Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D09856gna 1ON1561568261e-114
ZYRO0C18436gsingletonON1291263561e-43
TDEL0D00210singletonON1301283552e-43
KLTH0F14916gna 1ON1511233452e-41
SAKL0F16654gsingletonON1311273432e-41
KLLA0E04005gna 1ON1371293413e-41
Kwal_55.21247na 1ON1341263344e-40
KLLA0B14817gsingletonON1311293344e-40
Kwal_23.2807singletonON1291233335e-40
SAKL0F02684gna 1ON1381253283e-39
KLTH0C11880gsingletonON1311233041e-35
Kwal_47.16590singletonON1261222493e-27
KLTH0E03168gsingletonON1481222495e-27
SAKL0F02640gsingletonON1161182422e-26
Kpol_1033.127.238ON1431031591e-13
Skud_5.1717.238ON1291021571e-13
TPHA0K009207.238ON128991562e-13
Suva_5.1657.238ON1291041553e-13
NDAI0E047507.238ON1281001553e-13
KNAG0D016207.238ON1421021546e-13
ADL077C7.238ON1421031538e-13
YER057C (HMF1)7.238ON1291031528e-13
Smik_5.1877.238ON1291021529e-13
KAFR0I018307.238ON1431251529e-13
TDEL0H020607.238ON1771071532e-12
KAFR0L008607.238ON1281141492e-12
NCAS0E032407.238ON1281011483e-12
TPHA0C011007.238ON1421001484e-12
ZYRO0C08074g7.238ON1431001469e-12
TBLA0D040907.238ON1551021442e-11
SAKL0F08558g7.238ON1441391423e-11
Kwal_23.58047.238ON1411371423e-11
KNAG0L014507.238ON1311011413e-11
NDAI0A025507.238ON1441031424e-11
YIL051C (MMF1)7.238ON1451041415e-11
KLTH0A04224g7.238ON1411361407e-11
Smik_9.1397.238ON1451041407e-11
Suva_9.1487.238ON1451041381e-10
NCAS0A134907.238ON1481031362e-10
Skud_9.1187.238ON1451041337e-10
TBLA0J014207.238ON126981318e-10
CAGL0M12386g7.238ON142991321e-09
Kpol_1009.257.238ON1271011311e-09
KLLA0C08349g7.238ON1401021196e-08
ZYRO0F14014g8.349ON669691043e-05
SAKL0H14938g8.349ON69190954e-04
Suva_10.2398.349ON68987946e-04
NDAI0G024608.349ON71789910.002
Skud_12.2148.349ON68463860.006
CAGL0M04521g8.349ON68879830.017
TDEL0F047308.349ON69462810.029
YLR143W8.349ON68572750.20
TPHA0C006508.349ON71190750.20
Smik_12.2098.349ON68463730.32
Kpol_1036.868.349ON69762730.38
Kpol_257.22.491ON30458662.2
Suva_11.1342.491ON31067662.4
Smik_11.1492.491ON31046662.6
YKL091C2.491ON31046662.6
TBLA0D03280singletonON58068662.6
Skud_11.1372.491ON31046652.7
Kpol_1070.327.206ON42529653.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D09856g
         (156 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D09856g Chr4 complement(834023..834493) [471 bp, 156 aa] {O...   322   e-114
ZYRO0C18436g Chr3 complement(1444072..1444461) [390 bp, 129 aa] ...   141   1e-43
TDEL0D00210 Chr4 (34669..35061) [393 bp, 130 aa] {ON}                 141   2e-43
KLTH0F14916g Chr6 (1220286..1220741) [456 bp, 151 aa] {ON} weakl...   137   2e-41
SAKL0F16654g Chr6 (1378394..1378789) [396 bp, 131 aa] {ON} weakl...   136   2e-41
KLLA0E04005g Chr5 complement(364475..364888) [414 bp, 137 aa] {O...   135   3e-41
Kwal_55.21247 s55 (747831..748235) [405 bp, 134 aa] {ON} YER057C...   133   4e-40
KLLA0B14817g Chr2 (1301705..1302100) [396 bp, 131 aa] {ON} weakl...   133   4e-40
Kwal_23.2807 s23 (20785..21174) [390 bp, 129 aa] {ON} YER057C (H...   132   5e-40
SAKL0F02684g Chr6 complement(228156..228572) [417 bp, 138 aa] {O...   130   3e-39
KLTH0C11880g Chr3 complement(982966..983361) [396 bp, 131 aa] {O...   121   1e-35
Kwal_47.16590 s47 complement(15715..16095) [381 bp, 126 aa] {ON}...   100   3e-27
KLTH0E03168g Chr5 complement(285658..286104) [447 bp, 148 aa] {O...   100   5e-27
SAKL0F02640g Chr6 complement(227067..227417) [351 bp, 116 aa] {O...    98   2e-26
Kpol_1033.12 s1033 complement(28172..28603) [432 bp, 143 aa] {ON...    66   1e-13
Skud_5.171 Chr5 complement(266894..267283) [390 bp, 129 aa] {ON}...    65   1e-13
TPHA0K00920 Chr11 (190389..190775) [387 bp, 128 aa] {ON} Anc_7.2...    65   2e-13
Suva_5.165 Chr5 complement(246850..247239) [390 bp, 129 aa] {ON}...    64   3e-13
NDAI0E04750 Chr5 complement(1071393..1071779) [387 bp, 128 aa] {...    64   3e-13
KNAG0D01620 Chr4 complement(272653..273081) [429 bp, 142 aa] {ON...    64   6e-13
ADL077C Chr4 complement(549523..549951) [429 bp, 142 aa] {ON} Sy...    64   8e-13
YER057C Chr5 complement(270737..271126) [390 bp, 129 aa] {ON}  H...    63   8e-13
Smik_5.187 Chr5 complement(274856..275245) [390 bp, 129 aa] {ON}...    63   9e-13
KAFR0I01830 Chr9 complement(375688..376119) [432 bp, 143 aa] {ON...    63   9e-13
TDEL0H02060 Chr8 (350315..350848) [534 bp, 177 aa] {ON} Anc_7.23...    64   2e-12
KAFR0L00860 Chr12 complement(161978..162364) [387 bp, 128 aa] {O...    62   2e-12
NCAS0E03240 Chr5 (641701..642087) [387 bp, 128 aa] {ON} Anc_7.238      62   3e-12
TPHA0C01100 Chr3 (250318..250746) [429 bp, 142 aa] {ON} Anc_7.23...    62   4e-12
ZYRO0C08074g Chr3 complement(619866..620297) [432 bp, 143 aa] {O...    61   9e-12
TBLA0D04090 Chr4 (1016159..1016626) [468 bp, 155 aa] {ON} Anc_7....    60   2e-11
SAKL0F08558g Chr6 complement(654765..655199) [435 bp, 144 aa] {O...    59   3e-11
Kwal_23.5804 s23 complement(1324907..1325332) [426 bp, 141 aa] {...    59   3e-11
KNAG0L01450 Chr12 complement(258500..258895) [396 bp, 131 aa] {O...    59   3e-11
NDAI0A02550 Chr1 complement(570003..570437) [435 bp, 144 aa] {ON...    59   4e-11
YIL051C Chr9 complement(257843..258280) [438 bp, 145 aa] {ON}  M...    59   5e-11
KLTH0A04224g Chr1 complement(356660..357085) [426 bp, 141 aa] {O...    59   7e-11
Smik_9.139 Chr9 complement(231954..232391) [438 bp, 145 aa] {ON}...    59   7e-11
Suva_9.148 Chr9 complement(246539..246976) [438 bp, 145 aa] {ON}...    58   1e-10
NCAS0A13490 Chr1 (2655822..2656268) [447 bp, 148 aa] {ON} Anc_7....    57   2e-10
Skud_9.118 Chr9 complement(226723..227160) [438 bp, 145 aa] {ON}...    56   7e-10
TBLA0J01420 Chr10 (325885..326265) [381 bp, 126 aa] {ON} Anc_7.2...    55   8e-10
CAGL0M12386g Chr13 (1236543..1236971) [429 bp, 142 aa] {ON} simi...    55   1e-09
Kpol_1009.25 s1009 complement(58847..59230) [384 bp, 127 aa] {ON...    55   1e-09
KLLA0C08349g Chr3 (731629..732051) [423 bp, 140 aa] {ON} similar...    50   6e-08
ZYRO0F14014g Chr6 (1151774..1153783) [2010 bp, 669 aa] {ON} simi...    45   3e-05
SAKL0H14938g Chr8 complement(1295178..1297253) [2076 bp, 691 aa]...    41   4e-04
Suva_10.239 Chr10 (436127..438196) [2070 bp, 689 aa] {ON} YLR143...    41   6e-04
NDAI0G02460 Chr7 complement(560518..562671) [2154 bp, 717 aa] {ON}     40   0.002
Skud_12.214 Chr12 (410879..412933) [2055 bp, 684 aa] {ON} YLR143...    38   0.006
CAGL0M04521g Chr13 (496157..498223) [2067 bp, 688 aa] {ON} simil...    37   0.017
TDEL0F04730 Chr6 (889641..891725) [2085 bp, 694 aa] {ON} Anc_8.3...    36   0.029
YLR143W Chr12 (427329..429386) [2058 bp, 685 aa] {ON} Putative p...    33   0.20 
TPHA0C00650 Chr3 complement(123052..125187) [2136 bp, 711 aa] {O...    33   0.20 
Smik_12.209 Chr12 (409793..411847) [2055 bp, 684 aa] {ON} YLR143...    33   0.32 
Kpol_1036.86 s1036 (225185..227278) [2094 bp, 697 aa] {ON} (2251...    33   0.38 
Kpol_257.2 s257 complement(3732..4646) [915 bp, 304 aa] {ON} com...    30   2.2  
Suva_11.134 Chr11 complement(255890..256822) [933 bp, 310 aa] {O...    30   2.4  
Smik_11.149 Chr11 complement(256076..257008) [933 bp, 310 aa] {O...    30   2.6  
YKL091C Chr11 complement(269718..270650) [933 bp, 310 aa] {ON} P...    30   2.6  
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...    30   2.6  
Skud_11.137 Chr11 complement(255229..256161) [933 bp, 310 aa] {O...    30   2.7  
Kpol_1070.32 s1070 complement(72051..73328) [1278 bp, 425 aa] {O...    30   3.2  

>ZYRO0D09856g Chr4 complement(834023..834493) [471 bp, 156 aa] {ON}
           some similarities with uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1
          Length = 156

 Score =  322 bits (826), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%)

Query: 1   MRKGYYYLEYGTTKLCKTTVGTASNMSRVDWNQLGTSNPLLSPAFVVSSAHHLVFTSGCL 60
           MRKGYYYLEYGTTKLCKTTVGTASNMSRVDWNQLGTSNPLLSPAFVVSSAHHLVFTSGCL
Sbjct: 1   MRKGYYYLEYGTTKLCKTTVGTASNMSRVDWNQLGTSNPLLSPAFVVSSAHHLVFTSGCL 60

Query: 61  GTDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKY 120
           GTDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKY
Sbjct: 61  GTDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKY 120

Query: 121 FPEKPARSCIVVAFPNPKVQVELECVAVTKSRESKL 156
           FPEKPARSCIVVAFPNPKVQVELECVAVTKSRESKL
Sbjct: 121 FPEKPARSCIVVAFPNPKVQVELECVAVTKSRESKL 156

>ZYRO0C18436g Chr3 complement(1444072..1444461) [390 bp, 129 aa]
           {ON} similar to uniprot|P40037 Saccharomyces cerevisiae
           YER057C
          Length = 129

 Score =  141 bits (356), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 94/126 (74%), Gaps = 3/126 (2%)

Query: 27  SRVDWNQLG--TSNPLLSPAFVVSSAHHLVFTSGCLGTDDQ-DQLPECPAEQTKNAFENL 83
           +++ WNQ+G    + LLSPA+V + A  LVFTSGC+GTD +   L E   +Q +NA ENL
Sbjct: 3   TQITWNQVGPLGGSSLLSPAYVTADAKKLVFTSGCVGTDPKTGTLAEELDQQVRNALENL 62

Query: 84  SKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIVVAFPNPKVQVEL 143
             VL+ASGSS+ +V+KVLLFV D +    VN+IYQ+YFP  PARSCIVV+FP+PK++VEL
Sbjct: 63  KNVLKASGSSIDNVLKVLLFVADGSFAAPVNKIYQEYFPGAPARSCIVVSFPDPKLKVEL 122

Query: 144 ECVAVT 149
           EC+A T
Sbjct: 123 ECIAQT 128

>TDEL0D00210 Chr4 (34669..35061) [393 bp, 130 aa] {ON} 
          Length = 130

 Score =  141 bits (355), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 90/128 (70%), Gaps = 1/128 (0%)

Query: 27  SRVDWNQL-GTSNPLLSPAFVVSSAHHLVFTSGCLGTDDQDQLPECPAEQTKNAFENLSK 85
           +++ W  + G S+ LLSP +V +    L+FTSGC+GTD   +L E    QTK A ENL  
Sbjct: 3   TQIQWEDVNGPSHSLLSPGYVTAKNSQLLFTSGCVGTDKSGKLAEGVEAQTKLALENLKV 62

Query: 86  VLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIVVAFPNPKVQVELEC 145
           VLEA GSSLS+V+KVLLFV D +    VN +YQ+YFP +P RSC+VVAFP+P ++VELEC
Sbjct: 63  VLEAGGSSLSNVLKVLLFVGDGSYASAVNSVYQEYFPGRPGRSCVVVAFPDPAIKVELEC 122

Query: 146 VAVTKSRE 153
           VAV   ++
Sbjct: 123 VAVVPEKD 130

>KLTH0F14916g Chr6 (1220286..1220741) [456 bp, 151 aa] {ON} weakly
           similar to uniprot|P40185 Saccharomyces cerevisiae
           YIL051C MMF1 Mitochondrial protein involved in
           maintenance of the mitochondrial genome and weakly
           similar to YER057C uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to
           mitochondria; heat shock inducible; high- dosage growth
           inhibitor; forms a homotrimer in vitro
          Length = 151

 Score =  137 bits (345), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 70/123 (56%), Positives = 90/123 (73%), Gaps = 4/123 (3%)

Query: 28  RVDWNQLGTSN--PLLSPAFVVSSAHHLVFTSGCLGTDD-QDQLPECPAEQTKNAFENLS 84
           +V W ++G +    LLSPAFV +S   LVFTSGC+G+D   D+LPE   +Q +NA +NL 
Sbjct: 19  KVTWQEVGATKGIDLLSPAFV-TSGSKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLR 77

Query: 85  KVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIVVAFPNPKVQVELE 144
            VLEASGS+   V+KVLLFV D A    VNRIY++ FP  PARSC+VV+FPNPK++VELE
Sbjct: 78  NVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQFPNSPARSCVVVSFPNPKIKVELE 137

Query: 145 CVA 147
           C+A
Sbjct: 138 CIA 140

>SAKL0F16654g Chr6 (1378394..1378789) [396 bp, 131 aa] {ON} weakly
           similar to uniprot|P40037 Saccharomyces cerevisiae
           YER057C HMF1
          Length = 131

 Score =  136 bits (343), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 66/127 (51%), Positives = 91/127 (71%), Gaps = 3/127 (2%)

Query: 28  RVDWNQLG--TSNPLLSPAFVVSSAHHLVFTSGCLGTDDQD-QLPECPAEQTKNAFENLS 84
           +++WNQ+G  + + LLSP F+ S    ++FTSG +GTD +  ++PE    QTKNA ENL 
Sbjct: 4   KIEWNQVGVTSGHALLSPGFICSKDEDILFTSGNVGTDPKSGEVPEDLRAQTKNALENLK 63

Query: 85  KVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIVVAFPNPKVQVELE 144
             LEA GSSL +V+KVLLFV D +    VN +Y++YFP  PARSCIVV+FP+PK+++ELE
Sbjct: 64  TTLEAGGSSLDNVLKVLLFVADGSYAATVNEVYKEYFPGSPARSCIVVSFPDPKLKLELE 123

Query: 145 CVAVTKS 151
           C+A   S
Sbjct: 124 CIAAVPS 130

>KLLA0E04005g Chr5 complement(364475..364888) [414 bp, 137 aa] {ON}
           weakly similar to uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1 Mitochondrial protein involved
           in maintenance of the mitochondrial genome and weakly
           similar to YER057C uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to
           mitochondria; heat shock inducible; high- dosage growth
           inhibitor; forms a homotrimer in vitro
          Length = 137

 Score =  135 bits (341), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 63/129 (48%), Positives = 94/129 (72%), Gaps = 3/129 (2%)

Query: 28  RVDWNQLGTSN--PLLSPAFVVSSAHHLVFTSGCLGTDD-QDQLPECPAEQTKNAFENLS 84
           ++ W  +G  +  PL+SP F   S + L+F+SGC+GTD   ++LPE   +Q +N+  NL 
Sbjct: 4   KITWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLK 63

Query: 85  KVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIVVAFPNPKVQVELE 144
           KVLE SGSS+ SV+K+LLFV D +   +VN++++++FP +PARSCIVVAFPN K++VELE
Sbjct: 64  KVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPNNKLKVELE 123

Query: 145 CVAVTKSRE 153
           C+A   S++
Sbjct: 124 CIAEIPSKK 132

>Kwal_55.21247 s55 (747831..748235) [405 bp, 134 aa] {ON} YER057C
           (HMF1) - heat-regulated protein [contig 130] FULL
          Length = 134

 Score =  133 bits (334), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 70/126 (55%), Positives = 90/126 (71%), Gaps = 5/126 (3%)

Query: 26  MSR-VDWNQLGTSN--PLLSPAFVVSSAHHLVFTSGCLGTDD-QDQLPECPAEQTKNAFE 81
           M+R V W ++G     P+L+PA+V S++  LVFTSGC+GTD    +LP    +Q +NA E
Sbjct: 1   MARQVTWKEVGPGKGYPILAPAYVTSNSD-LVFTSGCVGTDPVTGELPTDLEQQVRNALE 59

Query: 82  NLSKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIVVAFPNPKVQV 141
           NL  VL ASGSSL  VIKVLLFV D +  P VN++Y +YFP  PARSCIVV+FPN  ++V
Sbjct: 60  NLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLKV 119

Query: 142 ELECVA 147
           ELEC+A
Sbjct: 120 ELECIA 125

>KLLA0B14817g Chr2 (1301705..1302100) [396 bp, 131 aa] {ON} weakly
           similar to uniprot|P40185 Saccharomyces cerevisiae
           YIL051C MMF1 Mitochondrial protein involved in
           maintenance of the mitochondrial genome and weakly
           similar to YER057C uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to
           mitochondria; heat shock inducible; high- dosage growth
           inhibitor; forms a homotrimer in vitro
          Length = 131

 Score =  133 bits (334), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 92/129 (71%), Gaps = 3/129 (2%)

Query: 26  MSRVDWNQLGT-SNP-LLSPAFVVSSAHHLVFTSGCLGTDD-QDQLPECPAEQTKNAFEN 82
           + RV+W ++G  S P  L+PA+V S    LV+TSGC+G+D    ++PE   +Q +NA +N
Sbjct: 2   VRRVEWKEVGVESGPTFLAPAYVTSKDTELVYTSGCVGSDLLTGEIPEDLEKQVRNALDN 61

Query: 83  LSKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIVVAFPNPKVQVE 142
           L +VL+AS SS   V+K+LLFV D +    VN +Y++YFPE+PARSCIVV+FP+P ++VE
Sbjct: 62  LGRVLKASNSSFDDVLKILLFVADGSYASTVNAVYKEYFPERPARSCIVVSFPDPTLKVE 121

Query: 143 LECVAVTKS 151
           LECVA   S
Sbjct: 122 LECVAAVSS 130

>Kwal_23.2807 s23 (20785..21174) [390 bp, 129 aa] {ON} YER057C
           (HMF1) - heat-regulated protein [contig 246] FULL
          Length = 129

 Score =  132 bits (333), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 84/123 (68%), Gaps = 3/123 (2%)

Query: 28  RVDWNQLGTSN--PLLSPAFVVSSAHHLVFTSGCLGTDD-QDQLPECPAEQTKNAFENLS 84
           +V W+ +G      +LSPA+V S ++ LVFTSGC+GTD     LPE   +Q  NA ENL 
Sbjct: 4   QVQWSAVGPGKGYDILSPAYVASKSNDLVFTSGCVGTDPVTGNLPEDLEQQIINALENLK 63

Query: 85  KVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIVVAFPNPKVQVELE 144
            VL ASGSSL  V+KVLLFV D +    VN +Y +YFP  PARSCIVVAFP P ++VELE
Sbjct: 64  NVLHASGSSLERVLKVLLFVSDASYASTVNEVYSRYFPNAPARSCIVVAFPAPALKVELE 123

Query: 145 CVA 147
           C+A
Sbjct: 124 CIA 126

>SAKL0F02684g Chr6 complement(228156..228572) [417 bp, 138 aa] {ON}
           conserved hypothetical protein
          Length = 138

 Score =  130 bits (328), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 89/125 (71%), Gaps = 4/125 (3%)

Query: 27  SRVDWNQLGT--SNPLLSPAFVVSSAHHLVFTSGCLGTDDQ-DQLPECPAEQTKNAFENL 83
           ++  W  +G   ++ LLSPAFV +S   LV+TSGC+GTD +  +LPE   +QT+NA ENL
Sbjct: 3   TKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENL 62

Query: 84  SKVLEASG-SSLSSVIKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIVVAFPNPKVQVE 142
             VL  SG SSL  V+KVLLFV D    PVVN++Y++YF  +P RSC+VV FPN K++VE
Sbjct: 63  RIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTNQPCRSCVVVGFPNEKIKVE 122

Query: 143 LECVA 147
           LECVA
Sbjct: 123 LECVA 127

>KLTH0C11880g Chr3 complement(982966..983361) [396 bp, 131 aa] {ON}
           conserved hypothetical protein
          Length = 131

 Score =  121 bits (304), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 84/123 (68%), Gaps = 3/123 (2%)

Query: 28  RVDWNQLGTSN--PLLSPAFVVSSAHHLVFTSGCLGTDD-QDQLPECPAEQTKNAFENLS 84
           ++ W ++G SN    LSP  V S    L+FTSGC+G D    + PE    Q +NA EN+ 
Sbjct: 4   KLKWEEVGVSNGPSFLSPGCVSSKNCDLLFTSGCVGNDPITGEYPEDVESQARNAMENMK 63

Query: 85  KVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIVVAFPNPKVQVELE 144
           +VLE++ S+   V+K LLF+ DP+    VN++YQ++FP +P+RSCIVV+FP+PK++ E+E
Sbjct: 64  RVLESASSNFDYVLKALLFISDPSYASAVNKVYQEFFPGRPSRSCIVVSFPDPKLKFEME 123

Query: 145 CVA 147
           CVA
Sbjct: 124 CVA 126

>Kwal_47.16590 s47 complement(15715..16095) [381 bp, 126 aa] {ON}
           YER057C (HMF1) - heat-regulated protein [contig 376]
           FULL
          Length = 126

 Score =  100 bits (249), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 73/122 (59%), Gaps = 5/122 (4%)

Query: 28  RVDWNQL-GTSNPLLSPAFVVSSAHHLVFTSGCLGTD-DQDQLPECPAEQTKNAFENLSK 85
           ++ W  + G  +P LSP +V S+ H  VFTSG +G +    ++P    +Q   A +NL  
Sbjct: 5   KITWEAIKGKEHPTLSPGYV-SNGH--VFTSGIIGANYGTGEVPHEIEDQVHLAIKNLET 61

Query: 86  VLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIVVAFPNPKVQVELEC 145
           VL A GSSLS V KV +F+       VVN IY  YFP KPARSC+VVAF +  ++ ELE 
Sbjct: 62  VLVAGGSSLSKVFKVTMFISHADYSKVVNEIYGHYFPHKPARSCVVVAFMDAAIKYELEA 121

Query: 146 VA 147
           +A
Sbjct: 122 IA 123

>KLTH0E03168g Chr5 complement(285658..286104) [447 bp, 148 aa] {ON}
           conserved hypothetical protein
          Length = 148

 Score =  100 bits (249), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 75/122 (61%), Gaps = 5/122 (4%)

Query: 28  RVDWNQL-GTSNPLLSPAFVVSSAHHLVFTSGCLGTD-DQDQLPECPAEQTKNAFENLSK 85
           ++ W  + G  +P LSPAFV S+ H  VFTSG +G+     ++ +   +Q   A +NL  
Sbjct: 27  KITWESIEGKEHPTLSPAFV-SNGH--VFTSGIIGSKYGTGEVSQQIEDQVHLAIQNLEN 83

Query: 86  VLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIVVAFPNPKVQVELEC 145
           VL  +GSSL  V KV +F+       VVN IY +YFP+KPARSC+VVAF +  ++ ELE 
Sbjct: 84  VLAVAGSSLEQVFKVTMFISHAEYSKVVNEIYGQYFPQKPARSCVVVAFMDAAIKYELEA 143

Query: 146 VA 147
           VA
Sbjct: 144 VA 145

>SAKL0F02640g Chr6 complement(227067..227417) [351 bp, 116 aa] {ON}
           some similarities with uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to mitochondria
          Length = 116

 Score = 97.8 bits (242), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 76/118 (64%), Gaps = 4/118 (3%)

Query: 40  LLSPAFVVSSAHHLVFTSGCLGTDDQ-DQLPECPAEQTKNAFENLSKVLEASG-SSLSSV 97
           + S AF+ +S   LV+TSGC+GTD +  +LPE   +QT+NA ENL  VL  SG SSL  V
Sbjct: 1   MFSSAFISTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV 60

Query: 98  IKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIVVAFPNPKVQVELECVAVTKSRESK 155
           +KVLLFV D   VPV N++Y+ YF  +  +S  VV F N  +++E   VA  KS E++
Sbjct: 61  VKVLLFVADGKYVPVANKVYKDYFTNRSCKSSAVVGFTNEGIKIEPGSVA--KSSEAE 116

>Kpol_1033.12 s1033 complement(28172..28603) [432 bp, 143 aa] {ON}
           complement(28172..28603) [432 nt, 144 aa]
          Length = 143

 Score = 65.9 bits (159), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 60/103 (58%), Gaps = 2/103 (1%)

Query: 50  AHHLVFTSGCLG-TDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPA 108
           A++L+F SG +  T +   +    +++ +  F N++ +LEAS SSL  VIKV +F+KD  
Sbjct: 39  ANNLIFVSGQIPYTPENKPVEGSISDKAEQVFSNVTNILEASNSSLDRVIKVNVFLKDIK 98

Query: 109 LVPVVNRIYQKYFP-EKPARSCIVVAFPNPKVQVELECVAVTK 150
                N +Y KYF   KPARSC+ VA     V +E+E +A  K
Sbjct: 99  NFQEFNSVYAKYFNVHKPARSCVAVAALPLNVDLEMEVIAAEK 141

>Skud_5.171 Chr5 complement(266894..267283) [390 bp, 129 aa] {ON}
           YER057C (REAL)
          Length = 129

 Score = 65.1 bits (157), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (56%), Gaps = 2/102 (1%)

Query: 51  HHLVFTSGCLGTDDQDQLPECP-AEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPAL 109
           ++L+F SG +     ++L E   AE+ +   +N+  VLE+S SSL  V+KV +F+ D   
Sbjct: 27  NNLIFLSGQIPVTQDNKLVEGSIAEKAEQVLQNVKNVLESSNSSLDRVVKVNIFLADIKH 86

Query: 110 VPVVNRIYQKYF-PEKPARSCIVVAFPNPKVQVELECVAVTK 150
               N +Y KYF   KPARSC+ VA     V +E+E +A  K
Sbjct: 87  FAEFNSVYAKYFHTHKPARSCVAVAALPLGVDMEMEAIAAEK 128

>TPHA0K00920 Chr11 (190389..190775) [387 bp, 128 aa] {ON} Anc_7.238
           YIL051C
          Length = 128

 Score = 64.7 bits (156), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (57%), Gaps = 2/99 (2%)

Query: 54  VFTSGCLGTDDQDQL-PECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPALVPV 112
           ++ SG +  ++ ++L     A++ +  FEN+ KVL A+ S L  V+K  +F+KD      
Sbjct: 29  IYLSGQIHLNEDNKLVGGSIADKAEQIFENVQKVLAAANSDLDHVVKCNVFLKDIKDFAE 88

Query: 113 VNRIYQKYF-PEKPARSCIVVAFPNPKVQVELECVAVTK 150
            N +Y KYF   KPARSC+ VA       VE+EC+AV K
Sbjct: 89  FNTVYAKYFNSHKPARSCVAVAALPLNADVEMECIAVEK 127

>Suva_5.165 Chr5 complement(246850..247239) [390 bp, 129 aa] {ON}
           YER057C (REAL)
          Length = 129

 Score = 64.3 bits (155), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 58/104 (55%), Gaps = 2/104 (1%)

Query: 50  AHHLVFTSGCLGTDDQDQLPECP-AEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPA 108
           A++L+F SG +     ++L E   A++ +   +N+  VL AS SSL  +IKV +F+ D  
Sbjct: 26  ANNLIFLSGQIPMTSDNKLVEGSIADKAEQVIQNIKDVLAASNSSLDRIIKVNIFLADIK 85

Query: 109 LVPVVNRIYQKYF-PEKPARSCIVVAFPNPKVQVELECVAVTKS 151
                N +Y KYF   KPARSC+ VA     V +E+E +A  + 
Sbjct: 86  YFAEFNSVYAKYFTTHKPARSCVAVAALPLNVDMEVEIIAAERD 129

>NDAI0E04750 Chr5 complement(1071393..1071779) [387 bp, 128 aa] {ON}
           Anc_7.238
          Length = 128

 Score = 64.3 bits (155), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 57/100 (57%), Gaps = 2/100 (2%)

Query: 50  AHHLVFTSGCLG-TDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPA 108
           A++L+F SG +  T D   +    A++ +   +N+ KVLEAS SSL  +IKV +F+ D  
Sbjct: 25  ANNLIFLSGQIPLTSDNKPVEGSIADKAEQVIQNVKKVLEASNSSLERIIKVNIFLADIN 84

Query: 109 LVPVVNRIYQKYFP-EKPARSCIVVAFPNPKVQVELECVA 147
                N +Y KYF   KPARSC+ VA       +E+E +A
Sbjct: 85  SFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEMEVIA 124

>KNAG0D01620 Chr4 complement(272653..273081) [429 bp, 142 aa] {ON}
           Anc_7.238 YIL051C
          Length = 142

 Score = 63.9 bits (154), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (55%), Gaps = 2/102 (1%)

Query: 51  HHLVFTSGCLG-TDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPAL 109
           + +VF SG +  T D   +    +++    F+N+  +L+AS SSL  +IKV +F+KD   
Sbjct: 40  NKMVFVSGQIPYTHDNKPVEGSISKKADQVFQNIKNILDASNSSLDKIIKVNVFLKDINN 99

Query: 110 VPVVNRIYQKYFP-EKPARSCIVVAFPNPKVQVELECVAVTK 150
               N +Y KYF   KPARSC+ VA     V VE+E +A  K
Sbjct: 100 FKEFNGVYAKYFNVHKPARSCVAVAALPLDVDVEVEVIATEK 141

>ADL077C Chr4 complement(549523..549951) [429 bp, 142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL051C
           (MMF1) and YER057C (HMF1)
          Length = 142

 Score = 63.5 bits (153), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 57/103 (55%), Gaps = 2/103 (1%)

Query: 50  AHHLVFTSGCLG-TDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPA 108
           A+ +VF SG +  T D   +    A++T+    N+  VLEAS S L  V KV +F+ D A
Sbjct: 39  ANGMVFVSGQIPYTPDNKPVEGSVADKTEQVIANVRNVLEASNSGLDRVAKVNVFLADMA 98

Query: 109 LVPVVNRIYQKYFPE-KPARSCIVVAFPNPKVQVELECVAVTK 150
                N +Y KYF E KPARSC+ V      V +E+E +A+ +
Sbjct: 99  YFAEFNSVYAKYFGEHKPARSCVAVRALPLNVDLEMEVIALER 141

>YER057C Chr5 complement(270737..271126) [390 bp, 129 aa] {ON}
           HMF1Member of the p14.5 protein family with similarity
           to Mmf1p, functionally complements Mmf1p function when
           targeted to mitochondria; heat shock inducible;
           high-dosage growth inhibitor; forms a homotrimer in
           vitro
          Length = 129

 Score = 63.2 bits (152), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 58/103 (56%), Gaps = 2/103 (1%)

Query: 51  HHLVFTSGCLGTDDQDQLPECP-AEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPAL 109
           ++L+F SG +     ++L E   A++ +   +N+  VLEAS SSL  V+KV +F+ D   
Sbjct: 27  NNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIKNVLEASNSSLDRVVKVNIFLADINH 86

Query: 110 VPVVNRIYQKYF-PEKPARSCIVVAFPNPKVQVELECVAVTKS 151
               N +Y KYF   KPARSC+ VA     V +E+E +A  + 
Sbjct: 87  FAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEMEAIAAERD 129

>Smik_5.187 Chr5 complement(274856..275245) [390 bp, 129 aa] {ON}
           YER057C (REAL)
          Length = 129

 Score = 63.2 bits (152), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 58/102 (56%), Gaps = 2/102 (1%)

Query: 51  HHLVFTSGCLGTDDQDQLPECP-AEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPAL 109
           ++L+F SG +     ++L E   A++ +   +N+  VLE+S SSL  V+KV +F+ D   
Sbjct: 27  NNLIFLSGQIPVTSDNKLVEGSIADKAEQVIQNIKNVLESSNSSLDRVVKVNIFLADINH 86

Query: 110 VPVVNRIYQKYFP-EKPARSCIVVAFPNPKVQVELECVAVTK 150
               N +Y KYF   KPARSC+ VA     V +E+E +A  +
Sbjct: 87  FAEFNTVYAKYFSTHKPARSCVAVAALPLGVDMEMEAIAAER 128

>KAFR0I01830 Chr9 complement(375688..376119) [432 bp, 143 aa] {ON}
           Anc_7.238 YIL051C
          Length = 143

 Score = 63.2 bits (152), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 67/125 (53%), Gaps = 10/125 (8%)

Query: 34  LGTSNPL---LSPAFVVS-----SAHHLVFTSGCLG-TDDQDQLPECPAEQTKNAFENLS 84
           LGT  P+   L+P    S      A++ V+ SG +  T D   +    +++    F+N+ 
Sbjct: 16  LGTLTPVATKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVEGTLSDKANQVFQNVK 75

Query: 85  KVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFP-EKPARSCIVVAFPNPKVQVEL 143
            +LEAS SS++ ++KV +F+ D       N +Y KYF   KPARSC+ VA     V +E+
Sbjct: 76  NILEASNSSMNKIVKVNVFLADMKFFQEFNSVYAKYFNVHKPARSCVAVASLPLNVDLEV 135

Query: 144 ECVAV 148
           E VAV
Sbjct: 136 EVVAV 140

>TDEL0H02060 Chr8 (350315..350848) [534 bp, 177 aa] {ON} Anc_7.238
           YIL051C
          Length = 177

 Score = 63.5 bits (153), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 60/107 (56%), Gaps = 2/107 (1%)

Query: 50  AHHLVFTSGCLG-TDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPA 108
           A++L+F SG +  T +   +    A++ +  F+N+  +LEAS SS   VIKV +F+ D  
Sbjct: 68  ANNLIFVSGQIPYTPENKPVEGSIADKAEQVFKNVRNILEASDSSFERVIKVNVFLADIN 127

Query: 109 LVPVVNRIYQKYFP-EKPARSCIVVAFPNPKVQVELECVAVTKSRES 154
                N++Y KYF   KPARSC+ VA     V +E+E +A    + +
Sbjct: 128 NFAEFNKVYAKYFSTHKPARSCVAVAALPLNVDLEMEVIATENEKSA 174

>KAFR0L00860 Chr12 complement(161978..162364) [387 bp, 128 aa] {ON}
           Anc_7.238 YIL051C
          Length = 128

 Score = 62.0 bits (149), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 63/114 (55%), Gaps = 7/114 (6%)

Query: 42  SPAFVVSSAH-----HLVFTSGCLG-TDDQDQLPECPAEQTKNAFENLSKVLEASGSSLS 95
           +PA   S +H     ++++ SG +  T D   +    A++T    EN+  VL+AS SSL 
Sbjct: 12  APAQAASYSHAAKVGNMIYLSGQIPLTPDGKPVEGSIADKTTQVLENIKTVLKASNSSLE 71

Query: 96  SVIKVLLFVKDPALVPVVNRIYQKYF-PEKPARSCIVVAFPNPKVQVELECVAV 148
           +++KV +F+ D      +N +Y KYF   KPARSC+ VA       +E+E VAV
Sbjct: 72  NIVKVNIFLADIKYFSELNVVYAKYFKAHKPARSCVAVAALPLNADLEIEVVAV 125

>NCAS0E03240 Chr5 (641701..642087) [387 bp, 128 aa] {ON} Anc_7.238
          Length = 128

 Score = 61.6 bits (148), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 58/101 (57%), Gaps = 2/101 (1%)

Query: 50  AHHLVFTSGCLGTDDQDQLPECP-AEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPA 108
           A++L+F SG +    +++  E   A++ +   +N+  VLEAS SSL  ++KV +F+ D  
Sbjct: 25  ANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIKNVLEASNSSLEKIVKVNIFLADIN 84

Query: 109 LVPVVNRIYQKYFP-EKPARSCIVVAFPNPKVQVELECVAV 148
                N +Y KYF   KPARSC+ VA       +E+E +AV
Sbjct: 85  SFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEMEVIAV 125

>TPHA0C01100 Chr3 (250318..250746) [429 bp, 142 aa] {ON} Anc_7.238
           YIL051C
          Length = 142

 Score = 61.6 bits (148), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 57/100 (57%), Gaps = 2/100 (2%)

Query: 50  AHHLVFTSGCLG-TDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPA 108
           A++LVF SG +  T D   +    +++T+  F+N+  +L+AS SS   VIKV +F+ D  
Sbjct: 39  ANNLVFVSGQIPYTKDNVPVKGSISDKTEQVFQNVKNILDASNSSFDKVIKVNVFLADIN 98

Query: 109 LVPVVNRIYQKYF-PEKPARSCIVVAFPNPKVQVELECVA 147
                N +Y KYF   KPARSC+ VA       +E+E +A
Sbjct: 99  NFKEFNEVYAKYFNTHKPARSCVAVAALPLGCDLEMEVIA 138

>ZYRO0C08074g Chr3 complement(619866..620297) [432 bp, 143 aa] {ON}
           similar to uniprot|P40185 Saccharomyces cerevisiae
           YIL051C MMF1 Mitochondrial protein involved in
           maintenance of the mitochondrial genome and similar to
           YER057C uniprot|P40037 Saccharomyces cerevisiae YER057C
           HMF1 Member of the p14.5 protein family with similarity
           to Mmf1p, functionally complements Mmf1p function when
           targeted to mitochondria; heat shock inducible; high-
           dosage growth inhibitor; forms a homotrimer in vitro
          Length = 143

 Score = 60.8 bits (146), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 57/100 (57%), Gaps = 2/100 (2%)

Query: 50  AHHLVFTSGCLG-TDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPA 108
           A +L+F SG +  T D   +    +++T+  F N+  +L+A  SSL  V+KV +F+ D  
Sbjct: 40  ASNLLFVSGQIPYTPDNKPVEGSISDKTEQVFSNVKSILQAGNSSLERVVKVNVFLADIK 99

Query: 109 LVPVVNRIYQKYFPE-KPARSCIVVAFPNPKVQVELECVA 147
                N++Y KYF E +PARSC+ VA       +E+E +A
Sbjct: 100 YFEEFNKVYAKYFNEHQPARSCVAVAALPKNCDLEMEVIA 139

>TBLA0D04090 Chr4 (1016159..1016626) [468 bp, 155 aa] {ON} Anc_7.238
           YIL051C
          Length = 155

 Score = 60.1 bits (144), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 59/102 (57%), Gaps = 2/102 (1%)

Query: 51  HHLVFTSGCLG-TDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPAL 109
           + L++ SG +  T D   +    +++ +  F+N+  +L++  SSL+ V+KV +F+KD   
Sbjct: 51  NELLYVSGQIPFTPDNKPVEGSISDKAEQVFQNVENILKSGNSSLNEVVKVNVFLKDIDN 110

Query: 110 VPVVNRIYQKYFP-EKPARSCIVVAFPNPKVQVELECVAVTK 150
               N++Y KYF   KPARSC+ VA     V +E+E +A  K
Sbjct: 111 FAEFNKVYAKYFTVHKPARSCVAVAALPLNVDLEMEVIAAVK 152

>SAKL0F08558g Chr6 complement(654765..655199) [435 bp, 144 aa] {ON}
           highly similar to uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1 Mitochondrial protein involved
           in maintenance of the mitochondrial genome and similar
           to YER057C uniprot|P40037 Saccharomyces cerevisiae
           YER057C HMF1 Member of the p14.5 protein family with
           similarity to Mmf1p, functionally complements Mmf1p
           function when targeted to mitochondria; heat shock
           inducible; high- dosage growth inhibitor; forms a
           homotrimer in vitro
          Length = 144

 Score = 59.3 bits (142), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 72/139 (51%), Gaps = 13/139 (9%)

Query: 25  NMSRVDWNQLGTSNPLLS--------PAFVVSSA---HHLVFTSGCLG-TDDQDQLPECP 72
           N +R+ +N L T + L          PA   S A   +++VF SG +  T +   +    
Sbjct: 5   NSARLAFNNLRTMSTLTPVRTQLAPPPAASYSQAIKVNNMVFVSGQIPYTHENKPVEGSI 64

Query: 73  AEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPE-KPARSCIV 131
           A++ +   +N+  +LE + SSL+ ++KV +F+ D       N +Y KYF E KPARSC+ 
Sbjct: 65  ADKAEQVIQNVKNILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVA 124

Query: 132 VAFPNPKVQVELECVAVTK 150
           V      V +E+E +AV K
Sbjct: 125 VKSLPLNVDLEMEVIAVEK 143

>Kwal_23.5804 s23 complement(1324907..1325332) [426 bp, 141 aa] {ON}
           YIL051C (MMF1) - Maintenance of Mitochondrial DNA 1
           [contig 11] FULL
          Length = 141

 Score = 59.3 bits (142), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 69/137 (50%), Gaps = 10/137 (7%)

Query: 25  NMSRVDWNQLGTSNPLLS-----PAFVVSSA---HHLVFTSGCLG-TDDQDQLPECPAEQ 75
           N +R  +  + T  P+ +     PA   S A   + +VF SG +  T +  ++    A++
Sbjct: 5   NAARNTFRSMSTLTPVRTQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENKRVEGTIADK 64

Query: 76  TKNAFENLSKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPE-KPARSCIVVAF 134
            +   +N+  +LE + S L  ++KV +F+ D       N +Y KYF E KPARSC+ V  
Sbjct: 65  AEQVIQNVRNILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHKPARSCVAVKA 124

Query: 135 PNPKVQVELECVAVTKS 151
               V +E+E VAV K 
Sbjct: 125 LPLDVDLEMEVVAVEKD 141

>KNAG0L01450 Chr12 complement(258500..258895) [396 bp, 131 aa] {ON}
           Anc_7.238 YIL051C
          Length = 131

 Score = 58.9 bits (141), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 55/101 (54%), Gaps = 2/101 (1%)

Query: 50  AHHLVFTSGCLG-TDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPA 108
           A++LVF SG +  T D   L    AE+ +    N+  +L AS S+L  V+K  +F+ D  
Sbjct: 27  ANNLVFVSGQVPLTADNKMLEGSIAEKAEQVITNIKTILAASNSALDRVVKCNIFLADIN 86

Query: 109 LVPVVNRIYQKYFPE-KPARSCIVVAFPNPKVQVELECVAV 148
                N +Y K+F + KPARSC+ VA       +E+E +AV
Sbjct: 87  NFAEFNTVYAKHFHDHKPARSCVAVAALPLNADLEMEVIAV 127

>NDAI0A02550 Chr1 complement(570003..570437) [435 bp, 144 aa] {ON}
           Anc_7.238
          Length = 144

 Score = 59.3 bits (142), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 58/103 (56%), Gaps = 2/103 (1%)

Query: 50  AHHLVFTSGCLG-TDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPA 108
           A++ V+ SG +  T +   +    +++ +  F+N+  +LEAS SSL  ++KV +F+ D  
Sbjct: 42  ANNFVYVSGQIPYTPENKPVEGSISDKAEQVFQNVRNILEASNSSLDKIVKVNVFLADIN 101

Query: 109 LVPVVNRIYQKYF-PEKPARSCIVVAFPNPKVQVELECVAVTK 150
                N +Y KYF   KPARSC+ V      V +E+E +AV K
Sbjct: 102 NFKEFNGVYAKYFNTHKPARSCVAVKALPLNVDLEVEVIAVEK 144

>YIL051C Chr9 complement(257843..258280) [438 bp, 145 aa] {ON}
           MMF1Mitochondrial protein required for transamination of
           isoleucine but not of valine or leucine; may regulate
           specificity of branched-chain transaminases Bat1p and
           Bat2p; interacts genetically with mitochondrial
           ribosomal protein genes
          Length = 145

 Score = 58.9 bits (141), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 59/104 (56%), Gaps = 2/104 (1%)

Query: 50  AHHLVFTSGCLG-TDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPA 108
           A++ V+ SG +  T D   +    +E+ +  F+N+  +L  S SSL +++KV +F+ D  
Sbjct: 42  ANNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMK 101

Query: 109 LVPVVNRIYQKYF-PEKPARSCIVVAFPNPKVQVELECVAVTKS 151
                N +Y K+F   KPARSC+ VA     V +E+E +AV K+
Sbjct: 102 NFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEMEVIAVEKN 145

>KLTH0A04224g Chr1 complement(356660..357085) [426 bp, 141 aa] {ON}
           highly similar to uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1 Mitochondrial protein involved
           in maintenance of the mitochondrial genome and similar
           to YER057C uniprot|P40037 Saccharomyces cerevisiae
           YER057C HMF1 Member of the p14.5 protein family with
           similarity to Mmf1p, functionally complements Mmf1p
           function when targeted to mitochondria; heat shock
           inducible; high- dosage growth inhibitor; forms a
           homotrimer in vitro
          Length = 141

 Score = 58.5 bits (140), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 71/136 (52%), Gaps = 10/136 (7%)

Query: 25  NMSRVDWNQLGTSNPLLS-----PAFVVSSA---HHLVFTSGCLG-TDDQDQLPECPAEQ 75
           N +R  +  + T  P+ +     PA   S A   +++VF SG +  T +  ++     ++
Sbjct: 5   NAARQTFRTMSTLTPVRTQLSPPPAASYSQAMKVNNMVFVSGQIPYTAENKRVEGTMTDK 64

Query: 76  TKNAFENLSKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPE-KPARSCIVVAF 134
            +   +N+  +LE + S+L+ ++KV +F+ D       N +Y KYF E KPARSC+ V  
Sbjct: 65  AEQVIQNVKNILEEANSALNKIVKVNIFLADINDFAEFNGVYGKYFNEHKPARSCVAVKD 124

Query: 135 PNPKVQVELECVAVTK 150
               V +E+E VAV K
Sbjct: 125 LPLNVDLEMEVVAVEK 140

>Smik_9.139 Chr9 complement(231954..232391) [438 bp, 145 aa] {ON}
           YIL051C (REAL)
          Length = 145

 Score = 58.5 bits (140), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 59/104 (56%), Gaps = 2/104 (1%)

Query: 50  AHHLVFTSGCLG-TDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPA 108
           A++ V+ SG +  T +   +    +++ +  F+N+  +L  S SSL +++KV +F+ D  
Sbjct: 42  ANNFVYVSGQIPYTPENKPVQGSISDKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMK 101

Query: 109 LVPVVNRIYQKYF-PEKPARSCIVVAFPNPKVQVELECVAVTKS 151
                N +Y KYF   KPARSC+ VA     V +E+E +AV KS
Sbjct: 102 NFGEFNSVYAKYFHTHKPARSCVGVASLPLNVDLEMEVIAVEKS 145

>Suva_9.148 Chr9 complement(246539..246976) [438 bp, 145 aa] {ON}
           YIL051C (REAL)
          Length = 145

 Score = 57.8 bits (138), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 60/104 (57%), Gaps = 2/104 (1%)

Query: 50  AHHLVFTSGCLG-TDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPA 108
           A++ V+ SG +  T +   +    +++ +  F+N+  +L  S SSL+SV+KV +F+ D  
Sbjct: 42  ANNFVYVSGQIPYTAENKPVQGSISDKAEQVFQNVKNILAESNSSLNSVVKVNVFLADMK 101

Query: 109 LVPVVNRIYQKYF-PEKPARSCIVVAFPNPKVQVELECVAVTKS 151
                N +Y K+F   KPARSC+ VA     V +E+E +AV K+
Sbjct: 102 NFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEMEVIAVEKN 145

>NCAS0A13490 Chr1 (2655822..2656268) [447 bp, 148 aa] {ON} Anc_7.238
          Length = 148

 Score = 57.0 bits (136), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 58/103 (56%), Gaps = 2/103 (1%)

Query: 50  AHHLVFTSGCLG-TDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPA 108
           A++ V+ SG +  T +   +    +++ +  F+N+  +L+ SGSS+  ++KV +F+ D  
Sbjct: 42  ANNFVYVSGQIPYTPENKPVEGTISDKAEQVFQNIKNILKESGSSMDKIVKVNVFLADIN 101

Query: 109 LVPVVNRIYQKYFP-EKPARSCIVVAFPNPKVQVELECVAVTK 150
                N +Y KYF   KPARSC+ V      V +E+E +AV K
Sbjct: 102 NFKEFNGVYAKYFNVHKPARSCVAVKDLPLNVDLEVEVIAVEK 144

>Skud_9.118 Chr9 complement(226723..227160) [438 bp, 145 aa] {ON}
           YIL051C (REAL)
          Length = 145

 Score = 55.8 bits (133), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 57/104 (54%), Gaps = 2/104 (1%)

Query: 50  AHHLVFTSGCLG-TDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPA 108
           A+  V+ SG +  T     +    +++ +  F+N+  +L  S SSL +++KV +F+ D  
Sbjct: 42  ANSFVYVSGQIPYTAANKPVQGSISDKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMK 101

Query: 109 LVPVVNRIYQKYF-PEKPARSCIVVAFPNPKVQVELECVAVTKS 151
                N +Y KYF   KPARSC+ VA     V +E+E +AV K+
Sbjct: 102 NFAEFNSVYAKYFHTHKPARSCVGVASLPLNVDLEMEVIAVEKN 145

>TBLA0J01420 Chr10 (325885..326265) [381 bp, 126 aa] {ON} Anc_7.238
           YIL051C
          Length = 126

 Score = 55.1 bits (131), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 54/98 (55%), Gaps = 2/98 (2%)

Query: 53  LVFTSGCLGT-DDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPALVP 111
            ++ SG +    D  ++    +++    F+N+S +LE +GSSL+ +IKV +F+ +     
Sbjct: 28  FIYVSGQIALLPDGTRVEGSISDKAHQIFKNISAILETAGSSLNKIIKVNIFLANIKDFE 87

Query: 112 VVNRIYQKYF-PEKPARSCIVVAFPNPKVQVELECVAV 148
             N  Y KYF   KPARSC+ VA       VE+E VA+
Sbjct: 88  EFNATYIKYFNTHKPARSCVAVAALPLGADVEVEVVAL 125

>CAGL0M12386g Chr13 (1236543..1236971) [429 bp, 142 aa] {ON} similar
           to uniprot|P40037 Saccharomyces cerevisiae YER057c HIG1
           Heat-shock induceable Inhibiter of cell Growth
          Length = 142

 Score = 55.5 bits (132), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 56/99 (56%), Gaps = 2/99 (2%)

Query: 51  HHLVFTSGCL-GTDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPAL 109
           ++L++ SG +  T D   +    +++ +   +N+  +L+ S S L+ ++KV +F+ D   
Sbjct: 40  NNLIYVSGQIPYTKDNKPVEGSISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADMNN 99

Query: 110 VPVVNRIYQKYFP-EKPARSCIVVAFPNPKVQVELECVA 147
               N++Y KYF   KPARSC+ VA     V +E+E +A
Sbjct: 100 FAEFNKVYAKYFNVHKPARSCVAVAALPLGVDLEMEVIA 138

>Kpol_1009.25 s1009 complement(58847..59230) [384 bp, 127 aa] {ON}
           complement(58847..59230) [384 nt, 128 aa]
          Length = 127

 Score = 55.1 bits (131), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 58/101 (57%), Gaps = 2/101 (1%)

Query: 50  AHHLVFTSGCLG-TDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPA 108
           A+ +++ SG +  T +   +    ++Q +   +N+  +LE++ SSL+ ++KV +F+ D  
Sbjct: 25  ANGMIYVSGQIPYTKENKPIGGTVSDQAEQMIQNVKNILESANSSLNKIVKVNVFLTDMN 84

Query: 109 LVPVVNRIYQKYFPE-KPARSCIVVAFPNPKVQVELECVAV 148
                N +Y KYF E KPARSC+ VA       +E+E VAV
Sbjct: 85  HFQEFNVVYAKYFSEHKPARSCVAVAALPLDNIMEMEVVAV 125

>KLLA0C08349g Chr3 (731629..732051) [423 bp, 140 aa] {ON} similar to
           uniprot|P40185 Saccharomyces cerevisiae YIL051C MMF1
           Mitochondrial protein involved in maintenance of the
           mitochondrial genome and similar to YER057C
           uniprot|P40037 Saccharomyces cerevisiae YER057C HMF1
           Member of the p14.5 protein family with similarity to
           Mmf1p, functionally complements Mmf1p function when
           targeted to mitochondria; heat shock inducible; high-
           dosage growth inhibitor; forms a homotrimer in vitro
          Length = 140

 Score = 50.4 bits (119), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 53/102 (51%), Gaps = 2/102 (1%)

Query: 51  HHLVFTSGCLG-TDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPAL 109
           ++L+F SG +  T +   +    A++ +   +N+  +L  + S L  ++KV +F+ D   
Sbjct: 38  NNLIFVSGQIPYTAENKPVEGSIADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADINS 97

Query: 110 VPVVNRIYQKYFP-EKPARSCIVVAFPNPKVQVELECVAVTK 150
               N +Y KYF   KPARSC+        V +E+E +AV K
Sbjct: 98  FAEFNSVYAKYFNVHKPARSCVAAKALPLNVDLEMEVIAVEK 139

>ZYRO0F14014g Chr6 (1151774..1153783) [2010 bp, 669 aa] {ON} similar
           to uniprot|Q07261 Saccharomyces cerevisiae YLR143W
           Hypothetical ORF
          Length = 669

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 6/69 (8%)

Query: 74  EQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYF------PEKPAR 127
           EQ ++ F+ L  +L+ + +  S V+   L + D +L P VN+IY  YF      P  PAR
Sbjct: 331 EQMQDIFKQLDDILKKNRTKPSQVLHCTLILDDMSLFPQVNQIYSSYFDVIKNGPLPPAR 390

Query: 128 SCIVVAFPN 136
           +CI     N
Sbjct: 391 ACISSMLGN 399

>SAKL0H14938g Chr8 complement(1295178..1297253) [2076 bp, 691 aa]
           {ON} similar to uniprot|Q07261 Saccharomyces cerevisiae
           YLR143W Hypothetical ORF
          Length = 691

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 39/90 (43%), Gaps = 6/90 (6%)

Query: 68  LPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYF------ 121
            P    EQ  + F+ L  +L   G   S V+   L + D +   +VN +Y K+F      
Sbjct: 327 FPGSTVEQASDVFKQLDTILNERGLYPSQVLSCALILSDISAFALVNDVYNKFFNIWKIG 386

Query: 122 PEKPARSCIVVAFPNPKVQVELECVAVTKS 151
           P  P+RSC+        V ++L  V  T +
Sbjct: 387 PLPPSRSCVGSKLLGKDVALQLSVVVDTTA 416

>Suva_10.239 Chr10 (436127..438196) [2070 bp, 689 aa] {ON} YLR143W
           (REAL)
          Length = 689

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 44/87 (50%), Gaps = 6/87 (6%)

Query: 74  EQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQ------KYFPEKPAR 127
           EQ+K+ F  L+ +L ++    S ++   L VKD +    +N+IY       KY P  P+R
Sbjct: 337 EQSKDIFTELADILRSNRIPRSHILSSSLLVKDMSNFGKINKIYNEFLNVTKYGPLPPSR 396

Query: 128 SCIVVAFPNPKVQVELECVAVTKSRES 154
           +C+   +      V+L  V  T+ R++
Sbjct: 397 ACVGSGYLPEGCHVQLSVVIDTEVRKT 423

>NDAI0G02460 Chr7 complement(560518..562671) [2154 bp, 717 aa] {ON}
          Length = 717

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 7/89 (7%)

Query: 74  EQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYF------PEKPAR 127
           +Q +N FE L+K+L       S  +   L ++D +    VN IY K+F      P  P+R
Sbjct: 345 KQAENVFEQLAKILNDENLFPSQTLYSSLILRDMSQFSKVNGIYNKFFNTFKVGPLPPSR 404

Query: 128 SCIVVAFPNPKVQVELECVAVTKSRESKL 156
           +C+         Q++L  V + +++ES+L
Sbjct: 405 ACVGSELLANDCQLQLSIV-LDRTKESQL 432

>Skud_12.214 Chr12 (410879..412933) [2055 bp, 684 aa] {ON} YLR143W
           (REAL)
          Length = 684

 Score = 37.7 bits (86), Expect = 0.006,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 6/63 (9%)

Query: 74  EQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQ------KYFPEKPAR 127
           EQ ++ F  L+ +L ++G+S + ++   L V+D      +N IY       KY P  P+R
Sbjct: 337 EQCQDIFAELAAILRSNGTSRNHILSSSLIVRDMCDFGKINNIYNEFLDLTKYGPLPPSR 396

Query: 128 SCI 130
           +C+
Sbjct: 397 ACV 399

>CAGL0M04521g Chr13 (496157..498223) [2067 bp, 688 aa] {ON} similar
           to uniprot|Q12429 Saccharomyces cerevisiae YLR143w
          Length = 688

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 6/79 (7%)

Query: 74  EQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYF------PEKPAR 127
           EQ K+  + L  +L+ +  +  +V+   L + D +L   VN+ Y K+F      P  PAR
Sbjct: 339 EQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDMSLFASVNQEYSKFFDIWKNGPLPPAR 398

Query: 128 SCIVVAFPNPKVQVELECV 146
           +CI     N    ++L  V
Sbjct: 399 ACIESNIINDGSALQLSVV 417

>TDEL0F04730 Chr6 (889641..891725) [2085 bp, 694 aa] {ON} Anc_8.349
           YLR143W
          Length = 694

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 6/62 (9%)

Query: 75  QTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYF------PEKPARS 128
           QT+   + L+ ++E  G S S  I   L +   +   VVN IY +YF      P  P+R+
Sbjct: 340 QTRQVLDALNVIIEKWGISPSQAINCTLVLSSMSNFAVVNEIYSEYFDISKYGPLPPSRA 399

Query: 129 CI 130
           CI
Sbjct: 400 CI 401

>YLR143W Chr12 (427329..429386) [2058 bp, 685 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-tagged protein localizes to the cytoplasm; YLR143W
           is not an essential gene
          Length = 685

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 37/72 (51%), Gaps = 6/72 (8%)

Query: 65  QDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQ------ 118
           Q +  E   +Q+++ F  L+ +L ++    + ++   L ++D +    +N+IY       
Sbjct: 328 QSRKSETVEKQSEDIFTELADILHSNQIPRNHILSASLLIRDMSNFGKINKIYNEFLDLS 387

Query: 119 KYFPEKPARSCI 130
           KY P  P+R+C+
Sbjct: 388 KYGPLPPSRACV 399

>TPHA0C00650 Chr3 complement(123052..125187) [2136 bp, 711 aa] {ON}
           Anc_8.349 YLR143W
          Length = 711

 Score = 33.5 bits (75), Expect = 0.20,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 10/90 (11%)

Query: 47  VSSAHHLVFTSGCLGTDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKD 106
           V+  ++L++ S  L T  QD   E    Q K+ F++L K+L  +    S ++   L++ +
Sbjct: 318 VNKVNNLMYISNILPTT-QDTSIEV---QIKSLFQHLDKILIENNIKPSQILSSTLYLSN 373

Query: 107 PALVPVVNRIYQKYF------PEKPARSCI 130
                 VN++Y  +F      P  P+R+C+
Sbjct: 374 IRDFANVNKVYNDFFDIEKNGPLPPSRACV 403

>Smik_12.209 Chr12 (409793..411847) [2055 bp, 684 aa] {ON} YLR143W
           (REAL)
          Length = 684

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 6/63 (9%)

Query: 74  EQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQ------KYFPEKPAR 127
           EQ  + F  L+ +L ++    + ++   L +KD +    +N+IY       KY P  P+R
Sbjct: 337 EQGDDIFSELADILRSNQIPRNHILSSSLLIKDMSNFGRINKIYNEFLDLTKYGPLPPSR 396

Query: 128 SCI 130
           +C+
Sbjct: 397 ACV 399

>Kpol_1036.86 s1036 (225185..227278) [2094 bp, 697 aa] {ON}
           (225185..227278) [2094 nt, 698 aa]
          Length = 697

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 6/62 (9%)

Query: 75  QTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYF------PEKPARS 128
           Q +N F  L  +L     S + V+   L++ + +    VN+IY  YF      P  P+R+
Sbjct: 341 QVENVFNQLDSILGEKTYSRAQVLNSSLYLFNMSDFSKVNKIYNNYFDIQKFGPLPPSRA 400

Query: 129 CI 130
           C+
Sbjct: 401 CV 402

>Kpol_257.2 s257 complement(3732..4646) [915 bp, 304 aa] {ON}
           complement(3732..4646) [915 nt, 305 aa]
          Length = 304

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 6/58 (10%)

Query: 76  TKNAFENLSKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIVVA 133
           +KN  E    +L+  G S+SS   V+ +VK+ ++      I Q Y+PE+  +  I+ A
Sbjct: 166 SKNLVETSCTILDLKGISISSFYNVIGYVKEASV------IGQNYYPERMGKFYIINA 217

>Suva_11.134 Chr11 complement(255890..256822) [933 bp, 310 aa] {ON}
           YKL091C (REAL)
          Length = 310

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 7/67 (10%)

Query: 65  QDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPEK 124
           + ++P C + +     E    VL+  G SLS+   VL ++KD      V  I Q Y+PE+
Sbjct: 158 RHRVPAC-SRRVGYLIETSCTVLDLKGISLSNAYHVLSYIKD------VASISQNYYPER 210

Query: 125 PARSCIV 131
             +  I+
Sbjct: 211 MGKFYII 217

>Smik_11.149 Chr11 complement(256076..257008) [933 bp, 310 aa] {ON}
           YKL091C (REAL)
          Length = 310

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 6/46 (13%)

Query: 86  VLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIV 131
           VL+  G SLS+   VL ++KD      V  I Q Y+PE+  +  I+
Sbjct: 178 VLDLKGISLSNAYHVLSYIKD------VADISQNYYPERMGKFYII 217

>YKL091C Chr11 complement(269718..270650) [933 bp, 310 aa] {ON}
           Putative homolog of Sec14p, which is a
           phosphatidylinositol/phosphatidylcholine transfer
           protein involved in lipid metabolism; localizes to the
           nucleus; contains a CRAL/TRIO domain and binds several
           lipids in a large-scale study
          Length = 310

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 6/46 (13%)

Query: 86  VLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIV 131
           VL+  G SLS+   VL ++KD      V  I Q Y+PE+  +  I+
Sbjct: 178 VLDLKGISLSNAYHVLSYIKD------VADISQNYYPERMGKFYII 217

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score = 30.0 bits (66), Expect = 2.6,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 32/68 (47%), Gaps = 9/68 (13%)

Query: 2   RKGYYYLEYGTTKLCKT---------TVGTASNMSRVDWNQLGTSNPLLSPAFVVSSAHH 52
           RK Y+ L+   ++  +T         ++ + SN S ++   L + N +LSP +  +  H 
Sbjct: 39  RKDYFQLKKNYSQDSQTNTSMNEVIGSISSVSNDSDINSENLQSENKVLSPKYFKNRTHE 98

Query: 53  LVFTSGCL 60
            +F   C+
Sbjct: 99  YLFIISCM 106

>Skud_11.137 Chr11 complement(255229..256161) [933 bp, 310 aa] {ON}
           YKL091C (REAL)
          Length = 310

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 6/46 (13%)

Query: 86  VLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIV 131
           VL+  G SLS+   VL ++KD      V  I Q Y+PE+  +  I+
Sbjct: 178 VLDLKGISLSNAYHVLSYIKD------VADISQNYYPERIGKFYII 217

>Kpol_1070.32 s1070 complement(72051..73328) [1278 bp, 425 aa] {ON}
           complement(72051..73328) [1278 nt, 426 aa]
          Length = 425

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 9/29 (31%), Positives = 19/29 (65%)

Query: 3   KGYYYLEYGTTKLCKTTVGTASNMSRVDW 31
           + +Y++EYG+  + K  VG  +N+ + D+
Sbjct: 342 ENFYFIEYGSADVIKEGVGIVANLKQHDY 370

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,465,623
Number of extensions: 633272
Number of successful extensions: 1842
Number of sequences better than 10.0: 67
Number of HSP's gapped: 1796
Number of HSP's successfully gapped: 67
Length of query: 156
Length of database: 53,481,399
Length adjustment: 100
Effective length of query: 56
Effective length of database: 42,014,799
Effective search space: 2352828744
Effective search space used: 2352828744
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)