   L+ P +YP  PP ++     M   N  
Sbjct: 25  ILARPNENNILEWHYIITGPADTPYFEGQYHGTLTFPSDYPYKPPAIR-----MVTPNGR 79

Query: 86  FRTG-EICLDILTKQH---WSPAWDLLHVVQAIGQLL--DEPVSSSPLNVD-IANILKAN 138
           FR    +CL  ++  H   W+P+W +  ++  +   +  DE  + S    D    IL A 
Sbjct: 80  FRENTRLCLS-MSDYHPNTWNPSWSVSTILNGLLSFMTGDEATTGSIATTDQQKKILAAR 138

Query: 139 DMN 141
            M+
Sbjct: 139 SMD 141

>NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON}
           Anc_7.392
          Length = 255

 Score = 43.1 bits (100), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 64/145 (44%), Gaps = 19/145 (13%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60
           + R  KEYK    ++ E    Y   I+    ++++  W  +I GP  TPY+   +   L+
Sbjct: 7   LKRLTKEYK----LMVENPPPY---ILARPNEDNILEWHYIITGPPDTPYKDGQYHGTLT 59

Query: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTG-EICLDILTKQH---WSPAWDLLHVVQAIGQ 116
            P +YP  PP ++     M   N  F+    +CL  ++  H   W+P W +  ++  +  
Sbjct: 60  FPSDYPYKPPAIR-----MITPNGRFKENTRLCLS-MSDYHPDLWNPGWSVNTILNGLLS 113

Query: 117 LL--DEPVSSSPLNVDIANILKAND 139
            +  D+  + S +  D    L A +
Sbjct: 114 FMTGDDSTTGSIVTTDSQKRLLAKN 138

>Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {ON}
           YER100W (UBC6) - ubiquitin-conjugating enzyme [contig
           33] FULL
          Length = 246

 Score = 43.1 bits (100), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 51/115 (44%), Gaps = 15/115 (13%)

Query: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLP 62
           R +KEYK++        E     I+    ++++  W  +I GP  TPY G  +   L  P
Sbjct: 9   RLSKEYKSMV-------ENPPPFIIAQPNEDNVLEWHYVITGPPDTPYMGGQYHGTLVFP 61

Query: 63  QEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQH---WSPAWDLLHVVQAI 114
            +YP  PP ++      P       T  +CL  ++  H   W+P+W +  ++  +
Sbjct: 62  SDYPFKPPAIRM---VTPSGRFKEDT-RLCLS-MSDYHPDTWNPSWSVSTILTGL 111

>TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {ON}
           Anc_7.392 YER100W
          Length = 257

 Score = 43.1 bits (100), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 51/111 (45%), Gaps = 10/111 (9%)

Query: 8   YKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPM 67
           +K +TK  K  +E  +  I+    + ++  W  +I GP  +PY    +   L+ P +YP 
Sbjct: 7   HKRLTKEYKMMNENPTPFIMARPNEANILEWHYIINGPPDSPYFEGQYHGTLTFPSDYPY 66

Query: 68  SPPYVKFEPYAMPHANVDFRTG-EICLDILTKQH---WSPAWDLLHVVQAI 114
            PP ++     M   N  F+    +CL  ++  H   W+P W +  ++  +
Sbjct: 67  KPPAIR-----MITPNGRFKENTRLCLS-MSDYHPDTWNPGWSVATILNGL 111

>Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON}
           complement(92064..92825) [762 nt, 254 aa]
          Length = 253

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 54/123 (43%), Gaps = 10/123 (8%)

Query: 8   YKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPM 67
           +K +TK  K   E  +  I+    + ++  W  +I GP  +PY    +   L+ P +YP 
Sbjct: 7   HKRLTKEYKMMMENPTPYIIARPNESNILEWHYVITGPPDSPYHDGQYHGTLTFPSDYPY 66

Query: 68  SPPYVKFEPYAMPHANVDFRTGEICLDILTKQH---WSPAWDLLHVVQAIGQLL--DEPV 122
            PP ++      P+      T  +CL  ++  H   W+P W +  ++  +   +  DE  
Sbjct: 67  KPPAIRM---VTPNGRFKENT-RLCLS-MSDYHPDTWNPGWSVATILNGLLSFMTGDEQT 121

Query: 123 SSS 125
           + S
Sbjct: 122 TGS 124

>Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 bp,
           137 aa] {ON} YGL087C (REAL)
          Length = 137

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 60/128 (46%), Gaps = 8/128 (6%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYS--QLIVGMEPKED--LTRWEALIRGPSGTPYEGCNFR 56
           MS+  + ++ + + L++G++ +       G+   +D  +T+W   I GP  + +E   + 
Sbjct: 1   MSKVPRNFRLLEE-LEKGEKGFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYS 59

Query: 57  LHLSLPQEYPMSPPYVKF-EPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIG 115
           L +     YP SPP V F     +P  N    TGEI  D  T + W  A+ +  ++  + 
Sbjct: 60  LSIECGPNYPDSPPKVTFISKINLPCVNQT--TGEIQTDFHTLRDWKRAYTMETLLLDLR 117

Query: 116 QLLDEPVS 123
           + +  P +
Sbjct: 118 KEMATPAN 125

>YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, 137
           aa] {ON}  MMS2Ubiquitin-conjugating enzyme variant
           involved in error-free postreplication repair; forms a
           heteromeric complex with Ubc13p, an active
           ubiquitin-conjugating enzyme; cooperates with
           chromatin-associated RING finger proteins, Rad18p and
           Rad5p
          Length = 137

 Score = 37.4 bits (85), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 60/128 (46%), Gaps = 8/128 (6%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYS--QLIVGMEPKED--LTRWEALIRGPSGTPYEGCNFR 56
           MS+  + ++ + + L++G++ +       G+   +D  +T+W   I GP  + +E   + 
Sbjct: 1   MSKVPRNFRLLEE-LEKGEKGFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYS 59

Query: 57  LHLSLPQEYPMSPPYVKF-EPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIG 115
           L +     YP SPP V F     +P  N    TGE+  D  T + W  A+ +  ++  + 
Sbjct: 60  LSIDCGPNYPDSPPKVTFISKINLPCVNP--TTGEVQTDFHTLRDWKRAYTMETLLLDLR 117

Query: 116 QLLDEPVS 123
           + +  P +
Sbjct: 118 KEMATPAN 125

>Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 35.4 bits (80), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 3/90 (3%)

Query: 35  LTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKF-EPYAMPHANVDFRTGEICL 93
           +T+W   I GP  + +E   + L +     YP SPP V F     +P  N    TGE+  
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTFISKINLPCVNPT--TGEVQT 58

Query: 94  DILTKQHWSPAWDLLHVVQAIGQLLDEPVS 123
           D  T + W  A+ +  ++  + + +  P +
Sbjct: 59  DFHTLRGWKRAYTMETLLLDLRKEMATPAN 88

>Suva_3.11 Chr3 complement(15902..17041) [1140 bp, 379 aa] {ON}
           YCL008C (REAL)
          Length = 379

 Score = 35.0 bits (79), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 57/133 (42%), Gaps = 22/133 (16%)

Query: 8   YKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPY--------EGCNFRLHL 59
           +K I  +  +G   +   +  ++    L     +   P G+P          G +  L +
Sbjct: 18  FKVIQPIYDDGRRTFHDSLALLDKFHRLRPRTRVFTHPDGSPQLLLSIYGTVGDSLPLIM 77

Query: 60  SLPQEYPMSPPYVKFE---------PYAMP-HANVDFRTGEICLDILTKQHWSPA-WDLL 108
            +P  YP+ PP++  +           ++P  A +D   G I L IL   HW+PA   L+
Sbjct: 78  WIPNLYPVKPPFISIDLETFDVSTISSSLPVQAYID-SDGRIALPIL--DHWNPATMSLI 134

Query: 109 HVVQAIGQLLDEP 121
            VVQ +  LL+EP
Sbjct: 135 AVVQELMGLLNEP 147

>Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 33.5 bits (75), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 3/90 (3%)

Query: 35  LTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKF-EPYAMPHANVDFRTGEICL 93
           +T+W   I GP  + +E   + L +     YP SPP V F     +P   V   TGE+  
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPNVTFISKINLPC--VSQTTGEVQT 58

Query: 94  DILTKQHWSPAWDLLHVVQAIGQLLDEPVS 123
           +  T + W  A+ +  ++  + + +  P +
Sbjct: 59  NFHTLRDWKRAYTMETLLLDLRKEMATPAN 88

>Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa]
           {ON} similar to Ashbya gossypii AFL064W 1-intron
          Length = 138

 Score = 32.7 bits (73), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 54/113 (47%), Gaps = 9/113 (7%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYS--QLIVGMEPKED--LTRWEALIRGPSGTPYEGCNFR 56
           MSR  + ++ + + L++G++         G+   ED  +T W   I GP  + +E   + 
Sbjct: 1   MSRVPRSFRLLEE-LEKGEKGLGPESCSYGLANGEDITMTTWNGTILGPPHSNHENRIYS 59

Query: 57  LHLSLPQEYPMSPPYVKF-EPYAMPHANVDFRTGEICLDIL-TKQHWSPAWDL 107
           + +    EYP  PP VKF     +P   VD  TGE+  ++  T + W  ++ +
Sbjct: 60  VVIKCGDEYPDKPPTVKFISKINLPC--VDQATGEVETNMFHTLRDWKRSYTM 110

>KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.187
           YGL087C
          Length = 138

 Score = 32.3 bits (72), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 60/129 (46%), Gaps = 9/129 (6%)

Query: 1   MSRAAKEYKTITKVLKEGDEVYS--QLIVGMEPKED--LTRWEALIRGPSGTPYEGCNFR 56
           MS+  + ++ + + L++G++ +       G+   +D  +T+W   I GP  + +E   + 
Sbjct: 1   MSKVPRSFRLLEE-LEKGEKGFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYS 59

Query: 57  LHLSLPQEYPMSPPYVKF-EPYAMPHANVDFRTGEICLDIL-TKQHWSPAWDLLHVVQAI 114
           L +     YP  PP VKF     +P   VD  TG +  +   T + W  ++ +  V+  +
Sbjct: 60  LEIVCGDRYPDEPPLVKFISKVNLP--CVDQTTGVVSAEKFHTLRDWKRSYTMQTVLLDL 117

Query: 115 GQLLDEPVS 123
            + +  P +
Sbjct: 118 RKEMGTPAN 126

>ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417
           bp, 138 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1
           6-bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 138

 Score = 32.3 bits (72), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 42/91 (46%), Gaps = 4/91 (4%)

Query: 35  LTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKF-EPYAMPHANVDFRTGEICL 93
           +T W   I GP  + +E   + L +     YP  PP +KF     +P   VD +TG++  
Sbjct: 38  MTTWNGTILGPPHSNHENRIYSLSIECGPNYPDHPPTIKFISKINLP--CVDSKTGQVTP 95

Query: 94  DIL-TKQHWSPAWDLLHVVQAIGQLLDEPVS 123
               T + W  A+++  ++  + + +  P +
Sbjct: 96  STFHTLRDWKRAYNMETILLELRKEMATPAN 126

>KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417
          bp, 138 aa] {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 31.6 bits (70), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 47/96 (48%), Gaps = 8/96 (8%)

Query: 1  MSRAAKEYKTITKVLKEGDEVYS--QLIVGMEPKED--LTRWEALIRGPSGTPYEGCNFR 56
          MS+  + ++ + + L++G++ +       G+   +D  +T W   I GP  + +E   + 
Sbjct: 1  MSKIPRSFRLLEE-LEKGEKGFGPESCSYGLADSDDITMTNWNGTILGPPHSNHENRIYS 59

Query: 57 LHLSLPQEYPMSPPYVKF-EPYAMPHANVDFRTGEI 91
          L +     YP  PP VKF     +P   +D +TGEI
Sbjct: 60 LEIVCGPNYPDEPPKVKFVSKVNLPC--IDDKTGEI 93

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,174,434
Number of extensions: 697942
Number of successful extensions: 2167
Number of sequences better than 10.0: 272
Number of HSP's gapped: 1884
Number of HSP's successfully gapped: 272
Length of query: 153
Length of database: 53,481,399
Length adjustment: 100
Effective length of query: 53
Effective length of database: 42,014,799
Effective search space: 2226784347
Effective search space used: 2226784347
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)