Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D09812g3.496ON1851858251e-113
Kpol_1017.43.496ON1841653667e-44
KLTH0F14938g3.496ON2291703593e-42
SAKL0F02618g3.496ON2531663595e-42
Suva_16.4793.496ON2121443541e-41
Kwal_55.212483.496ON2221663506e-41
YPR151C (SUE1)3.496ON2061443434e-40
Smik_16.4033.496ON2031433418e-40
Skud_16.4453.496ON2151433392e-39
TPHA0D033003.496ON1961893302e-38
KNAG0A079603.496ON1771683102e-35
NDAI0B058903.496ON2781612972e-32
KLLA0E03983g3.496ON1911552624e-28
TDEL0D056403.496ON124602062e-20
NCAS0F035703.496ON2301652122e-20
CAGL0L08426g3.496ON1401502062e-20
TBLA0D029403.496ON71531803e-17
Ecym_12333.496ON87431612e-14
KAFR0G037103.496ON79561561e-13
ZYRO0F07480g8.682ON2361451352e-09
AFR315C3.496ON77431254e-09
TPHA0D012908.682ON2181491151e-06
NCAS0C013108.682ON2571411098e-06
Skud_16.1238.682ON255541072e-05
Suva_16.1518.682ON253501052e-05
KNAG0J017608.682ON2581431053e-05
Kpol_1013.98.682ON2611381044e-05
Smik_6.3568.682ON25339992e-04
YPL159C (PET20)8.682ON25332992e-04
NDAI0K013208.682ON25830992e-04
SAKL0H06380g8.682ON21936955e-04
TDEL0A062708.682ON242138946e-04
Kwal_26.88288.682ON22328947e-04
KLLA0D06061g8.682ON24928947e-04
TPHA0G015708.682ON25544930.001
KLLA0A07447g3.62ON486153920.002
KLTH0D11396g8.682ON22528890.003
CAGL0M02101g8.682ON26745870.006
TBLA0B038008.682ON32428850.012
Kpol_1072.128.682ON22230810.033
KAFR0H023808.682ON22037810.034
TDEL0E007103.62ON476139800.060
YNL295W3.62ON52460770.14
NCAS0A099403.62ON49438760.22
Kpol_1066.443.62ON47928750.23
Ecym_23908.682ON22728720.50
ZYRO0C02244g3.62ON46027720.53
TBLA0B085103.62ON50128701.2
Skud_14.423.62ON52437691.6
Smik_14.363.62ON52450691.7
SAKL0C12342g3.62ON552140672.7
TPHA0P012603.62ON49427654.3
Suva_14.443.62ON52540645.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D09812g
         (185 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar...   322   e-113
Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON} (17411..1...   145   7e-44
KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa] ...   142   3e-42
SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar...   142   5e-42
Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {O...   140   1e-41
Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {O...   139   6e-41
YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}  ...   136   4e-40
Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {O...   135   8e-40
Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {O...   135   2e-39
TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON...   131   2e-38
KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {...   124   2e-35
NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {...   119   2e-32
KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar...   105   4e-28
TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {...    84   2e-20
NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON...    86   2e-20
CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} simila...    84   2e-20
TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496...    74   3e-17
Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to ...    67   2e-14
KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}...    65   1e-13
ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar...    57   2e-09
AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON} S...    53   4e-09
TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.68...    49   1e-06
NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON...    47   8e-06
Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {O...    46   2e-05
Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {O...    45   2e-05
KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.6...    45   3e-05
Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON} (15300..1...    45   4e-05
Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C (...    43   2e-04
YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}  ...    43   2e-04
NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {O...    43   2e-04
SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {O...    41   5e-04
TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8....    41   6e-04
Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C ...    41   7e-04
KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly ...    41   7e-04
TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON...    40   0.001
KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} simila...    40   0.002
KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar...    39   0.003
CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {...    38   0.006
TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON...    37   0.012
Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON...    36   0.033
KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON...    36   0.034
TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.6...    35   0.060
YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative pro...    34   0.14 
NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa] ...    34   0.22 
Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {O...    33   0.23 
Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON} ...    32   0.50 
ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {...    32   0.53 
TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa] ...    32   1.2  
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    31   1.6  
Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W (...    31   1.7  
SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]...    30   2.7  
TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {...    30   4.3  
Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W (...    29   5.7  

>ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 185

 Score =  322 bits (825), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 160/185 (86%)

Query: 1   MMSKRLFSTATIRSFKRKCCSSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKE 60
           MMSKRLFSTATIRSFKRKCCSSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKE
Sbjct: 1   MMSKRLFSTATIRSFKRKCCSSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKE 60

Query: 61  NPLFKERTRNGELTDELQSRHNSGLRQGRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXXX 120
           NPLFKERTRNGELTDELQSRHNSGLRQGRTQ         YSVI                
Sbjct: 61  NPLFKERTRNGELTDELQSRHNSGLRQGRTQEEEKESGEEYSVIAGPRGCGGIASGGASG 120

Query: 121 TWRNGAKMPSKLLPYSWWSTTSMGMEFFPEWEGVPRHVVRKLKPFDRGHDTLDILESIKV 180
           TWRNGAKMPSKLLPYSWWSTTSMGMEFFPEWEGVPRHVVRKLKPFDRGHDTLDILESIKV
Sbjct: 121 TWRNGAKMPSKLLPYSWWSTTSMGMEFFPEWEGVPRHVVRKLKPFDRGHDTLDILESIKV 180

Query: 181 NGNPK 185
           NGNPK
Sbjct: 181 NGNPK 185

>Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON}
           (17411..17965) [555 nt, 185 aa]
          Length = 184

 Score =  145 bits (366), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 77/165 (46%), Positives = 98/165 (59%), Gaps = 4/165 (2%)

Query: 5   RLFSTATIRSFKRKCCSS--DIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENP 62
           R +S+  IR  KRK  S    IFRS+PRVPTTQFLES  LT DILFSGYRP+ YPVKENP
Sbjct: 14  RCYSSTPIRFMKRKMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENP 73

Query: 63  LFKE--RTRNGELTDELQSRHNSGLRQGRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXXX 120
           LF+    T+N    D + +  NS       +         ++ +                
Sbjct: 74  LFRNTGNTKNIFGQDLVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNG 133

Query: 121 TWRNGAKMPSKLLPYSWWSTTSMGMEFFPEWEGVPRHVVRKLKPF 165
           TWR   ++PSKLLPYSWWST+ MGME++PEW+ +PR VV+ LKP+
Sbjct: 134 TWRFNPRVPSKLLPYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPY 178

>KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa]
           {ON} weakly similar to uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 229

 Score =  142 bits (359), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 81/170 (47%), Positives = 100/170 (58%), Gaps = 13/170 (7%)

Query: 1   MMSKRLFSTATIRSFKRKCCSSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKE 60
           M  KR FS    +  KRK  SS+IFRS+P+VPTTQ+LE  ELTRDIL+SGYRPV+YPVKE
Sbjct: 1   MAHKRQFSLEASKMLKRK--SSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKE 58

Query: 61  NPLFKERT-RNGELTDELQSRHNSGLRQGRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXX 119
           NPLFKE   +   L  E  +R +S + Q              + +               
Sbjct: 59  NPLFKEAGWKTQRLRGERGARKSSTVPQS----------SEMNAMAGPLGTGGIGSGGVN 108

Query: 120 XTWRNGAKMPSKLLPYSWWSTTSMGMEFFPEWEGVPRHVVRKLKPFDRGH 169
            TWR   ++PSKLLPY+ WS TSM ME+ PEW  VPR VV KL+PF+  H
Sbjct: 109 GTWRYNPRIPSKLLPYNLWSCTSMAMEYHPEWLAVPRTVVNKLRPFESPH 158

>SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar to
           uniprot|Q06524 Saccharomyces cerevisiae YPR151C SUE1
           Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 253

 Score =  142 bits (359), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 74/166 (44%), Positives = 99/166 (59%), Gaps = 7/166 (4%)

Query: 1   MMSKRLFSTATIRSFKRKCCSSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKE 60
           M   RLFST      K+K  +SDIFR +P+VPTTQFLE RELTRDILFSGYRPV YPVKE
Sbjct: 1   MKQSRLFSTTATNMIKKK--NSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKE 58

Query: 61  NPLFKERTRNGELTDELQSRHNSGLRQGRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXXX 120
           NP F   T+   L  E  ++     ++ + +         ++V+                
Sbjct: 59  NPFFNIGTQRKGLAGETSAK-----KEYKNEAERENEKEEHNVMAGPRGTGGIVSGGVNG 113

Query: 121 TWRNGAKMPSKLLPYSWWSTTSMGMEFFPEWEGVPRHVVRKLKPFD 166
           TWR   ++P+KLLPY+ WS+++M ME++PEW  VP+ +  KLKPFD
Sbjct: 114 TWRYNPRIPTKLLPYNLWSSSTMAMEYYPEWLNVPKTIANKLKPFD 159

>Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {ON}
           YPR151C (REAL)
          Length = 212

 Score =  140 bits (354), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 70/144 (48%), Positives = 92/144 (63%), Gaps = 6/144 (4%)

Query: 25  FRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDELQSRHNSG 84
           FRS+P+VPTTQ+LE+RELTRDIL+SGYRPVMYPVKENPLF+++ +   L   L S     
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKS-LQMLLASDEKPA 120

Query: 85  LRQGRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXXXTWRNGAKMPSKLLPYSWWSTTSMG 144
                T+          +V                 TW+    +P++LLPY+WWST+SMG
Sbjct: 121 -----TEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMG 175

Query: 145 MEFFPEWEGVPRHVVRKLKPFDRG 168
           ME+FPEW+ VP +++RKLKPFDR 
Sbjct: 176 MEYFPEWKNVPSYMMRKLKPFDRA 199

>Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {ON}
           YPR151C - Hypothetical ORF [contig 130] FULL
          Length = 222

 Score =  139 bits (350), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 78/166 (46%), Positives = 95/166 (57%), Gaps = 11/166 (6%)

Query: 1   MMSKRLFSTATIRSFKRKCCSSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKE 60
           M  KR F     +  KR+  SSDIFRS+P+VPTTQ+LE  ELTRDIL+SGYRPV+YPVKE
Sbjct: 1   MAQKRQFCVEASKMLKRR--SSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKE 58

Query: 61  NPLFKERTRNGELTDELQSRHNSGLRQGRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXXX 120
           NPLFKE    G  T  L+         G             + +                
Sbjct: 59  NPLFKE---TGWKTQRLREEP------GSDTALTAAKESSKNAMAGPQGTGGIGSGGVNG 109

Query: 121 TWRNGAKMPSKLLPYSWWSTTSMGMEFFPEWEGVPRHVVRKLKPFD 166
           TWR   ++PSKLLP+S WS+TSM ME+ PEW  VPR VV KL+PF+
Sbjct: 110 TWRYNPRIPSKLLPFSLWSSTSMAMEYHPEWLAVPRTVVNKLRPFN 155

>YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}
           SUE1Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 206

 Score =  136 bits (343), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 95/144 (65%), Gaps = 6/144 (4%)

Query: 25  FRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDELQSRHNSG 84
           FRS+P+VPTTQ+LE+RELTRDIL+SGYRPVMYPVKENPLF+++ R    T  L + +   
Sbjct: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQT--LLTMNEKT 112

Query: 85  LRQGRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXXXTWRNGAKMPSKLLPYSWWSTTSMG 144
             + +T           +++                TW+    +P++LLP++WWST+SMG
Sbjct: 113 NAEAKT----IDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMG 168

Query: 145 MEFFPEWEGVPRHVVRKLKPFDRG 168
           ME+FPEW+ VP +++RKLKPFD+ 
Sbjct: 169 MEYFPEWKNVPPYMMRKLKPFDKA 192

>Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {ON}
           YPR151C (REAL)
          Length = 203

 Score =  135 bits (341), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 64/143 (44%), Positives = 93/143 (65%), Gaps = 6/143 (4%)

Query: 25  FRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDELQSRHNSG 84
           FRS+P+VPTTQ+LE+RELTRDIL+SGYRPVMYPVKENPLF+++ +       L +   + 
Sbjct: 53  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKS--LQMLLTADEAP 110

Query: 85  LRQGRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXXXTWRNGAKMPSKLLPYSWWSTTSMG 144
           + + +T           +++                TW+    +P++LLP++WWST+SMG
Sbjct: 111 ITEAKTTEKSKHK----NILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMG 166

Query: 145 MEFFPEWEGVPRHVVRKLKPFDR 167
           ME+FPEW  +P ++ RKLKPFD+
Sbjct: 167 MEYFPEWRNIPSYMTRKLKPFDK 189

>Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {ON}
           YPR151C (REAL)
          Length = 215

 Score =  135 bits (339), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 68/143 (47%), Positives = 93/143 (65%), Gaps = 6/143 (4%)

Query: 25  FRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDELQSRHNSG 84
           FRS+P+VPTTQ+LE+RELTRDIL+SGYRPVMYPVKENPLF+++ R+  L   L       
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDS-LQMLLAPDEAPA 120

Query: 85  LRQGRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXXXTWRNGAKMPSKLLPYSWWSTTSMG 144
                T+          +V+                TW+    +P++LLP++WWST+SMG
Sbjct: 121 AEAKATEKDMHK-----NVLFGERGTGGISSGGVNGTWKYNPTVPNELLPFNWWSTSSMG 175

Query: 145 MEFFPEWEGVPRHVVRKLKPFDR 167
           ME+FPEW+ VP +++RKLKPFD+
Sbjct: 176 MEYFPEWKNVPSYMMRKLKPFDK 198

>TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON}
           Anc_3.496 YPR151C
          Length = 196

 Score =  131 bits (330), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 75/189 (39%), Positives = 105/189 (55%), Gaps = 31/189 (16%)

Query: 1   MMSKRLFSTATIRSF-KRKCCSSD-------------------IFRSMPRVPTTQFLESR 40
           MM+ ++F ++T +S  KRK  SS                    IF+++PRVPTT++LES 
Sbjct: 7   MMNSKMFFSSTNKSLWKRKSMSSSRAVDSSHSVTGHNSATFNSIFKNLPRVPTTRYLEST 66

Query: 41  ELTRDILFSGYRPVMYPVKENPLFKERTR-NGEL--TDELQSRHNSGLRQGRTQXXXXXX 97
           +LT DILFSGYRP+ YPVKENPLF+   + N +   T E Q ++N  L Q   +      
Sbjct: 67  KLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKNNPVLPQKNHE------ 120

Query: 98  XXXYSVIXXXXXXXXXXXXXXXXTWRNGAKMPSKLLPYSWWSTTSMGMEFFPEWEGVPRH 157
              +SV+                TW+    +P  LLPY+WWST+ MGME++PEW  VPR 
Sbjct: 121 --AFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYPEWNNVPRR 178

Query: 158 VVRKLKPFD 166
            ++ LKPF+
Sbjct: 179 FLKTLKPFE 187

>KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {ON}
           Anc_3.496 YPR151C
          Length = 177

 Score =  124 bits (310), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 93/168 (55%), Gaps = 10/168 (5%)

Query: 2   MSKRLFSTATIRSFKRKCCSSD---IFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPV 58
           + +R  ST    S  R   + D   +FR +P+VP T++LE+REL +DIL+SGYRPVMYPV
Sbjct: 6   VGRRALSTVKKGSGSRLEYNGDGRSMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPV 65

Query: 59  KENPLFKERTRNGELTDELQSRHNSGLRQGRTQXXXXXXXXXYSVIXXXXXXXXXXXXXX 118
           +ENPLF+   +   L       H++   +G  +         +                 
Sbjct: 66  RENPLFRNSNK---LMAISHPEHDTEGTEGTHRDSQTVNTELFG----NNNCGGINTLGC 118

Query: 119 XXTWRNGAKMPSKLLPYSWWSTTSMGMEFFPEWEGVPRHVVRKLKPFD 166
             TW+   K+P K+LP++WWS +S+ ME +PEW  VP+HVV+ LKPFD
Sbjct: 119 NGTWKYAPKIPQKMLPFNWWSASSLAMEVYPEWSSVPKHVVKGLKPFD 166

>NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {ON}
           Anc_3.496 YPR151C
          Length = 278

 Score =  119 bits (297), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 97/161 (60%), Gaps = 12/161 (7%)

Query: 19  CCSSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFK---ERTRNGELTD 75
              ++IFR+MP+VP T++LE++EL++D+L+SGYRP+MYPVKENPLF+   ++  +     
Sbjct: 123 ILQNNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNSSSSFPF 182

Query: 76  ELQSRHNSGLRQGRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXXXTWRNGAKMPSKLLPY 135
              S  +S  ++ + +         Y  I                TWR   ++P+ LLP 
Sbjct: 183 STTSSSSSEKKKPQQEQMKKHYDDEYGGI---------MTGGINGTWRYSPRIPNNLLPN 233

Query: 136 SWWSTTSMGMEFFPEWEGVPRHVVRKLKPFDRGHDTLDILE 176
             WS + MGME++PEW+GVP ++V+ LKPFD+   T+++++
Sbjct: 234 KIWSMSIMGMEYYPEWKGVPFNIVKNLKPFDKSRGTVEVMK 274

>KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 191

 Score =  105 bits (262), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 87/155 (56%), Gaps = 8/155 (5%)

Query: 18  KCCSSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDEL 77
           K  ++ ++R +PRVPTT+FL  +ELT DILFSGYRP++ P+++NPLF+ + +  E+  E 
Sbjct: 5   KSKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVERE- 63

Query: 78  QSRHNSGLRQGRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXXXTWRNGAKMPSKLLPYSW 137
             ++  G  + +           +  +                TWR   ++P+KLL  + 
Sbjct: 64  --KNGGGKLKSKA---AFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSAL 118

Query: 138 WSTTSMGMEFFPEWEGVPRHVVRKLKPF--DRGHD 170
           WS+++MGMEF+PEW  VP  V   LKP+  D+  D
Sbjct: 119 WSSSAMGMEFYPEWNDVPNKVSASLKPYQLDQPQD 153

>TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa]
          {ON} Anc_3.496 YPR151C
          Length = 124

 Score = 84.0 bits (206), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 52/60 (86%), Gaps = 1/60 (1%)

Query: 5  RLFSTATIRSFKRKCCSSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLF 64
          R FST++ R ++RK  + D+FR++PRVPTT+FLE++ L+ DILFSGYRPVMYPV+ENPLF
Sbjct: 12 RRFSTSS-RVWRRKSVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLF 70

 Score = 62.4 bits (150), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 28/44 (63%), Positives = 32/44 (72%)

Query: 126 AKMPSKLLPYSWWSTTSMGMEFFPEWEGVPRHVVRKLKPFDRGH 169
           A + S L  Y  WSTT+MG+E FPEW  VPR VVRKL+PFDR H
Sbjct: 80  ASLESNLPRYDLWSTTTMGLERFPEWSNVPREVVRKLRPFDRHH 123

>NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON}
           Anc_3.496 YPR151C
          Length = 230

 Score = 86.3 bits (212), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 83/165 (50%), Gaps = 48/165 (29%)

Query: 21  SSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDELQSR 80
           S++IFR +P+VP T++LE+++L+++ILF+GY+P+MYPV+ENPLFK + +      E   R
Sbjct: 114 SNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIK-----QEDAKR 168

Query: 81  HNSGLRQGRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXXXTWRNGAKMPSKLLPYSWWST 140
            N   ++                                     G+ +  K      WST
Sbjct: 169 ENGNEKRAL-----------------------------------GSSVSHKY--KGIWST 191

Query: 141 TSMGMEFFPEWEGVPRHVVRKLKPFDRGHDTLDILESIKVNGNPK 185
           + +G++ +PEW  VP + ++ LKPFD      + L SI +  N K
Sbjct: 192 SILGLQDYPEWNNVPWNNIKNLKPFD------EELASITIKKNKK 230

>CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} similar
           to uniprot|Q06524 Saccharomyces cerevisiae YPR151c
          Length = 140

 Score = 84.0 bits (206), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 81/150 (54%), Gaps = 27/150 (18%)

Query: 22  SDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLF-----KERTRNGELTDE 76
           ++IFR +P+VP T++LE+R L+ D+L++GYRP++YP++ENPL      +E    GE ++E
Sbjct: 5   NEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNE 64

Query: 77  LQSRHNSGLRQGRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXXXTWRNGAKMPSKLLPYS 136
           LQ +    + +               V                   R  A  PSK+    
Sbjct: 65  LQKKDEEPVNELLYGPEGRGGISTMGV-------------------RRMAD-PSKVK--L 102

Query: 137 WWSTTSMGMEFFPEWEGVPRHVVRKLKPFD 166
             S + MGME++PEWE VPR VV+++KP++
Sbjct: 103 GLSYSIMGMEYYPEWEKVPRDVVKRIKPYE 132

>TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496
          YPR151C
          Length = 71

 Score = 73.9 bits (180), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 4/53 (7%)

Query: 21 SSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGEL 73
          S  + R +PRVPTT++LE+  L  DI FSGYRPVMYPVKENPLF    RNGEL
Sbjct: 12 SKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLF----RNGEL 60

>Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to
          Ashbya gossypii AFR315C
          Length = 87

 Score = 66.6 bits (161), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%)

Query: 23 DIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFK 65
          +I R +PRVPTTQ+L   EL  DI FSGYRP++YPVK+NPLF+
Sbjct: 8  EILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFR 50

>KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}
          Anc_3.496 YPR151C
          Length = 79

 Score = 64.7 bits (156), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 43/56 (76%), Gaps = 2/56 (3%)

Query: 21 SSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDE 76
           S + +++PRVPTT++L+  +L  DIL++GYRPV+YP+KENPL     +NGEL +E
Sbjct: 4  GSILCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYR--QNGELANE 57

>ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 236

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 61/145 (42%), Gaps = 58/145 (40%)

Query: 28  MPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDELQSRHNSGLRQ 87
           +PRVP+T +L  R+++  IL+SGYRP+      NP            DEL++  + G   
Sbjct: 88  LPRVPSTNYLRPRDMSSKILYSGYRPLFL----NP------------DELKTSQDGG--- 128

Query: 88  GRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXXXTWRNGAKMPS------KLLPYSWWSTT 141
                                               NGA++        +L   S W+++
Sbjct: 129 ---------------------------------NANNGARLYEFAMKLEELGEQSLWTSS 155

Query: 142 SMGMEFFPEWEGVPRHVVRKLKPFD 166
           + G E +PEW+ VP  V RKLKPF+
Sbjct: 156 ATGQEIYPEWDYVPMEVQRKLKPFN 180

>AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YPR151C
          (SUE1)
          Length = 77

 Score = 52.8 bits (125), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 32/43 (74%)

Query: 25 FRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKER 67
          FR +PRVP+TQ L + ++  DILFS +RP+ YPV +NPL + R
Sbjct: 7  FRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRR 49

>TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.682
           YPL159C
          Length = 218

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 64/149 (42%), Gaps = 47/149 (31%)

Query: 28  MPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDELQSRHNSGLRQ 87
           +P+VP T  +  RE+T + L+SGYRP+    K+  L       G++    Q  ++S    
Sbjct: 95  LPKVPQTSSITHREITTNSLYSGYRPLFIDNKKGTLL------GDVNSTAQDANSS---- 144

Query: 88  GRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXXXTWRNGAKMPSKLLPYSWWSTTSMGMEF 147
                                             +    K+ ++L   S W  ++ G+E 
Sbjct: 145 ---------------------------------IYEFAMKL-NELSEPSPWMMSATGLES 170

Query: 148 FPEWEGVPRHVVRKLKPFD---RGHDTLD 173
           + EW+ VP  V++KLKP+D   + +DTL+
Sbjct: 171 YSEWDYVPSKVIKKLKPYDLSIKENDTLN 199

>NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON}
           Anc_8.682
          Length = 257

 Score = 46.6 bits (109), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 53/141 (37%), Gaps = 35/141 (24%)

Query: 25  FRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDELQSRHNSG 84
           + ++P+V     L   E++ DIL+SGYRP+    K+         N     E  + +NS 
Sbjct: 87  YSTLPKVEPITNLRHNEISTDILYSGYRPLFLNFKD-------LENSSRKAEFGNSNNST 139

Query: 85  LRQGRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXXXTWRNGAKMPSKLLPYSWWSTTSMG 144
           L               Y +                 +               W ST++ G
Sbjct: 140 L---------------YEIAMKLDDLSPEAISGSTSS-------------NFWHSTSATG 171

Query: 145 MEFFPEWEGVPRHVVRKLKPF 165
           ME F EW+ VP  +++ LKPF
Sbjct: 172 MEVFDEWDNVPNSILKNLKPF 192

>Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {ON}
           YPL159C (REAL)
          Length = 255

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 5/54 (9%)

Query: 134 PYSWWSTTSMGMEFFPEWEGVPRHVVRKLKPF----DRGHDTLDILESIKVNGN 183
           P S W +++ G+EFF EWE +P  +++ LKPF    ++  DT D L +I   GN
Sbjct: 159 PLSPWISSATGLEFFSEWENIPSELLKNLKPFHPPNEKALDT-DELVNIIAKGN 211

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 29/44 (65%), Gaps = 1/44 (2%)

Query: 25  FRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERT 68
           F  +PRVP+T  L+  ++T ++L+SGYRP ++    +P  KE T
Sbjct: 100 FSWLPRVPSTSHLKHTDMTTNVLYSGYRP-LFINPNDPKLKEDT 142

>Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {ON}
           YPL159C (REAL)
          Length = 253

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 134 PYSWWSTTSMGMEFFPEWEGVPRHVVRKLKPFD-RGHDTLDILESIKVNG 182
           P S W +++ G+EFF EWE +P  +++ LKPF   G   +D+ E   V  
Sbjct: 159 PLSPWISSATGLEFFSEWENIPSELLKNLKPFHPPGEKAMDVDELTNVTA 208

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 29/44 (65%), Gaps = 1/44 (2%)

Query: 25  FRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERT 68
           F  +PRVP+T  L+  ++T ++L+SGYRP+ +    +P  KE T
Sbjct: 100 FSWLPRVPSTSHLKHSDMTTNVLYSGYRPI-FINPNDPKLKEDT 142

>KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.682
           YPL159C
          Length = 258

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 54/143 (37%), Gaps = 43/143 (30%)

Query: 25  FRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERT--RNGELTDELQSRHN 82
           +  +P VP+TQ +E+ ++  ++L+SGYR         PLF + T    G L  + Q+   
Sbjct: 93  YHPLPSVPSTQHIEANDMCTELLYSGYR---------PLFLDSTALERGLLAAKEQASF- 142

Query: 83  SGLRQGRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXXXTWRNGAKMPSKLLPYSWWSTTS 142
                  TQ         Y +                              P   W+ ++
Sbjct: 143 -------TQSASPTGSTFYEIAMKLED------------------------PACIWANSA 171

Query: 143 MGMEFFPEWEGVPRHVVRKLKPF 165
            G+E + EW+ +P  V   LKPF
Sbjct: 172 TGLEKYTEWDNIPYSVANSLKPF 194

>Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON}
           (15300..16085) [786 nt, 262 aa]
          Length = 261

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 53/138 (38%), Gaps = 47/138 (34%)

Query: 28  MPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDELQSRHNSGLRQ 87
           +P+VP+T+ L  RE+    L+SGYRP+    K           G   ++L     +G+  
Sbjct: 112 LPKVPSTENLNHREIRTSALYSGYRPIYINSK-----------GSGKNKLSGTMKNGVNS 160

Query: 88  GRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXXXTWRNGAKMPSKLLPYSWWSTTSMGMEF 147
                        Y +                           KL   S W +++ GME 
Sbjct: 161 -----------TFYEIAM-------------------------KLENPSPWMSSATGMEL 184

Query: 148 FPEWEGVPRHVVRKLKPF 165
           + EW+ VP  V++ LKPF
Sbjct: 185 YSEWDHVPLDVLKDLKPF 202

>Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C
           (REAL)
          Length = 253

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 26/39 (66%)

Query: 134 PYSWWSTTSMGMEFFPEWEGVPRHVVRKLKPFDRGHDTL 172
           P S W +++ G+EFF EW+ +P  ++R LKPF   ++ L
Sbjct: 159 PLSPWISSATGLEFFSEWDNIPSELLRNLKPFHPPNEKL 197

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 12  IRSFKRKCCSSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERT 68
           +R+F  K   SD F  +P+VP+T  L+  ++T ++L+SGYRP ++    +P  KE T
Sbjct: 88  MRTFNSKKKRSD-FSWLPKVPSTSHLKQSDMTTNVLYSGYRP-LFINPNDPKLKEDT 142

>YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}
           PET20Mitochondrial protein, required for respiratory
           growth under some conditions and for stability of the
           mitochondrial genome
          Length = 253

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 23/32 (71%)

Query: 134 PYSWWSTTSMGMEFFPEWEGVPRHVVRKLKPF 165
           P S W +++ G+EFF EWE +P  +++ LKPF
Sbjct: 159 PLSPWISSATGLEFFSEWENIPSELLKNLKPF 190

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 29/44 (65%), Gaps = 1/44 (2%)

Query: 25  FRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERT 68
           F  +PRVP+T  L+  ++T ++L+SGYRP ++    +P  KE T
Sbjct: 100 FSWLPRVPSTSHLKQSDMTTNVLYSGYRP-LFINPNDPKLKEDT 142

>NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {ON}
           Anc_8.682 YPL159C
          Length = 258

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%)

Query: 138 WSTTSMGMEFFPEWEGVPRHVVRKLKPFDR 167
           W T++ G+E F EW+ VP  V+R LKPF +
Sbjct: 157 WDTSATGVETFTEWDNVPESVIRNLKPFQK 186

>SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {ON}
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 219

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 24/36 (66%)

Query: 138 WSTTSMGMEFFPEWEGVPRHVVRKLKPFDRGHDTLD 173
           W +++ G EF+ EW+ VP  V++KLKPF    D ++
Sbjct: 139 WVSSATGTEFYGEWDNVPTEVIKKLKPFQPPVDEME 174

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 22/28 (78%)

Query: 28  MPRVPTTQFLESRELTRDILFSGYRPVM 55
           +P+ P+T+ L+ RE++ D+ +SGYRP+ 
Sbjct: 83  LPKAPSTEHLKLREISTDVFYSGYRPIF 110

>TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8.682
           YPL159C
          Length = 242

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 56/138 (40%), Gaps = 48/138 (34%)

Query: 28  MPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDELQSRHNSGLRQ 87
           +PRVP+T  L+ R+++  +L+SGYR    P+  NP            DE+++        
Sbjct: 96  LPRVPSTGNLKPRDMSMKVLYSGYR----PLFINP------------DEIKTSSEGSGTG 139

Query: 88  GRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXXXTWRNGAKMPSKLLPYSWWSTTSMGMEF 147
           G                                T    A    +L   S W T++ G+E+
Sbjct: 140 G--------------------------------TLYEFAMKLEELGDQSPWVTSATGLEY 167

Query: 148 FPEWEGVPRHVVRKLKPF 165
           + EW+ +P  + +KLKPF
Sbjct: 168 YREWDSIPGELQKKLKPF 185

>Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C -
           Hypothetical ORF [contig 68] FULL
          Length = 223

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 22/28 (78%)

Query: 138 WSTTSMGMEFFPEWEGVPRHVVRKLKPF 165
           W +++ G EF+ EW+GVP  V+++L+PF
Sbjct: 141 WISSATGTEFYGEWDGVPADVIKQLRPF 168

 Score = 34.3 bits (77), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 2/47 (4%)

Query: 15  FKRKCCSSDIFRSMPRVPTTQFLESRELTRDILFSGYRP-VMYPVKE 60
            K K   +D F  +P+ P+T  L+ R+++  +L+SGYRP V+ P  +
Sbjct: 73  LKGKQLKTD-FSWLPKAPSTDHLKQRDVSTTLLYSGYRPFVLAPADQ 118

>KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 249

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 20/28 (71%)

Query: 138 WSTTSMGMEFFPEWEGVPRHVVRKLKPF 165
           W +++ G EFF EW+ VP  +++ LKPF
Sbjct: 166 WVSSATGQEFFSEWDNVPSEIIKDLKPF 193

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 28  MPRVPTTQFLESRELTRDILFSGYRPVMY---PVKENPLFK 65
           +PRVPTT+ +   E   D+L+SGYRP++      KEN L +
Sbjct: 112 LPRVPTTEHILREEFNSDMLYSGYRPIVVGDKNAKENKLMQ 152

>TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON}
           Anc_8.682 YPL159C
          Length = 255

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 6/44 (13%)

Query: 25  FRSMPRVPTTQFLESRELTRDILFSGYRPVMYPV------KENP 62
           + S+P+ PTT  L S E   D+ +SGYRP+   V      +ENP
Sbjct: 103 YSSLPKAPTTHHLHSSEFNTDLFYSGYRPLSIDVNQLASEQENP 146

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 138 WSTTSMGMEFFPEWEGVPRHVVRKLKPFD--RGHDTLDILESI 178
           W  ++ G E + EW+ +P+ V+  LK F   +   T+D  E+I
Sbjct: 169 WLFSATGSELYKEWDNIPKSVLDNLKCFHPPQIKQTVDFSENI 211

>KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} similar
           to uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Length = 486

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 63/153 (41%), Gaps = 20/153 (13%)

Query: 14  SFKRKCCSSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGEL 73
           S KRK   S +   +P+VP+T +L   +L  + LF+GY+P+   +  +PL  E   N  L
Sbjct: 79  SKKRKAEKSFL---VPQVPSTDYLPREDLETEGLFAGYKPLF--LGNSPL--ESNNNDVL 131

Query: 74  TDELQSRHNSGLRQGRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXXXTWRNGAKMPSKLL 133
            D L     S +R+ +              +                      K+P    
Sbjct: 132 LDGLF----SSIRKLKNAQINSENNTVEIDVSDMLDDLKKDNQEYQRLHEKAPKIP---- 183

Query: 134 PYSWWSTTSMGMEFFPE-WEGVPRHVVRKLKPF 165
               W  +  G+ +  E ++GVPR VV KLKPF
Sbjct: 184 ----WDASISGLVYNDEPFKGVPRSVVSKLKPF 212

>KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 225

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 21/28 (75%)

Query: 138 WSTTSMGMEFFPEWEGVPRHVVRKLKPF 165
           W +++ G EF+ EW+ +P  V++KL+PF
Sbjct: 141 WISSATGTEFYGEWDNIPADVIKKLRPF 168

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 22/31 (70%)

Query: 25  FRSMPRVPTTQFLESRELTRDILFSGYRPVM 55
           F  +P+ P+T  L+ R+++  +L+SGYRP +
Sbjct: 82  FSWLPKAPSTDHLKHRDVSTTLLYSGYRPFV 112

>CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {ON}
           some similarities with uniprot|Q99373 Saccharomyces
           cerevisiae YPL159c
          Length = 267

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 5/45 (11%)

Query: 138 WSTTSMGMEFFPEWEGVPRHVVRKLKPFDRGHDTLDILESIKVNG 182
           W +++ G E + EW+ VP  V++ LKPF     T  ++ S K+NG
Sbjct: 174 WVSSATGSEMYAEWDNVPGDVIKDLKPF-----TPPVVNSRKLNG 213

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 10/35 (28%), Positives = 23/35 (65%)

Query: 25  FRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVK 59
           + ++PRV      + + ++ ++L+SGYRP+ + V+
Sbjct: 113 YSTLPRVEQISDTKLKNMSTEVLYSGYRPLFFDVE 147

>TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON}
           Anc_8.682 YPL159C
          Length = 324

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 20/28 (71%)

Query: 138 WSTTSMGMEFFPEWEGVPRHVVRKLKPF 165
           W +++ G+E + EW+ +P  V++KLKP 
Sbjct: 235 WMSSAAGLEVYSEWDSIPIEVLKKLKPL 262

 Score = 35.4 bits (80), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 22/27 (81%)

Query: 28  MPRVPTTQFLESRELTRDILFSGYRPV 54
           +P+VPT + L+ R++  ++L+SGYRP+
Sbjct: 167 LPKVPTLKNLKQRDVMTNVLYSGYRPL 193

>Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON}
           complement(24362..25030) [669 nt, 223 aa]
          Length = 222

 Score = 35.8 bits (81), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 136 SWWSTTSMGMEFFPEWEGVPRHVVRKLKPF 165
           S W++++ GME + EW  VP  V+  L PF
Sbjct: 158 SIWTSSATGMERYREWHSVPEEVINSLTPF 187

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 21/27 (77%)

Query: 28  MPRVPTTQFLESRELTRDILFSGYRPV 54
           +P+VP+ + L  +++T DI +SG+RP+
Sbjct: 97  LPKVPSNKRLTHQDITTDIFYSGFRPL 123

>KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON}
           Anc_8.682 YPL159C
          Length = 220

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 26/37 (70%)

Query: 25  FRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKEN 61
           + ++PRVP+T  ++ ++L  ++LFS YRP+   +K +
Sbjct: 88  YSALPRVPSTSNMDRKQLNTELLFSAYRPLSMDLKSD 124

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 6/32 (18%)

Query: 151 WEGVPRHVVRKLKPF------DRGHDTLDILE 176
           W  VP H VRKLKPF      D  ++  D++E
Sbjct: 157 WRNVPSHTVRKLKPFVPPSEIDFTNNADDVME 188

>TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.62
           YNL295W
          Length = 476

 Score = 35.4 bits (80), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 56/139 (40%), Gaps = 15/139 (10%)

Query: 28  MPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDELQSRHNSGLRQ 87
           +PRVP+T ++ + E+  + LF+GYRP+      N   +  TR   L +   S  N  +  
Sbjct: 75  LPRVPSTDYIPNTEVQTEGLFAGYRPLFLG---NSSLRPETRTNALDNFFTSFANLKV-- 129

Query: 88  GRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXXXTWRNGAKMPSKLLPYSWWSTTSMGMEF 147
             ++           VI                   +  K    ++P   W  +  GM +
Sbjct: 130 -TSESKNSAEEEVQDVIEELKRDSAQLNLK-----NSKGKNRKPIIP---WDASISGMVY 180

Query: 148 FPE-WEGVPRHVVRKLKPF 165
               ++ VP+ VV KLKPF
Sbjct: 181 NDHSFKDVPKSVVSKLKPF 199

>YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative
           protein of unknown function
          Length = 524

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 18  KCCSSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDEL 77
           K   S++   +PRV +T ++ ++E+  + LF+GYRP+      N  F    R G+   EL
Sbjct: 101 KISGSNLHLLVPRVASTDYISNKEVHTEGLFAGYRPLFLG---NSGFPSDARKGKNFHEL 157

>NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa]
           {ON} Anc_3.62 YNL295W
          Length = 494

 Score = 33.9 bits (76), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 26/38 (68%), Gaps = 5/38 (13%)

Query: 28  MPRVPTTQFLESRELTRDILFSGYRPV-----MYPVKE 60
           +P+VPTT ++ S E+  + LF+GY+P+     + PVK+
Sbjct: 70  VPKVPTTDYIPSLEMQTEGLFAGYKPLFLGNHVLPVKK 107

>Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {ON}
           complement(74670..76109) [1440 nt, 480 aa]
          Length = 479

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 20/28 (71%)

Query: 28  MPRVPTTQFLESRELTRDILFSGYRPVM 55
           +PRVP+T+ +   E+  D LF+GYRP+ 
Sbjct: 74  LPRVPSTENIPVEEVQTDGLFAGYRPLF 101

>Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AAL087C
          Length = 227

 Score = 32.3 bits (72), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 17/28 (60%)

Query: 138 WSTTSMGMEFFPEWEGVPRHVVRKLKPF 165
           W   + G   + EW+ VP+ V+R L+P+
Sbjct: 145 WVKNATGRVLYDEWDNVPQSVIRNLRPY 172

 Score = 32.0 bits (71), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 14/66 (21%)

Query: 3   SKRLFSTATIRSFKRKCCSSD-----IFRS---------MPRVPTTQFLESRELTRDILF 48
           +K+  S  T +    KC SSD     + RS          P  P T+ L+  ++  D+L+
Sbjct: 50  NKKETSGETRKEGGEKCISSDSKKEKVNRSGKQKRDYSWFPVAPKTEHLKEGDIAVDLLY 109

Query: 49  SGYRPV 54
           SGYRP+
Sbjct: 110 SGYRPL 115

>ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa]
          {ON} similar to gnl|GLV|KLLA0A07447g Kluyveromyces
          lactis KLLA0A07447g and weakly similar to YNL295W
          uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Hypothetical ORF
          Length = 460

 Score = 32.3 bits (72), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%)

Query: 28 MPRVPTTQFLESRELTRDILFSGYRPV 54
          +PRVP T ++ + E+  + LF+GYRP+
Sbjct: 58 VPRVPPTDYISAPEIQTEGLFAGYRPL 84

>TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa]
           {ON} Anc_3.62 YNL295W
          Length = 501

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 20/28 (71%)

Query: 28  MPRVPTTQFLESRELTRDILFSGYRPVM 55
           +PRV +T+ + S E+  D LF+GYRP+ 
Sbjct: 90  VPRVASTEDIPSHEVQVDGLFAGYRPLF 117

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 25/37 (67%)

Query: 18  KCCSSDIFRSMPRVPTTQFLESRELTRDILFSGYRPV 54
           K   S++   +P+V +T+++  +E+  + LF+GYRP+
Sbjct: 101 KMFGSNLHLLVPKVASTEYIPIKEVHTEGLFAGYRPL 137

>Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 28  MPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDEL 77
           +P+V +T  ++++E+  + LF+GYRP+      N  F    R G+   EL
Sbjct: 111 VPKVASTDHIQNKEVHTEGLFAGYRPLFLG---NSSFPSDARKGKNFHEL 157

>SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]
           {ON} similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 552

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 53/140 (37%), Gaps = 21/140 (15%)

Query: 28  MPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDELQSRHNSGLRQ 87
           +P VP T ++   E+  + LF+GY+P+               N  L DE ++    GL  
Sbjct: 161 VPHVPNTDYIPHSEIQTEGLFAGYKPLF------------LGNSSL-DEKRADVLDGLFT 207

Query: 88  GRTQXXXXXXXXXYSVIXXXXXXXXXXXXXXXXTWRNGAKMPSKLLPYSWWSTTSMGMEF 147
             T+           +                       K P  ++P   W  +  GM +
Sbjct: 208 SLTKIKKGTSAPNGEINVQEILDDLQKDDTMETLKEKSHKKP--VIP---WDASISGMVY 262

Query: 148 --FPEWEGVPRHVVRKLKPF 165
              P ++ VPR+VV KLKPF
Sbjct: 263 NDLP-FKDVPRNVVGKLKPF 281

>TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {ON}
           Anc_3.62 YNL295W
          Length = 494

 Score = 29.6 bits (65), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 19/27 (70%)

Query: 28  MPRVPTTQFLESRELTRDILFSGYRPV 54
           +P+V +T  L S E+  + LF+GYRP+
Sbjct: 89  VPKVASTDNLSSAEIQTEGLFAGYRPL 115

>Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W
           (REAL)
          Length = 525

 Score = 29.3 bits (64), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 11/40 (27%), Positives = 24/40 (60%)

Query: 16  KRKCCSSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVM 55
           ++    S++   +P+V +T  +  +E+  + LF+GYRP+ 
Sbjct: 100 QKTTTGSNLHLLVPKVASTDHIPKKEVNTEGLFAGYRPLF 139

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,713,799
Number of extensions: 580685
Number of successful extensions: 1328
Number of sequences better than 10.0: 55
Number of HSP's gapped: 1331
Number of HSP's successfully gapped: 87
Length of query: 185
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 82
Effective length of database: 41,670,801
Effective search space: 3417005682
Effective search space used: 3417005682
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)