Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D09790g3.497ON1180118058240.0
TDEL0D056503.497ON1077113127010.0
Suva_7.4223.497ON1127115023940.0
YGR134W (CAF130)3.497ON1122120122430.0
Smik_6.2303.497ON1124115122270.0
Skud_7.4453.497ON1123115121890.0
SAKL0F02596g3.497ON1132110521380.0
KAFR0C020003.497ON1066109521020.0
Kpol_480.123.497ON1114115819880.0
NCAS0E007703.497ON115088419810.0
Kwal_47.188863.497ON1105110219430.0
Ecym_12323.497ON1204116519210.0
AFR316W3.497ON1191116719030.0
KLTH0G02442g3.497ON1113111118720.0
TBLA0C045103.497ON1307129918580.0
KNAG0B007703.497ON1038112418070.0
NDAI0G009003.497ON127990317250.0
CAGL0I10428g3.497ON1163112816610.0
TPHA0A056803.497ON107478614850.0
KLLA0E03961g3.497ON1132114310291e-120
TPHA0E001905.706ON136163729.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D09790g
         (1180 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] ...  2248   0.0  
TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_...  1045   0.0  
Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W...   926   0.0  
YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Par...   868   0.0  
Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W...   862   0.0  
Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W...   847   0.0  
SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] ...   828   0.0  
KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3....   814   0.0  
Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON...   770   0.0  
NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {...   767   0.0  
Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR...   753   0.0  
Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON...   744   0.0  
AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic...   737   0.0  
KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] ...   725   0.0  
TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_...   720   0.0  
KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {...   700   0.0  
NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {...   669   0.0  
CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa...   644   0.0  
TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_...   576   0.0  
KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] ...   400   e-120
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...    32   9.0  

>ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1180

 Score = 2248 bits (5824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1108/1180 (93%), Positives = 1108/1180 (93%)

Query: 1    MVKKRKSKTNSSNVTESAFNGNGNNINKEEYIPLGALKDEDMLDLKMISLEELLAERELD 60
            MVKKRKSKTNSSNVTESAFNGNGNNINKEEYIPLGALKDEDMLDLKMISLEELLAERELD
Sbjct: 1    MVKKRKSKTNSSNVTESAFNGNGNNINKEEYIPLGALKDEDMLDLKMISLEELLAERELD 60

Query: 61   YDARFEFLDRLLRDSKSWKDPQLKYSLLLEMVIVALLTTRAGLSVLALLKPSGSNPSIPK 120
            YDARFEFLDRLLRDSKSWKDPQLKYSLLLEMVIVALLTTRAGLSVLALLKPSGSNPSIPK
Sbjct: 61   YDARFEFLDRLLRDSKSWKDPQLKYSLLLEMVIVALLTTRAGLSVLALLKPSGSNPSIPK 120

Query: 121  CISNQRKWLAQVERKGKLHSDLISQWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKV 180
            CISNQRKWLAQVERKGKLHSDLISQWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKV
Sbjct: 121  CISNQRKWLAQVERKGKLHSDLISQWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKV 180

Query: 181  PLSFLIQSKYRAAELILDPSYNLLVDYFLAVVPLCEKWLRRAISYGNGVHLKRTVINYNR 240
            PLSFLIQSKYRAAELILDPSYNLLVDYFLAVVPLCEKWLRRAISYGNGVHLKRTVINYNR
Sbjct: 181  PLSFLIQSKYRAAELILDPSYNLLVDYFLAVVPLCEKWLRRAISYGNGVHLKRTVINYNR 240

Query: 241  VYDFSGYFTWYTLQTRGSNHPFVSQQILFDLIDSDDKEIEAVSQIESNXXXXXXXXXXXX 300
            VYDFSGYFTWYTLQTRGSNHPFVSQQILFDLIDSDDKEIEAVSQIESN            
Sbjct: 241  VYDFSGYFTWYTLQTRGSNHPFVSQQILFDLIDSDDKEIEAVSQIESNDQEERIQIIDQI 300

Query: 301  XSAIQDISSASLNSGFYGDEDRSALEEYSDNYHHQVNQNEQVFSFDLNQDGSLELPNLMS 360
             SAIQDISSASLNSGFYGDEDRSALEEYSDNYHHQVNQNEQVFSFDLNQDGSLELPNLMS
Sbjct: 301  RSAIQDISSASLNSGFYGDEDRSALEEYSDNYHHQVNQNEQVFSFDLNQDGSLELPNLMS 360

Query: 361  HAAVRHEILMKVXXXXXXXXXXXXXXFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLGF 420
            HAAVRHEILMKV              FKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLGF
Sbjct: 361  HAAVRHEILMKVLKLNNSSSPLLQLQFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLGF 420

Query: 421  LTPEIQQTLEFEEGCDWRFHVCFNMQKIIDASLVRLNFDDFERLNSINNSDDNVDWRSQL 480
            LTPEIQQTLEFEEGCDWRFHVCFNMQKIIDASLVRLNFDDFERLNSINNSDDNVDWRSQL
Sbjct: 421  LTPEIQQTLEFEEGCDWRFHVCFNMQKIIDASLVRLNFDDFERLNSINNSDDNVDWRSQL 480

Query: 481  DKWLPHGFNTQDLELICMVDIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILLGL 540
            DKWLPHGFNTQDLELICMVDIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILLGL
Sbjct: 481  DKWLPHGFNTQDLELICMVDIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILLGL 540

Query: 541  EIDRIEEELETFDTPLMVRATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSPHG 600
            EIDRIEEELETFDTPLMVRATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSPHG
Sbjct: 541  EIDRIEEELETFDTPLMVRATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSPHG 600

Query: 601  RKLCQGALYXXXXXXXXXXXXXXXXXXDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYNDL 660
            RKLCQGALY                  DVTSLFSDLQPGDRFDEDVRYMFEYEFEDYNDL
Sbjct: 601  RKLCQGALYAELRSHAAALLALGSELEDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYNDL 660

Query: 661  SSREEDYSGFDKYDDYTDSSKTHARKGFGRRCNCIFXXXXXXXXXXXXXXXXGHKAPKQI 720
            SSREEDYSGFDKYDDYTDSSKTHARKGFGRRCNCIF                GHKAPKQI
Sbjct: 661  SSREEDYSGFDKYDDYTDSSKTHARKGFGRRCNCIFDDDEMLEDEDYENEYEGHKAPKQI 720

Query: 721  LPQQNPTTSVSMSTTGKPHAIRSGGSFEFDYSGKDWRDIPRMSNLYYSPNYHFVEDLDPN 780
            LPQQNPTTSVSMSTTGKPHAIRSGGSFEFDYSGKDWRDIPRMSNLYYSPNYHFVEDLDPN
Sbjct: 721  LPQQNPTTSVSMSTTGKPHAIRSGGSFEFDYSGKDWRDIPRMSNLYYSPNYHFVEDLDPN 780

Query: 781  TIISLTNKATKQSLSKIESLLLLGSVATCVKNEQDEIVLGNITELHHQNGSRGSQVIDKL 840
            TIISLTNKATKQSLSKIESLLLLGSVATCVKNEQDEIVLGNITELHHQNGSRGSQVIDKL
Sbjct: 781  TIISLTNKATKQSLSKIESLLLLGSVATCVKNEQDEIVLGNITELHHQNGSRGSQVIDKL 840

Query: 841  KDISPDDIYEMWCKDSTFEKMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLI 900
            KDISPDDIYEMWCKDSTFEKMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLI
Sbjct: 841  KDISPDDIYEMWCKDSTFEKMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLI 900

Query: 901  HYIFELVMGLRKSFXXXXXXXXXXXSISEMTKEAPEVRTSLPFSRQGSIQLSSIETKMLL 960
            HYIFELVMGLRKSF           SISEMTKEAPEVRTSLPFSRQGSIQLSSIETKMLL
Sbjct: 901  HYIFELVMGLRKSFDENNENDNGDESISEMTKEAPEVRTSLPFSRQGSIQLSSIETKMLL 960

Query: 961  QEFFTNAAIFLTEKSKEWIGEEPMEDEATINDGENGNVSLYAVGLMKLICLMVRAFIKKG 1020
            QEFFTNAAIFLTEKSKEWIGEEPMEDEATINDGENGNVSLYAVGLMKLICLMVRAFIKKG
Sbjct: 961  QEFFTNAAIFLTEKSKEWIGEEPMEDEATINDGENGNVSLYAVGLMKLICLMVRAFIKKG 1020

Query: 1021 KFDFRESECVFELQTLLMNWIAIIPEAKDLFFELKALVAEVHSDPMDDEELSNNPPDSNK 1080
            KFDFRESECVFELQTLLMNWIAIIPEAKDLFFELKALVAEVHSDPMDDEELSNNPPDSNK
Sbjct: 1021 KFDFRESECVFELQTLLMNWIAIIPEAKDLFFELKALVAEVHSDPMDDEELSNNPPDSNK 1080

Query: 1081 KLSSMVENDNINGNEAVDSEYNRKLISLLSPVMHRKEENAAVVALRNFIKKYSFDTTVPL 1140
            KLSSMVENDNINGNEAVDSEYNRKLISLLSPVMHRKEENAAVVALRNFIKKYSFDTTVPL
Sbjct: 1081 KLSSMVENDNINGNEAVDSEYNRKLISLLSPVMHRKEENAAVVALRNFIKKYSFDTTVPL 1140

Query: 1141 IGRKVVYEGNEILPLPESETPMSLLDYLVDNYPPNVEHYE 1180
            IGRKVVYEGNEILPLPESETPMSLLDYLVDNYPPNVEHYE
Sbjct: 1141 IGRKVVYEGNEILPLPESETPMSLLDYLVDNYPPNVEHYE 1180

>TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_3.497
            YGR134W
          Length = 1077

 Score = 1045 bits (2701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/1131 (50%), Positives = 732/1131 (64%), Gaps = 86/1131 (7%)

Query: 46   KMISLEELLAERELDYDARFEFLDRLLRDSKSWKDPQLKYSLLLEMVIVALLTTRAGLSV 105
            K+  L ELL E  L      E L   LR+ K  K+ Q + SL+ E +I+AL TTRAG+S+
Sbjct: 8    KVRPLHELLVEANLQPLKGVEGLAEALREEKVLKNDQWRPSLICETLIIALFTTRAGISL 67

Query: 106  LALLKPSGSNPSIPKCISNQRKWLAQVERKGKLHSDLISQWQSDDDIFLKFLHFLLKNED 165
            L L   S                 A+ +R G      + +W +D+++ L+F  ++L+N  
Sbjct: 68   LPLFSES-----------------AKRKRVGPR----VLEWHNDEELMLRFFSYILENRS 106

Query: 166  VWLPCENVNQCEWKVPLSFLIQSKYRAAELILDPSYNLLVDYFLAVVPLCEKWLRRAISY 225
              +      +  WK+PL FLI+SK+ AA ++LD +YNLL+DY   + P+ ++W+ RA  +
Sbjct: 107  SRIEPRLFEKARWKLPLFFLIESKFLAASMVLDQNYNLLLDYVHTITPMIKRWVHRA--F 164

Query: 226  GNGVHLKRTVINYNRVYDFSGYFTWYTLQTRGSNHPFVSQQILFDLIDSDDKEIEAVSQI 285
              G   K TV+ YNRVY+      WY+  T+ SN    + Q    L ++ ++ ++   ++
Sbjct: 165  TQGTFFKDTVVCYNRVYELKDSSEWYSFGTKKSNEERRAIQQF--LRENSEQVLDTYHEM 222

Query: 286  ESNXXXXXXXXXXXXXSAIQDISSASLNSGFYGDEDRSALEEYSDNYHHQVNQNEQVFSF 345
                             AI D +S                      YHH+++Q+E V+SF
Sbjct: 223  ----------VRPSNERAINDTAS----------------------YHHRISQHENVYSF 250

Query: 346  DLNQDGSLELPNLMSHAAVRHEILMKVXXXXXXXXXXXXXXFKIVAGLVDPLTQPAPNDK 405
            D+NQDGSLE+PN+MSHA+VRH+IL  +              FK++AGLVDPLTQP PNDK
Sbjct: 251  DINQDGSLEIPNIMSHASVRHDILQNLMRLPLCDSPLLQWQFKLMAGLVDPLTQPPPNDK 310

Query: 406  HVISLDLLYQMFLGFLTPEIQQTLEFEEGCDWRFHVCFNMQKIIDASLVRLNFDDFERLN 465
            H+ISLDLLYQM LG + P I  TL   +GCDW+FH+CFNMQKII ASL RLN  DF+ LN
Sbjct: 311  HIISLDLLYQMLLGLMEPAISNTLG-SDGCDWKFHLCFNMQKIIQASLKRLNLQDFDTLN 369

Query: 466  SINNSDDNVDWRSQLDKWLPHGFNTQDLELICMVDIIAVYTIYKLYEHLPIQLNPFLSSL 525
            SINNSD++V WR  L  WLPHG NTQ+LELI M+DI+AVYTIYKLYE LP+QLNPFLS +
Sbjct: 370  SINNSDEDVSWRDNLHSWLPHGLNTQNLELIYMIDILAVYTIYKLYEDLPVQLNPFLSPM 429

Query: 526  ISLWKNLTCVILLGLEIDRIEEELETFDTPLMVRATIRGAAALRAIVATVLNGHVEATKH 585
            ISLWKNLTCVILLGLEIDR EEE ETF+TP++VRATIRGAAALRA+VAT+LNGHV+  KH
Sbjct: 430  ISLWKNLTCVILLGLEIDRFEEEHETFETPVLVRATIRGAAALRAVVATILNGHVDTYKH 489

Query: 586  DIKHESLNTFMSPHGRKLCQGALYXXXXXXXXXXXXXXXXXXDVTSLFSDLQPGDRFDED 645
            D  HE LNTFMSPHGRKLCQGALY                  DVT+L +DLQ GDRFDED
Sbjct: 490  DFMHEPLNTFMSPHGRKLCQGALYADLRSHAAALLALGTELEDVTNLLADLQAGDRFDED 549

Query: 646  VRYMFEYEFEDYNDLSSREEDYSGFDKYDDYTDSSKTHARKGFGRRCNCIFXXXXXXXXX 705
            VRYMFEYE ++YN+  S  E                    K   RRCNCIF         
Sbjct: 550  VRYMFEYECDNYNEGDSESEKDGKL----------AVEQPKILQRRCNCIFDDDEMAEDE 599

Query: 706  XXXXXXXGHKAPKQILPQQNPTTSVSMSTTGKPHAIRSGGSFEFDYSGKDWRDIPRMSNL 765
                        K ++ QQN  TS+SMS++GKP A+RSGG+FEFDYSGKDWRDIPR SN 
Sbjct: 600  DFDGENDEAFFSKHLILQQNAQTSLSMSSSGKPRAVRSGGAFEFDYSGKDWRDIPRGSNF 659

Query: 766  YYSPNYHFVEDLDPNTIISLTNKATKQSLSKIESLLLLGSVATCVKNEQDEIVLGNITEL 825
            YYSP++ F+E    +++++LT KA+ + L + ESL LL SVA+CVKNEQDEI LGN+ + 
Sbjct: 660  YYSPDFEFIESPSLSSLLALTKKASSEKLVEKESLTLLRSVASCVKNEQDEITLGNLIDP 719

Query: 826  HHQN-GSRGSQVIDKLKDISPDDIYEMWCKDSTFEKMVYCNHEVAWRLMDEMLMCSGFRR 884
            H  +     S+  DK   I PDDIYEMWC++STFEK+VY NH +AW+LMDEML+C G+RR
Sbjct: 720  HQDSQADEESRNADK---IEPDDIYEMWCENSTFEKIVYFNHTLAWKLMDEMLLCIGYRR 776

Query: 885  VLIWFITHMELNHSLIHYIFELVMGLR-KSFXXXXXXXXXXXSISEMTKEAPEVRTSLPF 943
            VLIWFITHMELNHSLIHYIFELVMGLR  S             + ++ K   E+  S+ F
Sbjct: 777  VLIWFITHMELNHSLIHYIFELVMGLRGNSDENDRDVDLAGPPLQDVDKVKGEL--SVGF 834

Query: 944  SRQGSIQLSSIETKMLLQEFFTNAAIFLTEKSKEW--IGEEPMEDEATINDGENGNVSLY 1001
            SRQG++QLS+IETKMLLQEFFTNAAIF+++KS+E   I  E   +E    +G + NVSLY
Sbjct: 835  SRQGALQLSTIETKMLLQEFFTNAAIFISKKSEESTDIANEEQNNENRDLNGNSENVSLY 894

Query: 1002 AVGLMKLICLMVRAFIKKGKFDFRESECVFELQTLLMNWIAIIPEAKDLFFELKALVAEV 1061
            A+GLMKLIC MVR FI K KFDF ESECVFELQ LLMNWI IIPEAK LFFELK+L+A  
Sbjct: 895  AMGLMKLICFMVRTFINKEKFDFSESECVFELQALLMNWIGIIPEAKTLFFELKSLIAGF 954

Query: 1062 HS----DPMDDEELSNNPPDSNKKLSSMVENDNINGNEAVDSEYNRKLISLLSPVMHRKE 1117
             +        + E+ N+  +   K  S V   N  G      E+NRKL++LL P++  KE
Sbjct: 955  STATSVQEQKNAEVKNDTQEDVPKEQSPVRVSNTAG-----FEFNRKLMTLLPPLVKNKE 1009

Query: 1118 ENAAVVALRNFIKKYSFDTTVPLIGRKVVYEGNEILPLPESETPMSLLDYL 1168
            ENAA+  LR+FIK  SF  TVP+IGRK+VYE ++ILPLP+S+ P++L +Y+
Sbjct: 1010 ENAAMQTLRSFIKTSSFLNTVPVIGRKIVYEDDKILPLPKSDVPLALHEYI 1060

>Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W
            (REAL)
          Length = 1127

 Score =  926 bits (2394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/1150 (43%), Positives = 698/1150 (60%), Gaps = 90/1150 (7%)

Query: 46   KMISLEELLAERELDYDARFEFLDRLLRDSKSWKDPQLKYSLLLEMVIVALLTTRAGLSV 105
            + ISL+ELL +R   Y    E L++LL D     D ++++ LL E + V L TT++G S+
Sbjct: 32   QFISLQELLKDRH--YTPSVENLEKLLYDETILNDQEIRFPLLFEALSVTLFTTKSGKSI 89

Query: 106  LALLKPSGSNPSIPKCISNQRKWLAQVERKGKLHSDLISQWQSDDDIFLKFLHFLLKNED 165
            L  +K S S          ++ W    E     ++ +I  W+ DD + LKFL F+L N+ 
Sbjct: 90   LQTMKASTS--------KERKAWEKSFENHDSNYASIIRSWKEDDVLLLKFLRFILANKT 141

Query: 166  VWLPCENVNQCEWKVPLSFLIQSKYRAAELILDPSYNLLVDYFLAVVPLCEKWLRRAISY 225
              L  +  N  ++K+PLSFLI SK     +IL+  YN+L DY  A+    E  +    ++
Sbjct: 142  TPLQIDRYNLPKYKLPLSFLIVSKVNLPSIILNEGYNMLKDYLYAISGRMEGLIWCNSTF 201

Query: 226  GNGVHL-KRTVINYNRVYDFSGYFTWYTLQTRGSNHPFVSQQILFDLIDSDDKEIEAVSQ 284
                 + K T+  Y+R+ +F  ++ WY+     +  P ++  I   L+DS +  ++ VS 
Sbjct: 202  DQSARIFKGTLQQYDRMIEFRNFYFWYSFSAEKNATPKLNHNINL-LMDSYEDNLDGVSS 260

Query: 285  IESNXXXXXXXXXXXXXSAIQDISSASLNSGFYGDEDRSALEEYSDNYHHQVNQNEQVFS 344
            ++                               G  D    +      H  VN  EQ++S
Sbjct: 261  VDDA-----------------------------GKSDNHQKQPKDTIIHRTVNDQEQIYS 291

Query: 345  FDLNQDGSLELPNLMSHAAVRHEILMKVXXXXXXXXXXXXXXFKIVAGLVDPLTQPAPND 404
            F+LNQDG+L++PN+M H+ +RHE+L K+              F  + GLVDPLTQP PND
Sbjct: 292  FELNQDGTLQIPNVMEHSLLRHELLFKILNLTPVLTPLLEQQFSTLCGLVDPLTQPTPND 351

Query: 405  KHVISLDLLYQMFLGFLTPEIQQTLEFEEGCDWRFHVCFNMQKIIDASLVRLNFDDFERL 464
            KH+IS+D LYQ+FLG + P I+ + E     DW+F++CFNMQKIIDA+++RLN   FE+L
Sbjct: 352  KHIISIDFLYQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNCFGFEKL 411

Query: 465  NSINNSDDNVDWRSQLDKWLPHGFNTQDLELICMVDIIAVYTIYKLYEHLPIQLNPFLSS 524
            NSINN+DD V WR+QL  WLPHG NTQDLEL+ M+DI+AVYTIYKLYE +PIQLNPFL S
Sbjct: 412  NSINNTDDTVHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFS 471

Query: 525  LISLWKNLTCVILLGLEIDRIEEELETFDTPLMVRATIRGAAALRAIVATVLNGHVEATK 584
            L+SLWKNL+CVILL LEIDRIEEE  T++TPLMVRATIRGAAALR+++A VLNG V++  
Sbjct: 472  LLSLWKNLSCVILLALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSND 531

Query: 585  HDIKHESLNTFMSPHGRKLCQGALYXXXXXXXXXXXXXXXXXXDVTSLFSDLQPGDRFDE 644
            HD KHESLNTFMSP+GRKLC GALY                  DVT LF+DLQ GDRFDE
Sbjct: 532  HDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDE 591

Query: 645  DVRYMFEYEFEDYNDLSS---REEDYSGFDKYDDYTDSSKTHARKGF-GRRCNCIFXXXX 700
            D+RYMF+YE EDYN+  S    EE   G +      + +KT    GF  RRCNCIF    
Sbjct: 592  DIRYMFDYECEDYNESFSDCGDEELGEGVNS----GEKTKTSIHNGFYQRRCNCIFNDDK 647

Query: 701  XXXXXXXXXXXXGHKAPKQILPQQNPTTSVSMSTTG------KPHAIRSGGSFEFDYSGK 754
                              +I    N  ++ +++          P+++RS  +FEFDYSG+
Sbjct: 648  LVAEDGANASTNNDSIKNEIRSDGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGE 707

Query: 755  DWRDIPRMSNLYYSPNYHFVEDLDPNTIISLTNKATKQSLSKIESLLLLGSVATCVKNEQ 814
            DWRD+P+  N+YYSP+Y F+++   + I +LT +   + LS+ ES+LL+ SVA+CVKNEQ
Sbjct: 708  DWRDVPKDFNIYYSPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQ 767

Query: 815  DEIVLG----NITELHHQNGSRGSQVI-------DKLKDISPDDIYEMWCKDSTFEKMVY 863
            D+++L     N T +  +N   G   I       ++L+  +PDDIYE+W ++S FE+M+Y
Sbjct: 768  DQMILADLGSNFTSI-GENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLY 826

Query: 864  CNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLIHYIFELVMGLRKSFXXXXXXXXX 923
             NH+VAWRLMDEMLMC+G+RR+LIWF+TH+EL HSLI+Y+FEL+MGLR +          
Sbjct: 827  VNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQD 886

Query: 924  XXS--ISEM--TKEAPEVRTSLPFSRQGSIQLSSIETKMLLQEFFTNAAIFLTEKSKEWI 979
                 I E+   K+  E  + LPFSRQG I LS IETKMLLQEFF NAAIFL+ K+ E  
Sbjct: 887  RKDDMIYEILKKKQKNENTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNTEEE 946

Query: 980  GEEPMEDEATINDGENGNVSLYAVGLMKLICLMVRAFIKKGKFDFRESECVFELQTLLMN 1039
            GE+               VSLY++GL+KLIC MV+  I   KF F +SEC FELQTLLM 
Sbjct: 947  GEDA------------DKVSLYSLGLVKLICYMVQTLIANDKFFFTKSECTFELQTLLMT 994

Query: 1040 WIAIIPEAKDLFFELKALVAEVHSDPMDDEELSNNPPDSNKKLSSMVENDNINGNEAVDS 1099
            WI I+PEAKDLFF++K+ +A      M+++ +++N      K    +++      +++ S
Sbjct: 995  WIGILPEAKDLFFQIKSRLA------MEEDGITDNTVQHKDKTDLDLDSGKKPNTKSI-S 1047

Query: 1100 EYNRKLISLLSPVMHRKEENAAVVALRNFIKKYSFDTTVPLIGRKVVYEGNEILPLPESE 1159
            + N K++SL        ++N+A+  LR+FI  YSFDT V   GR+VV+  ++ILPLP+++
Sbjct: 1048 KLNMKILSLFPSNPTENDDNSAISTLRSFITDYSFDTQVVAPGRRVVFHDDKILPLPKAD 1107

Query: 1160 TPMSLLDYLV 1169
             P+ L +Y+ 
Sbjct: 1108 KPIPLHEYIT 1117

>YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Part of
            the evolutionarily-conserved CCR4-NOT transcriptional
            regulatory complex involved in controlling mRNA
            initiation, elongation, and degradation
          Length = 1122

 Score =  868 bits (2243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/1201 (41%), Positives = 713/1201 (59%), Gaps = 121/1201 (10%)

Query: 1    MVKKRKSKTNSSNVTESAFNGNGNNINKEEYIPLGALKDEDMLDLKMISLEELLAERELD 60
            M KK+ +   +     ++ + +G++++ +++IPL                +ELL ++  +
Sbjct: 1    MTKKKAATNYAERQNLASEDSSGDSVHFKDFIPL----------------QELLKDK--N 42

Query: 61   YDARFEFLDRLLRDSKSWKDPQLKYSLLLEMVIVALLTTRAGLSVLALLKPSGSNPSIPK 120
            Y    E L+++L +   + D ++  +LLLE +I+ L TT +G S L L++ S        
Sbjct: 43   YVPSVENLEKILYNETMFNDQKICSNLLLEALIITLFTTISGKSALRLIQTSS------- 95

Query: 121  CISNQRKWLAQVERKGKLHSDLISQWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKV 180
             +  ++ W    E     ++ ++  W+ +D + LKFL FLL N+   L     N  E+K+
Sbjct: 96   -LKERKSWAQSFENNSSSYASIVLSWKDNDILLLKFLRFLLANKTAPLQINRYNLPEYKL 154

Query: 181  PLSFLIQSKYRAAELILDPSYNLLVDYFLAVVPLCEKWLRRAISYGNGVHLKRTVI-NYN 239
            PLSFLI SK     ++L+ +YNLL DY  ++    E  +  + ++     + R ++ +YN
Sbjct: 155  PLSFLIVSKITIPSILLNETYNLLKDYLYSITGRIESLISCSSTFDKPALVVRKILKDYN 214

Query: 240  RVYDFSGYFTWYTLQTRGSNHPFVSQQILFDLIDSDDKEIEAVSQIESNXXXXXXXXXXX 299
            R+ +   ++ WY+       +   S  I   L+++D+                       
Sbjct: 215  RMIECRNFYFWYSFNAENRVNLTFSDNISL-LMENDEG---------------------- 251

Query: 300  XXSAIQDISSASLNSGF-YGDEDRSALEEYSDNYHHQVNQNEQVFSFDLNQDGSLELPNL 358
                  +  S   +S F +  + R A+          +N  EQ++SF+LNQDG+LE+PN+
Sbjct: 252  ------NAGSGLDDSRFDHQKQPREAI------MGRTINDQEQIYSFELNQDGTLEIPNV 299

Query: 359  MSHAAVRHEILMKVXXXXXXXXXXXXXXFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFL 418
            M H+ +RHE+L K+              F  + GLVDPL QP PNDKH+IS+D L+Q+FL
Sbjct: 300  MEHSLLRHELLFKILNLTTVLTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFQLFL 359

Query: 419  GFLTPEIQQTLEFEEGCDWRFHVCFNMQKIIDASLVRLNFDDFERLNSINNSDDNVDWRS 478
            G ++  I+ + E  +  DW+F++CFNMQKIIDA+++RLN  DF+ LNS+NN+D+ V W++
Sbjct: 360  GLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDATMLRLNCFDFDILNSVNNTDNAVHWKT 419

Query: 479  QLDKWLPHGFNTQDLELICMVDIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILL 538
            QL +WLPHG NTQDLEL+ M+DI+AVYTIYKLYE +PIQLNPFL SLISLWKNL+CVILL
Sbjct: 420  QLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVILL 479

Query: 539  GLEIDRIEEELETFDTPLMVRATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSP 598
             LEIDRIEEE  T++TPLMVRATIRGAAALR+++ATVLNG V+   HD KHESLNTFMSP
Sbjct: 480  ALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFMSP 539

Query: 599  HGRKLCQGALYXXXXXXXXXXXXXXXXXXDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYN 658
            +GRKLC GALY                  DVT LF+DLQ GDRFDED+RYMF+YE EDY 
Sbjct: 540  YGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDY- 598

Query: 659  DLSSREEDYSGFDKYDDYTDSSKTHARKG----FGRRCNCIFXXXXXXXXXXXXXXXXGH 714
            D S  E D+ G D  +   + ++  A       F RRCNCIF                  
Sbjct: 599  DESFSESDHGGLD--ESVVNPTEKIASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFGST 656

Query: 715  KAPKQILPQQNPTTSVSMSTTG---------KPHAIRSGGSFEFDYSGKDWRDIPRMSNL 765
             +        N   +V  +TT           P ++RS  +FEFDYSG+DWRD+PR  N+
Sbjct: 657  NSENVEGAMHNNRNAVHNATTATSDHVVTSPNPLSVRSRSTFEFDYSGEDWRDVPRDFNM 716

Query: 766  YYSPNYHFVEDLDPNTIISLTNKATKQSLSKIESLLLLGSVATCVKNEQDEIVLGNI--- 822
            YYSP+Y F+ +   + I SLT +   + L+K ES+LL+ SVA+CV+NEQD+++L ++   
Sbjct: 717  YYSPSYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMILADLESN 776

Query: 823  ------TELHHQNGSRGSQVIDK-LKDISPDDIYEMWCKDSTFEKMVYCNHEVAWRLMDE 875
                   ++  +  ++ S++ ++ L+  +PDDIYE+W ++S FE+M+  NH+VAWRLMDE
Sbjct: 777  FSASINGDVEGEGNTKMSKIDNEDLRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDE 836

Query: 876  MLMCSGFRRVLIWFITHMELNHSLIHYIFELVMGLR-KSFXXXXXXXXXXXS-ISEM--T 931
            MLMC+G+RR+LIWF+TH+EL HSLI+Y+FEL+MGLR K F             I E+   
Sbjct: 837  MLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYEILKK 896

Query: 932  KEAPEVRTSLPFSRQGSIQLSSIETKMLLQEFFTNAAIFLTEKSKEWIGEEPMEDEATIN 991
            K+  E  + LPFSRQG I LS IETKMLLQEFF NAAIFL+ K+           E    
Sbjct: 897  KQKNEDASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNN----------EEENE 946

Query: 992  DGENGNVSLYAVGLMKLICLMVRAFIKKGKFDFRESECVFELQTLLMNWIAIIPEAKDLF 1051
            DGE   +SLY++GL++LIC MV+  I   KF F +SEC FELQTLLM WI I+PEAKDLF
Sbjct: 947  DGE--KISLYSLGLVRLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLF 1004

Query: 1052 FELKALVA---EVHSDPMDDEELSNNPPDSNKKLSSMVENDNINGNEAVDSEYNRKLISL 1108
            F++K  +A   E  +D M  E   N+  D  KKL           N    SE N KL++L
Sbjct: 1005 FKIKTRLAMEEEDSADTMQHEGRKNS--DIEKKL-----------NAKPASELNLKLLNL 1051

Query: 1109 LSPVMHRKEENAAVVALRNFIKKYSFDTTVPLIGRKVVYEGNEILPLPESETPMSLLDYL 1168
                   K++++ +  LR+FI  YSFDT V   GR+VV+   +ILPLP+++ P+ L +Y+
Sbjct: 1052 FPSKPANKDDSSPINTLRSFIADYSFDTQVNPPGRRVVFYDGKILPLPKADKPIPLHEYI 1111

Query: 1169 V 1169
             
Sbjct: 1112 T 1112

>Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W
            (REAL)
          Length = 1124

 Score =  862 bits (2227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/1151 (43%), Positives = 679/1151 (58%), Gaps = 93/1151 (8%)

Query: 46   KMISLEELLAERELDYDARFEFLDRLLRDSKSWKDPQLKYSLLLEMVIVALLTTRAGLSV 105
            + + L+ELL ++  +Y    E L+++L D     D ++++SLL E + + L TT +G S+
Sbjct: 30   RFVPLQELLKDK--NYVPSVENLEKVLCDETMLNDQKVRFSLLFEALAITLFTTNSGKSI 87

Query: 106  LALLKPSGSNPSIPKCISNQRK-WLAQVERKGKLHSDLISQWQSDDDIFLKFLHFLLKNE 164
            L          SI    S +RK W    E     ++ ++  W+ +D + LKF+ FLL N+
Sbjct: 88   LQ---------SIQTFTSKKRKLWAQSFENNNSNYASIVFSWKDNDILLLKFVRFLLANK 138

Query: 165  DVWLPCENVNQCEWKVPLSFLIQSKYRAAELILDPSYNLLVDYFLAVVPLCEKWLRRAIS 224
             + L  +  N  E K+PLSFLI SK     ++L+  YNLL DY  ++    E+ L  +  
Sbjct: 139  TMPLKIDRYNLPEHKLPLSFLIVSKINIPSILLNEGYNLLKDYLYSITGRIEELLMCSPK 198

Query: 225  YGN-GVHLKRTVINYNRVYDFSGYFTWYTLQTRGSNHPFVSQQILFDLIDSDDKEIEAVS 283
            +    + +KRT+ +Y+R+ +    + WY      S H      + FD        I  + 
Sbjct: 199  FNQPALVVKRTLKDYDRMIECENCYCWYYFNAENSAH------LKFD------DNIACLM 246

Query: 284  QIESNXXXXXXXXXXXXXSAIQDISSASLNSGFYGDEDRSALEEYSDNYHHQVNQNEQVF 343
              E+N                  +  + +N+  Y  + +  +          +N  EQ++
Sbjct: 247  GSENNTE--------------NGLGDSRVNNNNYHKQPKDVV------MSRTINDQEQIY 286

Query: 344  SFDLNQDGSLELPNLMSHAAVRHEILMKVXXXXXXXXXXXXXXFKIVAGLVDPLTQPAPN 403
            SF+LN DG+LE+PN+M H+ +RHE+L K+              F  + GLVDPL QP PN
Sbjct: 287  SFELNHDGTLEIPNVMKHSLLRHELLFKILNLTPVSTPLLELQFSTLCGLVDPLMQPTPN 346

Query: 404  DKHVISLDLLYQMFLGFLTPEIQQTLEFEEGCDWRFHVCFNMQKIIDASLVRLNFDDFER 463
            DKH+IS+D L+++FLG + P I+ +    +  DW+F+ CFNMQKIIDA++ RLN  DF  
Sbjct: 347  DKHIISIDFLFKLFLGLMYPAIKSSQGHNDHYDWKFYTCFNMQKIIDATMSRLNCFDFNI 406

Query: 464  LNSINNSDDNVDWRSQLDKWLPHGFNTQDLELICMVDIIAVYTIYKLYEHLPIQLNPFLS 523
            LNS+NN+D +V WR+QL +WLPHG NTQDLEL+ M+DI+AVYTIYKLYE LPIQLNPFL 
Sbjct: 407  LNSVNNTDSSVHWRTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKLPIQLNPFLF 466

Query: 524  SLISLWKNLTCVILLGLEIDRIEEELETFDTPLMVRATIRGAAALRAIVATVLNGHVEAT 583
            SLISLWKNL+CVILL LEIDRIEEE  T++TPLMVRATIRGAAALR+++AT+LNG V+  
Sbjct: 467  SLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATILNGLVKTN 526

Query: 584  KHDIKHESLNTFMSPHGRKLCQGALYXXXXXXXXXXXXXXXXXXDVTSLFSDLQPGDRFD 643
            +HD KHESLNTFMSP+GRKL  GALY                  DVT LF+DLQ GDRFD
Sbjct: 527  EHDFKHESLNTFMSPYGRKLSHGALYADLRSHSASLLAFGTSIEDVTDLFADLQSGDRFD 586

Query: 644  EDVRYMFEYEFEDYNDLSSREEDYSGFDKYDDYTDSSKTHARKGF--GRRCNCIFXXXXX 701
            ED+RYMF+YE  DY++  S  +D    +   +  +  K+         RRCNCIF     
Sbjct: 587  EDIRYMFDYECADYDESFSESDDEGLEEGIVNAREKIKSSNDNNVFCQRRCNCIFNDDKL 646

Query: 702  XX------XXXXXXXXXGHKAPKQ---ILPQQNPTTSVSMSTTGKPHAIRSGGSFEFDYS 752
                             G +  +    ++     TTS  +ST+  P ++R+  +FEFDYS
Sbjct: 647  VAEDGLNEVFESTCNRNGERRVRNNIDVVSNTAITTSNHVSTSINPFSVRARSTFEFDYS 706

Query: 753  GKDWRDIPRMSNLYYSPNYHFVEDLDPNTIISLTNKATKQSLSKIESLLLLGSVATCVKN 812
            G+DWRD+PR  N+YYSP+Y F+ D   + I +LT +   + L++ ES+LL+ SVA+CVKN
Sbjct: 707  GEDWRDVPRDFNMYYSPSYPFIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKN 766

Query: 813  EQDEIVLG----NITELHHQNGSRGSQVIDK-----LKDISPDDIYEMWCKDSTFEKMVY 863
            EQD++VL     N+T +        S  I K     L+  +PDDIYE+W ++S FE+M+ 
Sbjct: 767  EQDQMVLADLKTNLTGISKHAEGENSTSISKTDNEELRRTTPDDIYEIWSEESAFERMLN 826

Query: 864  CNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLIHYIFELVMGLR-KSFXXXXXXXX 922
             NH+VAWRLMDEMLMC+G+RR+LIWF TH+EL HSLI+Y+FEL+MGLR K+F        
Sbjct: 827  VNHDVAWRLMDEMLMCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQD 886

Query: 923  XXXS-ISEM--TKEAPEVRTSLPFSRQGSIQLSSIETKMLLQEFFTNAAIFLTEKSKEWI 979
                 I E+   K+  +  +SLPFSRQG I LS IETKMLLQEFF NAAIFL+  +    
Sbjct: 887  KKDDMIYEILKKKQKNDDASSLPFSRQGPIILSDIETKMLLQEFFMNAAIFLSSNNS--- 943

Query: 980  GEEPMEDEATINDGENGNVSLYAVGLMKLICLMVRAFIKKGKFDFRESECVFELQTLLMN 1039
                   E    DGE   +SLY++GL++LIC MV+  I   KF F +SEC FELQTLLM 
Sbjct: 944  -------EEENEDGE--KISLYSLGLVRLICYMVQTLITNDKFFFTKSECTFELQTLLMT 994

Query: 1040 WIAIIPEAKDLFFELKA-LVAEVHSDPMDDEELSNNPPDSNKKLSSMVENDNINGNEAVD 1098
            WI I+PEAKDLFFE+K  L  E  +D    +       D  KKL           N    
Sbjct: 995  WIGILPEAKDLFFEIKTRLAMEEDNDTGTMQHEGRRSLDIEKKL-----------NTKPA 1043

Query: 1099 SEYNRKLISLLSPVMHRKEENAAVVALRNFIKKYSFDTTVPLIGRKVVYEGNEILPLPES 1158
            S+ N KL+SL         EN+A+  LRNFI  YSFDT V   GRKVV+   +ILPL ++
Sbjct: 1044 SKLNLKLLSLFPSNSADNGENSAINTLRNFITDYSFDTQVNPPGRKVVFYDGKILPLTKA 1103

Query: 1159 ETPMSLLDYLV 1169
            + P+ L +Y+ 
Sbjct: 1104 DKPIPLHEYIT 1114

>Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W
            (REAL)
          Length = 1123

 Score =  847 bits (2189), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/1151 (41%), Positives = 694/1151 (60%), Gaps = 94/1151 (8%)

Query: 46   KMISLEELLAERELDYDARFEFLDRLLRDSKSWKDPQLKYSLLLEMVIVALLTTRAGLSV 105
            + + L+ LL ++  +Y    E L++LL +     D +++ S+L E + + L TT++G S+
Sbjct: 30   QFVPLQVLLKDK--NYVPSLENLEKLLYNESILDDQKIRLSILFEALSIILFTTKSGKSI 87

Query: 106  LALLKPSGSNPSIPKCISNQRKWLAQVERKGKLHSDLISQWQSDDDIFLKFLHFLLKNED 165
            L  ++ S         +  ++ W   +      ++ ++  W+ +D +FLKFL FLL N+ 
Sbjct: 88   LQAVQAS--------TLKEKKLWAQSLRDDDSNYASVVQGWKDNDVLFLKFLRFLLANKT 139

Query: 166  VWLPCENVNQCEWKVPLSFLIQSKYRAAELILDPSYNLLVDYFLAVVPLCEKWLR-RAIS 224
              L  +  N  E+K+PLSFLI SK     +IL+  +N+L DY  ++    +  +R  +I+
Sbjct: 140  TSLQIDKYNLPEYKLPLSFLIVSKINFPSIILNEGHNMLKDYLYSMSGRIDCLIRGNSIT 199

Query: 225  YGNGVHLKRTVINYNRVYDFSGYFTWYTLQTRGSNHPFVSQQILFDLIDSDDKEIEAVSQ 284
              + + +K+ + +Y+R+ +F   + WY+          V   + F+  D+ D        
Sbjct: 200  SRSALVVKKILKDYDRIVEFHNLYFWYSFN--------VENDVNFEFSDNFD-------- 243

Query: 285  IESNXXXXXXXXXXXXXSAIQDISSASLNSGFYGDEDRS-ALEEYSDN--YHHQVNQNEQ 341
                               + +      + G   D  +S   ++++ N      +N  EQ
Sbjct: 244  ------------------LLMNSPEDHADGGVIDDRCKSDNPQKHAKNTIIKRTINDQEQ 285

Query: 342  VFSFDLNQDGSLELPNLMSHAAVRHEILMKVXXXXXXXXXXXXXXFKIVAGLVDPLTQPA 401
            ++SF+L+QDG+L++PN+M H+ +RHE+L K+              F  + GLVDPL QP+
Sbjct: 286  IYSFELDQDGTLQIPNIMEHSLMRHELLFKILNLPSVLTPLLELQFCNLCGLVDPLMQPS 345

Query: 402  PNDKHVISLDLLYQMFLGFLTPEIQQTLEFEEGCDWRFHVCFNMQKIIDASLVRLNFDDF 461
            PND+ VIS+D L+Q+FLG + P I+ + E  +  DW+F+ CFNMQKIIDA+++RLN  DF
Sbjct: 346  PNDEQVISIDFLFQLFLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRLNCSDF 405

Query: 462  ERLNSINNSDDNVDWRSQLDKWLPHGFNTQDLELICMVDIIAVYTIYKLYEHLPIQLNPF 521
            ERLNS+NN+D  + WR+QL KWLPHG NTQDLEL+ M+DI+A+YTIYKLYE +PIQLNPF
Sbjct: 406  ERLNSVNNTDSVIHWRTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPF 465

Query: 522  LSSLISLWKNLTCVILLGLEIDRIEEELETFDTPLMVRATIRGAAALRAIVATVLNGHVE 581
            L SL+SLWKNL+CVILL LEIDRIEEE  T++TPLMVRATIRGAAALR+++A+VLNG V+
Sbjct: 466  LFSLLSLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVK 525

Query: 582  ATKHDIKHESLNTFMSPHGRKLCQGALYXXXXXXXXXXXXXXXXXXDVTSLFSDLQPGDR 641
            +  HD KHESLNTFMSP+GRKLC GALY                  DVT LF+DLQ GDR
Sbjct: 526  SNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDR 585

Query: 642  FDEDVRYMFEYEFEDYNDLSSREEDYSGFDKYDDYTDSSKTHARKGF-GRRCNCIFXXXX 700
            FDED+RYMF+YE EDYN+  S E D    ++  +     K+ +  GF  RRCNCIF    
Sbjct: 586  FDEDIRYMFDYECEDYNEPFS-ESDDEQLNEDANSRGKIKSSSSNGFYQRRCNCIFNDDK 644

Query: 701  XXXXXXXXXX-------XXGHKAPK--QILPQQNPTTSVSMSTTGKPHAIRSGGSFEFDY 751
                                ++ P    ++P    T S   +++  P ++RS  +FEFDY
Sbjct: 645  LVAEDGTNEAFEISGNSNMENEMPNNVNVIPSTATTNSNRFASSINPLSVRSRSTFEFDY 704

Query: 752  SGKDWRDIPRMSNLYYSPNYHFVEDLDPNTIISLTNKATKQSLSKIESLLLLGSVATCVK 811
            SG+DWRD+P+  N+YYSP+Y F+++   + I +LT +   + L++ +S++L+ SVA+CVK
Sbjct: 705  SGEDWRDVPKDFNMYYSPSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVK 764

Query: 812  NEQDEIVL----GNITELHHQNGSRGSQVIDK-----LKDISPDDIYEMWCKDSTFEKMV 862
            NEQD+++L     N  E+     ++ S  I K     L+  +PDDIYE+W ++S FE+M+
Sbjct: 765  NEQDQMILSDLGSNFAEIDENPEAKSSNNITKTNNEELRRTTPDDIYEIWSEESAFERML 824

Query: 863  YCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLIHYIFELVMGLR-KSFXXXXXXX 921
              NH+VAWRLMDEMLMC+G+RR+LIWF+TH+EL HSLI+Y+FELVMGLR K F       
Sbjct: 825  NVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQ 884

Query: 922  XXXXS-ISEMTKEAP--EVRTSLPFSRQGSIQLSSIETKMLLQEFFTNAAIFLTEKSKEW 978
                  I E+ K+    E  + LPFSRQG I LS IETKMLLQEFF NAAIFL+ K+ E 
Sbjct: 885  DRKDDMIYEILKKKRKNEDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNDEE 944

Query: 979  IGEEPMEDEATINDGENGNVSLYAVGLMKLICLMVRAFIKKGKFDFRESECVFELQTLLM 1038
              E+  +            +SLY++GL+KLIC MV+  I   KF F +SEC FELQTLLM
Sbjct: 945  ENEDGEK------------ISLYSLGLVKLICYMVQTLIANDKFLFTKSECTFELQTLLM 992

Query: 1039 NWIAIIPEAKDLFFELKALVAEVHSDPMDDEELSNNPPDSNKKLSSMVENDNINGNEAVD 1098
             WI ++PEAKDLFF++K  +A       D ++      D NK L   VE      +   +
Sbjct: 993  TWIGVLPEAKDLFFQIKTRLAMEEDSDKDGQQ-----NDDNKDLE--VER---RPHTKSN 1042

Query: 1099 SEYNRKLISLLSPVMHRKEENAAVVALRNFIKKYSFDTTVPLIGRKVVYEGNEILPLPES 1158
            SE N KL++L         +N+A+  LR+FI  Y FDT +   GRKVV+   +ILPL ++
Sbjct: 1043 SELNVKLLNLFPSNPAGNNDNSAISTLRSFITDYPFDTQITPPGRKVVFYDGKILPLSKA 1102

Query: 1159 ETPMSLLDYLV 1169
            + P+ L +Y+ 
Sbjct: 1103 DKPIPLHEYIT 1113

>SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/1105 (42%), Positives = 651/1105 (58%), Gaps = 59/1105 (5%)

Query: 86   SLLLEMVIVALLTTRAGLSVLALLKPSGSNPSIPKC-ISNQRKWLAQVERKGKLHSDLIS 144
            +++ EM+I++L  T  G S+L L      + S  +  +S+ ++W     R    +  L+ 
Sbjct: 47   AVVQEMLILSLFVTLPGHSILELY----YDLSCGRVDLSSYKQWQHSQVRSTDGYKKLVK 102

Query: 145  QWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKVPLSFLIQSKYRAAELILDPSYNLL 204
            +W +   + L+F   LL+N++V L     N  E+K+ L FL+  +     LILDP YNLL
Sbjct: 103  RWSTSTLVLLRFTDLLLQNKNVPLEYTKHNTAEYKLSLIFLLDKQNEF--LILDPDYNLL 160

Query: 205  VDYFLAVVPLCEKWLRRAISYGN--GVHLKRTVINYNRVYDFSGYFTWYTLQTRGSNHPF 262
            +DY L   P+ E     +I  GN  G+ LK  V  YN++ +F+G  TWYT +T       
Sbjct: 161  LDYLLHAKPMIE-----SILLGNIPGL-LKALVYQYNKLPEFNGCHTWYTFRTHYHGTQE 214

Query: 263  VSQQILFDLIDSDDKEIEAVSQIESNXXXXXXXXXXXXXSAIQDISSASLNSGFYGDEDR 322
            +  +    L D      E + ++E                 I+ I+     S        
Sbjct: 215  IFHKFFIALTDKFTASKEIMPELEG---WFVEGPVSRDSGCIKPITGDDYTSS------- 264

Query: 323  SALEEYSDNY--HHQVNQNEQVFSFDLNQDGSLELPNLMSHAAVRHEILMKVXXXXXXXX 380
            +A+++++++Y    + N  EQV+SF+LN+DG+LE+PN+ +H   RH+ L KV        
Sbjct: 265  AAIDDFNEDYWTQQKTNTQEQVYSFELNEDGTLEIPNVFAHTKRRHDALYKVLGLNDDPT 324

Query: 381  XXXXXXFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLGFLTPEIQQTLEFEEGCD-WRF 439
                  F     L DP+TQP PNDKH++SLDLL  MFLG + PEI   L      D W  
Sbjct: 325  PLLKSCFLTFCCLADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEITADLVQPLNKDTWTL 384

Query: 440  HVCFNMQKIIDASLVRLNFDDFERLNSINNSDDNVDWRSQLDKWLPHGFNTQDLELICMV 499
            H+CFN+QKII+A+L RLN DDF RLN INNSDD+VDWR  L KWLP G NTQDLELI MV
Sbjct: 385  HICFNLQKIINATLSRLNCDDFTRLNEINNSDDSVDWRKNLYKWLPQGLNTQDLELIYMV 444

Query: 500  DIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILLGLEIDRIEEELETFDTPLMVR 559
            DI+A YTIYKLY + PIQ+NPFL  +ISLWKNLTCV+LLGLEIDR+EEE ETF+TP+MVR
Sbjct: 445  DILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLEEEQETFNTPVMVR 504

Query: 560  ATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSPHGRKLCQGALYXXXXXXXXXX 619
            ATIRGA+ALR+++AT++NGH     HD KHE +N FMSPHGRKLC GALY          
Sbjct: 505  ATIRGASALRSVLATIINGHARYKSHDFKHEPINLFMSPHGRKLCNGALYADLRSHAATM 564

Query: 620  XXXXXXXXDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYNDLSSREEDYSGFDKYDDYTDS 679
                     +T L SDLQPGDRFDEDV+YMF+YEF+DYN++ +   +    D+ +D    
Sbjct: 565  LALGIELETLTDLLSDLQPGDRFDEDVKYMFDYEFDDYNEVDT---ELMADDELEDIESR 621

Query: 680  SKTHARKGFGRRCNCIF----------XXXXXXXXXXXXXXXXGHKAPKQILPQQNPTTS 729
             +    +G+ +RC+C+F                                Q+ PQQN    
Sbjct: 622  ERIKEVRGYYKRCHCVFDDDSLVPENEDGGGEEGDQEDTKKHLQDSHEDQLPPQQN---- 677

Query: 730  VSMSTTGKPHAIRSGGSFEFDYSGKDWRDIPRMSNLYYSPNYHFVEDLDPNTIISLTNKA 789
            V MSTT KP A+RS  + EFD++G+DWRDIPR  N YY+  Y FV  L  + +  L  +A
Sbjct: 678  VVMSTTSKPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYTDAYIFVTKLHADVVHYLMKEA 737

Query: 790  TKQSLSKIESLLLLGSVATCVKNEQDEIVLGNITELHHQNGSRGSQ--VIDKLKDISPDD 847
            T++ L +  +  +L S+ATCVK EQ+E ++     L +Q+G + S    I    +++ D 
Sbjct: 738  TRKKLERNHASFILRSIATCVKLEQEEAIVRR--ALGNQDGDKSSNATTIKTENELTSDF 795

Query: 848  IYEMWCKDSTFEKMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLIHYIFELV 907
            IYE WC+DS FEKM+Y N ++ WR+MDEMLMCSG+RRVLIWFITH+E+NHS+IHYIFELV
Sbjct: 796  IYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGYRRVLIWFITHLEINHSVIHYIFELV 855

Query: 908  MGLRK--SFXXXXXXXXXXXSISEMTKEAPEVRTSLPFSRQGSIQLSSIETKMLLQEFFT 965
            MGLR   ++           ++  + + +     +LPFSRQG I LSSIE  MLLQEFFT
Sbjct: 856  MGLRGNITYEDDEEKSKNLDALDGLAQGSSTSELTLPFSRQGPIILSSIEVNMLLQEFFT 915

Query: 966  NAAIFLTEKSKEWIGEEPMEDEATINDGENGNVSLYAVGLMKLICLMVRAFIKKGKFDFR 1025
            NAAIF + K +E    E  E +    D +  +V  + +GLMKL+C MV   ++K KFDF 
Sbjct: 916  NAAIFFSSKLRESFDSENEELDENFEDEDEFSVPPHVIGLMKLVCFMVDTLMQKKKFDFT 975

Query: 1026 ESECVFELQTLLMNWIAIIPEAKDLFFELKALVAEVHSDPMDDEELSNNPPDSNKKLSSM 1085
            +SE +FELQTLLMNWI I+PEA+DLFF+LK+ +     D  +        P    +   +
Sbjct: 976  DSEYIFELQTLLMNWIGIVPEARDLFFKLKSQIVATSQDTQE-----QGTPVKESEKDDI 1030

Query: 1086 VENDNINGNEAVDSEYNRKLISLLSPVMHRKEENAAVVALRNFIKKYSFDTTVPLIGRKV 1145
               D +  N+ + SE+N+KL+ L+ P      E  A+ ALR FI KYS      + GRK+
Sbjct: 1031 DAPDTLEMNDTM-SEHNKKLMMLIPP--GTTNERNALTALRGFIGKYSLTNKTAVFGRKI 1087

Query: 1146 VYEGNEILPLPESETPMSLLDYLVD 1170
            +Y+ +EI+ +  ++  M   ++L +
Sbjct: 1088 IYQDDEIMGMYMTDKEMMYREFLAE 1112

>KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3.497
            YGR134W
          Length = 1066

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/1095 (43%), Positives = 656/1095 (59%), Gaps = 105/1095 (9%)

Query: 86   SLLLEMVIVALLTTRAGLSVLALLKPSGSNPSIPKCISNQRKWLAQVERKGKLHSDLISQ 145
            S+LLE ++++L TT++G S+L++L    +N  +         WL      G L+   +  
Sbjct: 51   SVLLEGLVISLFTTKSGHSILSVLNNPDANSEL---FQRYNSWLES--SSGDLNYKYLKH 105

Query: 146  --WQSDDDIFL-KFLHFLLKNEDVWLPCENVNQCEWKVPLSFLIQSKYRAAELILDP-SY 201
              WQS+ + +L +F  FLL+NE V     N +  ++K+ L  LI S+     LIL+  +Y
Sbjct: 106  ELWQSNRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRLINSESNIISLILNSDNY 165

Query: 202  NLLVDYFLAVVPLCEKWLRRAISY-GNGVHLKRTVINYNRVYDFSGYFTWYTLQTRGSNH 260
            NLL+D+ +   P    ++   ISY   G      +  YNR+Y+ +G+ TWYTL T  SN 
Sbjct: 166  NLLLDFIMFFQP----YMNDLISYIVEGNKFFEIIAKYNRIYELNGFHTWYTL-TIASNT 220

Query: 261  PFVSQQILFDLIDSDDKEIEAVSQIESNXXXXXXXXXXXXXSAIQDISSASLNSGFYGDE 320
              ++ + L D++  D        Q  SN                            Y D+
Sbjct: 221  S-IAVRYLNDVLSIDPM---ITDQFTSN----------------------------YRDK 248

Query: 321  DRSALEEYSDNYHHQVNQNEQVFSFDLNQDGSLELPNLMSHAAVRHEILMKVXXXXXXXX 380
                 EE       Q  +++ +FSFDLN+ G  +LPNL+ H+ +RH+I+  +        
Sbjct: 249  AFQESEETLLMSQQQTAKDDIIFSFDLNETG--DLPNLIKHSEMRHQIIYDILNLNQIDS 306

Query: 381  XXXXXXFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLGFLTPEIQQTLEFEEGCDWRFH 440
                  F ++ GLVDPLTQP PN++H+IS+DL+YQ+F+G +       L  ++     F 
Sbjct: 307  PFLKKQFLLICGLVDPLTQPQPNNEHIISIDLIYQLFMGLMYKFNNNELAGKDKELQHFT 366

Query: 441  VCFNMQKIIDASLVRLNFDDFERLNSINNSDDNVDWRSQLDKWLPHGFNTQDLELICMVD 500
            +CFNMQKII  SLV LN +D++ L++I N   N D+++ L+KWLPHG NTQDLELI M++
Sbjct: 367  ICFNMQKIISRSLVLLNCNDYDTLSTILNDFPN-DYKTALNKWLPHGINTQDLELIYMIN 425

Query: 501  IIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILLGLEIDRIEEELETFDTPLMVRA 560
            IIA+YTIYKLY +LPIQLNPFL +L+SLWK L+ ++L+GLEIDRIEE  ET+DTP++VRA
Sbjct: 426  IIAIYTIYKLYSNLPIQLNPFLQTLVSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRA 485

Query: 561  TIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSPHGRKLCQGALYX-XXXXXXXXX 619
            TIRGAAALRA++AT+LN HV   +HD KHES NTFMSPHGRKLC GAL            
Sbjct: 486  TIRGAAALRAVIATILNDHVSTKEHDFKHESFNTFMSPHGRKLCSGALLADLRSHAAAIL 545

Query: 620  XXXXXXXXDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYNDLSSREEDYSGFDKYDDYTDS 679
                    DVT L +DLQ GDRFDEDV+Y+FEYE++DYN+L   +E  +  ++ +     
Sbjct: 546  ALGDGELHDVTELLADLQAGDRFDEDVKYIFEYEYQDYNELGEEDEQTNELEELE----- 600

Query: 680  SKTHARKGFGRRCNCIFXXXXXXXXXXXXXXXXGHKAPKQILPQQNPTTSVSMSTTGKPH 739
             K   +K   RRCNCIF                G+++ ++ +  +      S  +   P+
Sbjct: 601  -KRSVKK---RRCNCIF--EDDKMLEDYEYYEVGNESRREDMNLE------SDKSRTNPY 648

Query: 740  AIRSGGSFEFDYSGKDWRDIPRMSNLYYSPNYHFVEDLDPNTIISLTNKATKQSLSKIES 799
            ++R    FEFDYSGKDWRD+PR  NLYYSP+Y F+++    T++  T KAT + LS  +S
Sbjct: 649  SVRVNSIFEFDYSGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTEKLSDEDS 708

Query: 800  LLLLGSVATCVKNEQDEIVLGNITELHHQNGSRGSQVIDKLKDISPDDIYEMWCKDSTFE 859
            LLLL SVA+CVK EQ++++L N     + N    S   D  ++++PDD+YE+WC++S FE
Sbjct: 709  LLLLQSVASCVKLEQEKMILEN-----YSNTKNCSTEEDLDREVTPDDVYEIWCEESAFE 763

Query: 860  KMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLIHYIFELVMGLRKSFXXXXX 919
            +M+Y N EVAWRLMDEMLMC+G+RRVL+WFITHME+NHSL+HYIFELVMGLR        
Sbjct: 764  RMIYLNKEVAWRLMDEMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQRDDSRN 823

Query: 920  XXXXXXSISEMTKEAPEVRTS--LPFSRQGSIQLSSIETKMLLQEFFTNAAIFLTEKSKE 977
                      +     + + S  +PFSRQGSI LS IETKMLLQEFFTNAAIF +     
Sbjct: 824  PGDDRLKSLLLQDMMTDKKGSEKVPFSRQGSIILSEIETKMLLQEFFTNAAIFFS----- 878

Query: 978  WIGEEPMEDEATINDGENGNVSLYAVGLMKLICLMVRAFIKKGKFDFRESECVFELQTLL 1037
                    D A ++  ++ NVSLYA+GL+KLIC MV+  +   KFDF +SEC FELQTLL
Sbjct: 879  ------TNDTANMSSNDSENVSLYAIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTLL 932

Query: 1038 MNWIAIIPEAKDLFFELKALVAEVHSDPMDDEELSNNPPDSNKKLSSMVENDNINGNEAV 1097
            MNWI IIPEA++LFF LKA V E   +   D                   +D  + NE  
Sbjct: 933  MNWIGIIPEAQELFFTLKANVGEPSMEGKSD-------------------SDGTDSNEGE 973

Query: 1098 DSEYNRKLISLLSPVMHRKEENAAVVALRNFIKKYSFDTTVPLIGRKVVYEGNEILPLPE 1157
             S YN KL++LL    +   EN A+  LR+F+KKYSF   VP++GRKV+Y+ ++ILP+P+
Sbjct: 974  LSWYNSKLLALLPSPTNSGLENPAIETLRSFLKKYSFTNKVPVVGRKVIYKDDKILPIPK 1033

Query: 1158 SETPMSLLDYLVDNY 1172
               P+ L + + +N+
Sbjct: 1034 LYQPILLRELIDENF 1048

>Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON}
            complement(23340..26684) [3345 nt, 1115 aa]
          Length = 1114

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/1158 (39%), Positives = 653/1158 (56%), Gaps = 131/1158 (11%)

Query: 68   LDRLLRDSKS----WKDPQLKYSLLLEMVIVALLTTRAGLSVLALL-------------K 110
            L++LLRD         D ++K S + E+ ++AL TTR G+S+L  L              
Sbjct: 28   LEQLLRDENQVLDLLADIEVKGSFITEVTVIALFTTRPGISLLNCLTDNFGIDEDNKDFN 87

Query: 111  PSGSNPSIPKCISNQRKWLAQVERKGKLHSDLISQWQSDDDIFLKFLHFLLKNEDVWLPC 170
            P+   P +P+                     L  +W  D+ I +KFL F++ N ++ +  
Sbjct: 88   PNSLLPRMPQ---------------------LALKWMHDELILIKFLRFIIDNRNMDINF 126

Query: 171  ENVNQCEWKVPLSFLIQ---SKYRAAELILDPSYNLLVDYFLAVVPLCEKWLRRAISYGN 227
            +N N    K+ L FLI+   S + +  L+ +   +++ +Y  A+ P  +  ++ +++  N
Sbjct: 127  KNKNDILSKLQLDFLIKNETSDFISLNLLTN-EVDVVREYLTAIWPKLKNIIKISLNGEN 185

Query: 228  ------GVHLKRTVINYNRVYDFSGYFTWY---TLQTRGSNHPFVSQQILFDLIDSDDKE 278
                       RT+++Y R+Y+   +F +Y   +++T GS                 D  
Sbjct: 186  EYIDCEDSFFVRTILSYKRLYETLLHFEFYDYSSMKTNGS-----------------DIY 228

Query: 279  IEAVSQIESNXXXXXXXXXXXXXSAIQDISSASLNSGFYG------DEDRSALEEYSDNY 332
            ++A+ +  +                   I + S N   +G      D D   +EE     
Sbjct: 229  VKALMKHLTGLSNFSFQLFKLSGYFYNTIDNQSYNPSKFGFIPLSVDPDDGEVEE----- 283

Query: 333  HHQVNQNEQVFSFDLNQDGSLELPNLMSHAAVRHEILMKVXXXXXXXXXXXXX-----XF 387
                NQ       ++ Q   L+ P+LM+  A RH  L K+                   +
Sbjct: 284  ----NQETD----NILQPSLLDFPDLMNETAKRHLALSKLIIDSKLEKQISNSPLLQIQY 335

Query: 388  KIVAGLVDPLTQPAPNDKHVISLDLLYQMFLGFLTPEIQQTLEFEEGCDWRFHVCFNMQK 447
            K +  L+DPLTQP PND HVIS+DLL  MFLG + P I   L  ++G DWRFH+CFNMQ+
Sbjct: 336  KTLLALIDPLTQPVPNDTHVISIDLLCNMFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQ 395

Query: 448  IIDASLVRLNFDDFERLNSINNSDDNVDWRSQLDKWLPHGFNTQDLELICMVDIIAVYTI 507
            II ASL  LN +DFERL ++   D++ DWRSQL  WLP G NTQ+LEL+ M  I+AVYTI
Sbjct: 396  IIIASLFVLNCNDFERLGTV---DESKDWRSQLHLWLPRGLNTQNLELVYMSCILAVYTI 452

Query: 508  YKLYEHLPIQLNPFLSSLISLWKNLTCVILLGLEIDRIEEELETFDTPLMVRATIRGAAA 567
            YKLY   P+  NPFLSSLISLWK+LTCV+L GL+IDR+EE  ++FDTP++VRATIRGAAA
Sbjct: 453  YKLYSDSPVHFNPFLSSLISLWKSLTCVVLYGLQIDRLEESNQSFDTPIIVRATIRGAAA 512

Query: 568  LRAIVATVLNGHVEATKHDIKHESLNTFMSPHGRKLCQGALYXXXXXXXXXXXXXXXXXX 627
            LR+IVATVLN  +E  +HD  HESLNTFMSPHGRKLC GALY                  
Sbjct: 513  LRSIVATVLNEQMELKRHDFIHESLNTFMSPHGRKLCDGALYADLKAYTASILALGAEFQ 572

Query: 628  DVTSLFSDLQPGDRFDEDVRYMFEYEFEDYNDLSSREEDYSGFDKYDDYTDSSKTHARKG 687
            +VT L S LQ GD+FDEDV+YMFEYE+EDYN++     + +  ++  DY  +        
Sbjct: 573  EVTDLVSYLQAGDQFDEDVKYMFEYEYEDYNEIYEDSSNENEENEEIDYAFNK------- 625

Query: 688  FGRRCNCIFXXXXXXXXXXXXXXXXGHKAPKQI-----LPQQNPTTSVSMSTTG------ 736
              RRCNCIF                  +    I        +  T     S +G      
Sbjct: 626  --RRCNCIFSDDNLIEEEEDDEEESDVEKTSDIDGEIATKSKEHTEKTIESDSGLSNQLS 683

Query: 737  KPHAIRSGGSFEFDYSGKDWRDIPRMSNLYYSPNYHFVEDLDPNTIISLTNKATKQSLSK 796
            KPHA+RS  +FEFDYSGKDWRDIPR  NLYYSP Y+F++  D NT+  LT KAT + L+K
Sbjct: 684  KPHAVRSKSNFEFDYSGKDWRDIPREYNLYYSPFYNFIDRPDLNTVFVLTLKATSEKLTK 743

Query: 797  IESLLLLGSVATCVKNEQDEIVLGNITELHHQNGSRGSQVIDKLKDISPDDIYEMWCKDS 856
             E+ LLL SVA+ VKNEQD ++ GN+  L     S   +  D  K+ +PDDIYE+WC++S
Sbjct: 744  EEAALLLCSVASTVKNEQDRMIFGNL--LEQDKSSTADEHEDTKKEATPDDIYEIWCEES 801

Query: 857  TFEKMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLIHYIFELVMGLRKSFXX 916
             FE++++ N ++AW+LMDEMLMCSG+RRVLIWFITHMEL+HSLI YIF+L+MG R     
Sbjct: 802  AFERILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHMELSHSLIIYIFDLMMGSRGINKT 861

Query: 917  XXXXXXXXXSISEMTKEAPEVRTSLPFSRQGSIQLSSIETKMLLQEFFTNAAIFLTEKSK 976
                      I+E   ++     SL FSR G ++LS +ET+M+LQE FTNAAI+ ++K++
Sbjct: 862  DTSKNVKSTFITENISDSNS--NSLKFSRMGHLKLSELETRMILQELFTNAAIYFSDKAR 919

Query: 977  EWIGEEPMEDEAT----INDGENGNVSLYAVGLMKLICLMVRAFIKKGKFDFRESECVFE 1032
            +        D +T     ++   G  S+Y+VGLMKLIC+MV   I+  KF+  ES+CVFE
Sbjct: 920  KSNQSILTPDYSTEEEEFDEENEGGYSIYSVGLMKLICIMVSKLIENSKFNVNESDCVFE 979

Query: 1033 LQTLLMNWIAIIPEAKDLFFELKALVAEVHSDPMDDEELSNNPPDSNKKLSSMVENDNIN 1092
            LQTLLM WI+I+PEAK+L F++ + ++E     +++ EL++    S K    +V+ +   
Sbjct: 980  LQTLLMGWISILPEAKELSFKINSSLSEFSH--VENSELASIEGASTKSHKQLVDKN--- 1034

Query: 1093 GNEAVDSEYNRKLISLLSPVMHRKEENAAVVALRNFIKKYSFDTTVPLIGRKVVYEGNEI 1152
               +   +YN  L+ L+ P    KEEN      R++IK YSFD+ V  + RK++++ +EI
Sbjct: 1035 ---SESYKYNEILLKLIPPTFGGKEENIIFNTFRDYIKDYSFDSEVSTMCRKIIHQSDEI 1091

Query: 1153 LPLPESETPMSLLDYLVD 1170
            LPL +SE P S  DYL +
Sbjct: 1092 LPLQDSEKPFSFHDYLTE 1109

>NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {ON}
            Anc_3.497
          Length = 1150

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/884 (47%), Positives = 546/884 (61%), Gaps = 78/884 (8%)

Query: 340  EQVFSFDLNQDGSLELPNLMSHAAVRHEILMK-VXXXXXXXXXXXXXXFKIVAGLVDPLT 398
            + V+SFDLN D + EL N++SH A RH +L + +              F  +AGLVDPL+
Sbjct: 275  QTVYSFDLNTDKTFELDNVVSHTAKRHRVLNQLINNNDLKTTPLLTLQFTFMAGLVDPLS 334

Query: 399  QPAPNDKHVISLDLLYQMFLGFLTPEIQQTLEFEEGCDWRFHVCFNMQKIIDASLVRLNF 458
            QP PN+K VISL LLY MF+G + P +++     +G +W+FH+CFNM K+I+ S+V L  
Sbjct: 335  QPPPNNKQVISLHLLYSMFIGLMYPNLKECFNANDGFNWKFHICFNMVKLINNSMVILKC 394

Query: 459  DDFERLNSI----------NNSDDNVDWRSQLDKWLPHGFNTQDLELICMVDIIAVYTIY 508
            D+F +LN I            +DD+  W+ +L++W+PHG NTQDLELI M++I+AVYTIY
Sbjct: 395  DNFNKLNDIINSNNDNDEGTENDDDDAWKLKLNEWIPHGINTQDLELIYMINIMAVYTIY 454

Query: 509  KLYEHLPIQLNPFLSSLISLWKNLTCVILLGLEIDRIEEELETFDTPLMVRATIRGAAAL 568
            +LY  LPIQ+NPFLS LI+LWKNL+ +ILLGL+IDR EE  +TF TPL+VRATIRGAA+L
Sbjct: 455  QLYSDLPIQMNPFLSCLITLWKNLSAIILLGLDIDRSEEARKTFSTPLLVRATIRGAASL 514

Query: 569  RAIVATVLNGHVEATKHDIKHESLNTFMSPHGRKLCQGALYXXXXXXXXXXXXXXXXXXD 628
            RA+VAT+LN HV+  +HD KHE LNTFMSPHGRKLCQGALY                  D
Sbjct: 515  RAVVATILNNHVDVNEHDFKHEPLNTFMSPHGRKLCQGALYADIRSHAAAILALGAELED 574

Query: 629  VTSLFSDLQPGDRFDEDVRYMFEYEFEDYNDLSSREEDYSGFDKYDDYTDSSKTHARKGF 688
            VT L +DLQ GDRFDED+RYMF+YE++DYND              DD  +  +      F
Sbjct: 575  VTDLLTDLQAGDRFDEDIRYMFDYEYDDYNDFK------------DDVEEQEEMEIMGSF 622

Query: 689  GRRCNCIFXXXXXXXXXXXXXXXX-------------GHKAPKQILPQQNPTTSVSMST- 734
             RRCNCIF                               +   +  P  N     ++ T 
Sbjct: 623  PRRCNCIFEDDNIINDDTDNINENDEDDDDEQEEYVDAIEGVTKDTPHNNLNPHDAIRTR 682

Query: 735  TGKPHAIRSGGSFEFDYSGKDWRDIPRMSNLYYSPNYHFVEDLDPNTIISLTNKATKQSL 794
               P++ RS  SFEFDY GKDWRDIPR  NLYYSP+YHF++     TI +LT+KAT + L
Sbjct: 683  NSHPNSKRSKSSFEFDYGGKDWRDIPRGFNLYYSPSYHFIKSPMMETISTLTSKATNEKL 742

Query: 795  SKIESLLLLGSVATCVKNEQDEIVLGNITE---LHHQNGSRGSQVIDKLKDISPDDIYEM 851
            +  +S LL+ +VA+C+K EQD+++   + +   + H + +      D  K  +PDDIY+M
Sbjct: 743  TTEDSTLLITAVASCIKLEQDKMISKELLKHNTVKHPHAAENEDDAD-FKIATPDDIYDM 801

Query: 852  WCKDSTFEKMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLIHYIFELVMGLR 911
            W ++S FE+M+Y N +VAWRLMDEMLMC+G+RRVLIWFITHMELNHSLI YIFELVMGLR
Sbjct: 802  WSEESKFERMLYLNQDVAWRLMDEMLMCNGYRRVLIWFITHMELNHSLIQYIFELVMGLR 861

Query: 912  KS-FXXXXXXXXXXXSI-------SEMTKEAPEVRTSLPFSRQGSIQLSSIETKMLLQEF 963
             S F            +           KE     T LPFSRQG + LS IE KMLLQEF
Sbjct: 862  GSPFSGEGDETDSKNDLLHEIMYGQVKNKEIVTSLTYLPFSRQGPLILSEIENKMLLQEF 921

Query: 964  FTNAAIFLTEKSKEWIGEEPMEDEATIN-------DGENGNVSLYAVGLMKLICLMVRAF 1016
            FTNAAI+ + KS          +E T N       D E  N S+Y+ GL+KLIC MV++ 
Sbjct: 922  FTNAAIYFSSKSN---------NEGTTNNDNGEGIDEEAVNFSVYSTGLVKLICFMVQSL 972

Query: 1017 IKKGKFDFRESECVFELQTLLMNWIAIIPEAKDLFFELKALVAEV------HSDPMDDEE 1070
            ++  KFDF +SEC FELQTLLMNWI IIPEA+DLFF LK+ V+         SD  D+  
Sbjct: 973  MENNKFDFAKSECTFELQTLLMNWIGIIPEAEDLFFTLKSGVSSSSTKTGRESDDHDNTH 1032

Query: 1071 LSN----NPPDSNKKLSSMVENDNINGNEAVDSEYNRKLISLLSPVMHRKEENAAVVALR 1126
              N    +  D+     S  + D+   NE++   +N++L+SLL   ++ K+ENAAV  LR
Sbjct: 1033 ADNLSFSDDGDTGHPGISRFDTDDSPPNESI---FNKRLVSLLPKRINDKDENAAVSTLR 1089

Query: 1127 NFIKKYSFDTTVPLIGRKVVYEGNEILPLPESETPMSLLDYLVD 1170
            +FI++YSFD   P+ GRKVVY    +LPLP ++ P+S  +YL +
Sbjct: 1090 HFIERYSFDEEAPVYGRKVVYSDEIVLPLPAADQPISFHEYLTE 1133

 Score = 71.6 bits (174), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 58/176 (32%), Positives = 82/176 (46%), Gaps = 9/176 (5%)

Query: 81  PQLKYSLLLEMVIVALLTTRAG-LSVLALLKPSGSNPSIPKCISNQ-RKWLAQVERKGKL 138
           P  ++SLL+E VI+  L+TR+G L   AL        +    + NQ +KWL   +     
Sbjct: 65  PIQEHSLLVECVIIGFLSTRSGKLLQSALFNDKHQQDTF---LENQYKKWLTSTDISKTA 121

Query: 139 HSDLISQWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKVPLSFLIQSKYR-AAELIL 197
           H  L  +W S+   FLKF  FLL N D  +  +   +  +K+PL+FL           IL
Sbjct: 122 HQYLRKKWSSNKLYFLKFTKFLLVNADGNINVDKYTEPIYKLPLNFLFDDNTNLMPTFIL 181

Query: 198 DPSYNLLVDYFLAVVPLCEKWLRRAISYGNGVHLKRTVINYNRVYDFSGYFTWYTL 253
           D  YNLL DY  A  PL +  ++  +   NG+ L    I Y    D    + WY L
Sbjct: 182 DNKYNLLQDYIYACGPLLKCVMKDTLE--NGICLDLPGI-YKLDIDLQFPYPWYDL 234

>Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR134W
            (CAF130) - CCR4 Associated Factor 130 kDa [contig 189]
            FULL
          Length = 1105

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/1102 (39%), Positives = 631/1102 (57%), Gaps = 83/1102 (7%)

Query: 90   EMVIVALLTTRAGLSVLAL---LKPSGSNPSIPKCISNQRKWLAQVERK--GKLHSDLIS 144
            E +++ L TT+ GLS+L L   L     N      +   +KW     +     ++  L+ 
Sbjct: 48   EKLVIGLFTTKPGLSILKLYYELSCGRIN------LLRYKKWQQSKFQSLPDAVYKKLVK 101

Query: 145  QWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKVPLSFLIQSKYRAAELILDPSYNLL 204
            +W    D     + +LL+N+   L   +    E+K+ ++FL+        LI+D  YNLL
Sbjct: 102  KWTGSSDYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLLDQDTEL--LIIDDEYNLL 159

Query: 205  VDYFLAVVPLCEKWLRRAISYGNGVHLKRTVINYNRVYDFSGYFTWYTLQ-TRGSNHPFV 263
            +D+ L      E+ L +A        + ++ ++++R++  SG + WYT    R +    +
Sbjct: 160  LDFLLQTRASVEELLSQA---DLPSLIAKSALSHHRLFQLSGRYVWYTFSDERFAEAQDI 216

Query: 264  SQQILFDLIDSDDKEIEAVSQIESNXXXXXXXXXXXXXSAIQDISSASLNSG--FYGDED 321
              + L  L D    + + + QI+                ++     A L+ G   Y +  
Sbjct: 217  CYKYLSVLTDKLTAQQDLIPQIQP------------LFDSVNSSRLAHLSQGDSLYSEGV 264

Query: 322  RSALEEYSDNY-HHQVNQNEQVFSFDLNQDGSLELPNLMSHAAVRHEILMKVXXXXXXXX 380
             S     SD++   +++ +E+++SFDL  DG+LE PN+      RH+ L +V        
Sbjct: 265  ESDSNSDSDHWPQKKLSAHERIYSFDLKDDGTLESPNVFGRTRRRHQALYQVLRLQQQNS 324

Query: 381  X-XXXXXFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLGFLTPEIQQTLEFEEGCDWRF 439
                   F  +  LVDP+TQP PND H+IS+DLL  MF+G L  EI+Q L F    +WRF
Sbjct: 325  SPCLKAQFFTLCALVDPVTQPTPNDSHIISIDLLSDMFIGLLHSEIKQ-LPF----NWRF 379

Query: 440  HVCFNMQKIIDASLVRLNFDDFERLNSINNSDDNVDWRSQLDKWLPHGFNTQDLELICMV 499
            H+CFN+QKI+ ++L RLN  DF++LNS+NNSDD++DWR  L KWLP G NTQDLEL+ M+
Sbjct: 380  HICFNLQKILQSTLPRLNCHDFQQLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELVYMI 439

Query: 500  DIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILLGLEIDRIEEELETFDTPLMVR 559
            DI+A+Y I+KLY   P+Q+NPFL+S+ISLWKNLT V+LLGLEIDR EEE ETF TP++VR
Sbjct: 440  DILAIYIIHKLYRDRPVQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVR 499

Query: 560  ATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSPHGRKLCQGALYXXXXXXXXXX 619
            A IRG++ALR++VATVLNGHVE  +HD +HE +N FMSPHGRKLC GALY          
Sbjct: 500  AAIRGSSALRSVVATVLNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAM 559

Query: 620  XXXXXXXXDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYNDLSSREEDYSGFDKYDDYTDS 679
                    DVT+L SDLQPGDRFDEDV+YMF+YE+++YN++ + + D    +        
Sbjct: 560  LALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNEVGTEDMDEEELED---VESR 616

Query: 680  SKTHARKGFGRRCNCIFXXXXXXXXXXXXXXX-XGHKAPKQILPQQNPTTSVSMSTTGKP 738
             +    + + +RC+C F                  H    + LP   P T+V +S T KP
Sbjct: 617  ERIKEMRAYYKRCHCQFDDDELLPEEEEESGIPISHTRISKELP---PDTNVKLSNTAKP 673

Query: 739  HAIRSGG-SFEFDYSGKDWRDIPRMSNLYYSPNYHFVEDLDPNTIISLTNKATKQSLSKI 797
             A+R+   + EFD++G+DWRDIPR  N Y++ NY F + +      +L N A ++ LSK 
Sbjct: 674  VALRNKKDTIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHTLMNSAAERQLSKE 733

Query: 798  ESLLLLGSVATCVKNEQDEIVLGNITELHHQNGSRGSQVIDKLKDISPDDIYEMWCKDST 857
            E++ LL  V+TCV  EQ+  VL +               +    D++ D IYE WC+DS 
Sbjct: 734  EAVHLLRLVSTCVAKEQEHTVLRSAFAADDSQALSCQSTLVADGDLTTDYIYENWCQDSL 793

Query: 858  FEKMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLIHYIFELVMGLRKSFXXX 917
            F+KM++ N  + WR+MDEMLMCSG+RRVLIWFITH+E+  S+I YI+ LVMG R      
Sbjct: 794  FDKMLFHNETLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIYSLVMGNRGE---- 849

Query: 918  XXXXXXXXSISEMTKEAPEVRTSLPFSRQGSIQLSSIETKMLLQEFFTNAAIFLTEKSKE 977
                          +E P  +  LPFSRQG I LS IE KMLLQEFFTNAAIF +++ +E
Sbjct: 850  ----------KLANEETPFGK--LPFSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQLRE 897

Query: 978  WIGEEPMEDEATINDGENGNVSLYAVGLMKLICLMVRAFIKKGKFDFRESECVFELQTLL 1037
             +G      +    + EN  +S Y VGLM+L+C MV++ I++  FDF++ + +FEL+TLL
Sbjct: 898  SLG------DEEEEETENLGISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLL 951

Query: 1038 MNWIAIIPEAKDLFFELKALV-------AEVHSDPMDDEELSNNPPDSNKKLSSMVENDN 1090
            M+WI I+PEA+DLFF L++ V       A+   D M    + N  PD      +  END 
Sbjct: 952  MSWICILPEARDLFFALRSRVDQQSRKPAKRDPDAMATASVVNLSPD----FRTTDENDG 1007

Query: 1091 INGNEAVDSE--YNRKLISLLSPVMHRKEENAAVVALRNFIKKYSFDTTVPLIGRKVVYE 1148
             + +E  +S   YN+KLISLL PV+    EN AV ALR+FI K+S      + GR+V+  
Sbjct: 1008 SSDSEETNSVSIYNKKLISLLPPVV--GTENTAVTALRSFISKHSLTMGTAVFGRRVINH 1065

Query: 1149 GNEILPLPESETPMSLLDYLVD 1170
             + I+ +  S+  +   ++L +
Sbjct: 1066 DDRIMSMYMSDKDIDNRNFLAE 1087

>Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON}
            similar to Ashbya gossypii AFR316W
          Length = 1204

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/1165 (37%), Positives = 635/1165 (54%), Gaps = 104/1165 (8%)

Query: 86   SLLLEMVIVALLTTRAGLSVLALLKPSGSNPSIPKCISNQRKWLAQVERKGKLHSDLISQ 145
            +L+ E V+V L  TR+G S+L +L     +    +    + K   +V             
Sbjct: 46   ALITEKVVVTLFMTRSGNSMLHML----YDLCCGRIKLTEYKQSLKVRSNHSYWKSCYKD 101

Query: 146  WQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKVPLSFLIQSKYRAAELILDPSYNLLV 205
            W S  DI  +FL F L+NE+  L          K+PL FL+    R    ++D  YNLL+
Sbjct: 102  WGSRRDILSEFLDFCLRNENCALDYIEYASATRKLPLQFLLPEPLRP--YLIDDEYNLLL 159

Query: 206  DYFLAVVPLCEKWLRRAISYGNGVHLKRTVINYNRVYDFSGYFTWY------TLQTRGSN 259
            DY +   P+ E  L + I       L   V  YNR Y+F+GY+ WY       +Q + S 
Sbjct: 160  DYMIQSRPMWEMLLTQGIP----KFLPELVDEYNRSYEFNGYYVWYGNVTCSQVQVQSST 215

Query: 260  HPFVSQQILFDLIDSDDKEIEAVSQIESNXXXXXXXXXXXXXSAIQDISSASLNSGFYGD 319
                ++   + L D      E + ++                S     +  +L      D
Sbjct: 216  KELYTK-FFYTLFDKLTVTKELLPKLN---------VALWSHSWPASYTKQTLLDLSNDD 265

Query: 320  EDRSALEEYSDNYH---HQVNQNEQVFSFDLNQDGSLELPNLMSHAAVRHEILMKVXXXX 376
            +D    +  S+N H    +++  EQVF+FDLN+DG+LE PN+  HA  RHEIL +V    
Sbjct: 266  DDHYDQDVDSENDHWPQQKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRHEILYRVLGLP 325

Query: 377  XXXXXXXXXXFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLGFLTPEIQQTLEFEEGCD 436
                      F  +A LVDP+TQP P + H+IS+DL++QMFLG  +  I+  L    G D
Sbjct: 326  DAEGPLLKAQFMTLAALVDPITQPPPTEDHIISIDLIFQMFLGSTSNLIENML-ISRGRD 384

Query: 437  WRFHVCFNMQKIIDASLVRLNFDDFERLNSINNSDDNVDWRSQLDKWLPHGFNTQDLELI 496
            WRFHVC+NMQKI+ A++ RLN  D + LN++NNSD++V W   LDKW P G NTQDLEL+
Sbjct: 385  WRFHVCYNMQKIVLATMKRLNCHDGDVLNTVNNSDESVHWNVNLDKWTPRGLNTQDLELL 444

Query: 497  CMVDIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILLGLEIDRIEEELETFDTPL 556
             MVD++++Y +Y+LY +LP+Q+NPFL   + LWKNLT V+L GLEIDR EE+ ETF+TP+
Sbjct: 445  YMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRETFNTPI 504

Query: 557  MVRATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSPHGRKLCQGALYXXXXXXX 616
            +VRA IRG AALR++VAT++N H  + +HD KHE +N FMSPHGRKLC GALY       
Sbjct: 505  IVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYADVRSHA 564

Query: 617  XXXXXXXXXXXDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYNDLSSRE---EDYSGFDKY 673
                       DVT L SDLQPGDRFD+DV+YMF+YE++DYN +   +   E+    ++ 
Sbjct: 565  AAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYDENEEDLERL 624

Query: 674  DDYTDSSKTHARKGFGRRCNCIFXXXXXXXXXXXXXXXXGH-KAPKQILPQQNPTTSVSM 732
            ++     +    +G+ +RC+C+F                 +   PK      N  +S+  
Sbjct: 625  EEIQQRERIKDMRGYYKRCHCVFDDDELLSDEEEGETASSNIDRPKYSHNSLNLPSSMLS 684

Query: 733  STTGKPH----AIRSGGSFEFDYSGKDWRDIPRMSNLYYSPNYHFVEDLDPNTIISLTNK 788
            +T   P+    AIRS    +FD++GKDWRDIPR  N YY+ +Y FV  L  + +  L  +
Sbjct: 685  TTFNGPNSQKFAIRSRDGVDFDFNGKDWRDIPRGLNFYYTEHYVFVNKLHADVVYYLMKE 744

Query: 789  ATKQSLSKIESLLLLGSVATCVKNEQDEIVLGNITELHHQNGSRGSQVIDKLKDISPDDI 848
            AT + +    +  +L S+ATC+K EQ++ ++ ++       GS  +   D++ +++ D I
Sbjct: 745  ATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVMNGRTDKGSSSNSNSDRVNELTSDFI 804

Query: 849  YEMWCKDSTFEKMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLIHYIFELVM 908
            YE WC++S F KM+Y N+++ WR+MDEMLMCSG+RRVLIWFITH+E++HSLIHYIFELVM
Sbjct: 805  YEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLEISHSLIHYIFELVM 864

Query: 909  GLRKSFXXXXXXXXXXXS-----ISEMTKEAPEVRTSLPFSRQGSIQLSSIETKMLLQEF 963
            G+R +            +     +  ++  +  V   +PFSRQG I LS IE  MLL EF
Sbjct: 865  GMRGNVDYDEEAEDDIKNRNLDILDSLSLGSSSVTIKIPFSRQGPIILSIIEINMLLLEF 924

Query: 964  FTNAAIFLTEKSKEWIGEEPMEDEATINDG---------ENGN-----VSLYAVGLMKLI 1009
            F NA I+ ++  K    +E +    + N+G         E+G+     VS + +GLMKL+
Sbjct: 925  FINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGLCEDGDKDTLGVSPHVIGLMKLV 984

Query: 1010 CLMVRAFIKKGKFDFRESECVFELQTLLMNWIAIIPEAKDLFFELKALVAEVHS------ 1063
            C MV   ++K KFDF +SE +FELQTLLMNWI IIPEA++LFF+LK+ + E  S      
Sbjct: 985  CFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIPEARNLFFKLKSSILEASSQNDSSK 1044

Query: 1064 --------------------------------------DPMDDEELSNNPPDSNKKLSSM 1085
                                                  + + D +    P D N      
Sbjct: 1045 SDKQGTENIRKKSSQSLVTEGEGIEQKIVNIDREDHLENCLSDADFPPTPIDINNLKLEN 1104

Query: 1086 VENDNINGNEAVDSEYNRKLISLLSPVMHRKEENAAVVALRNFIKKYSFDTTVPLIGRKV 1145
            V +  I+ N  + S+YN+ LI LL   +H   EN AV ALR+FI K+S      + GR+V
Sbjct: 1105 VGSPEIDNNNNL-SKYNKMLIELLP--LHVDNENTAVTALRSFITKHSLTNKTAVFGRRV 1161

Query: 1146 VYEGNEILPLPESETPMSLLDYLVD 1170
            +Y+ + I+ L  ++  M   ++L +
Sbjct: 1162 IYQDHAIMGLYMADKEMRQREFLAE 1186

>AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR134W (CAF130)
          Length = 1191

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/1167 (38%), Positives = 633/1167 (54%), Gaps = 111/1167 (9%)

Query: 80   DPQLKYSLLLEMVIVALLTTRAGLSVLALLKPSGSNPSIPKCISNQRKWLAQVERKGKLH 139
            DP  +  +++E V+V L  TR G S+L LL            +S  R  L++  +  K+ 
Sbjct: 41   DPHFEL-MIVEKVVVTLFMTRGGNSILHLLYD----------LSCGRIKLSEYRQSLKVR 89

Query: 140  SDL------ISQWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKVPLSFLIQSKYRAA 193
            S++        +W S  D   +FL F L+NED  L      +   K+PL FL+ +   A 
Sbjct: 90   SNVHQWKTCYKEWGSRRDTLSRFLDFCLRNEDCALDYTEYGRVMRKLPLQFLLPAGLHA- 148

Query: 194  ELILDPSYNLLVDYFLAVVPLCEKWLRRAISYGNGVHLKRTVINYNRVYDFSGYFTWYTL 253
              +LD  YNLL+DY +    + E+ L + I       L   + +YNRV++F+GY+TWY  
Sbjct: 149  -YVLDEGYNLLLDYIINSRLMWEELLIQGIPR----LLPELIEDYNRVFEFNGYYTWYGG 203

Query: 254  QTRGSNHPFVSQQ----ILFDLIDSDDKEIEAVSQIESNXXXXXXXXXXXXXSAIQDISS 309
               G+     +++    +L+ L D      E + ++ +                I + S+
Sbjct: 204  APSGAGAANSTRELHTKVLYALFDKLTVAKELLPRLNATVWSHSWPPMYHK-HGINEFSN 262

Query: 310  ASLNSGFYGDEDRSALEEYSDNY-HHQVNQNEQVFSFDLNQDGSLELPNLMSHAAVRHEI 368
                   Y D D S LE   D++  H+ +  EQV++F+LN+DGSLE PN+  H   RHE 
Sbjct: 263  EE--EDLY-DFD-SELE--GDSWPQHKSSAKEQVYTFELNRDGSLEFPNVFLHTRRRHET 316

Query: 369  LMKVXXXXXXXXXXXXXXFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLGFLTPEIQQT 428
            L ++              F  +  LVDP+TQP P +KH+IS+DL+YQMFL          
Sbjct: 317  LYRILGLPNRECPLLRAQFMTLCALVDPITQPPPTEKHIISIDLIYQMFL---GSISSLL 373

Query: 429  LEFEEGCDWRFHVCFNMQKIIDASLVRLNFDDFERLNSINNSDDNVDWRSQLDKWLPHGF 488
                 G DWRFHVC N+QKII A++ RLN  D E LNSINNSD+ V W   + KW P G 
Sbjct: 374  ESSLRGQDWRFHVCHNLQKIILATMKRLNCHDSEVLNSINNSDETVHWNVNIGKWTPRGL 433

Query: 489  NTQDLELICMVDIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILLGLEIDRIEEE 548
            NTQDLEL+ MVD++ +YTIY+LY  LP+Q+NPFL     LWKNLT V+LLGLEIDR EE+
Sbjct: 434  NTQDLELLYMVDMLGIYTIYQLYSDLPVQMNPFLPLSFHLWKNLTNVLLLGLEIDRFEED 493

Query: 549  LETFDTPLMVRATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSPHGRKLCQGAL 608
             ETF TP++VRATIRG+AALR++VAT++N H    +HD KHE +N FMSPHGRKLCQGAL
Sbjct: 494  RETFSTPIIVRATIRGSAALRSVVATMINSHFSIKEHDFKHEPINLFMSPHGRKLCQGAL 553

Query: 609  YXXXXXXXXXXXXXXXXXXDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYNDLSSRE---E 665
            Y                  DVT L SDLQPGDRFD+DV+YMF+YE++DYN +   +   E
Sbjct: 554  YADVRSHAAAMLALGIELNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYDE 613

Query: 666  DYSGFDKYDDYTDSSKTHARKGFGRRCNCIFXXXXXXXXXXXXXXXXGHKAPKQILP--Q 723
            +    ++ ++     +    +G+ +RC+C+F                G      I    Q
Sbjct: 614  NEEDLERLEEIQQRERIKDMRGYYKRCHCVF--DDDELLSDEEGTDTGEHTDNHITETVQ 671

Query: 724  QNPTTSVSMSTTGKPH--AIRSGGSFEFDYSGKDWRDIPRMSNLYYSPNYHFVEDLDPNT 781
              P   V+  +T  P   A+RS    EFD++GKDWRDIPR  N YY  +Y FV  L  + 
Sbjct: 672  SAPLNLVTGVSTSGPQKVAVRSRDYVEFDFNGKDWRDIPRGMNFYYVEDYVFVNKLHADV 731

Query: 782  IISLTNKATKQSLSKIESLLLLGSVATCVKNEQDEIVLGNITELHHQNGSRGSQVIDKLK 841
            +  L  +AT + L   +S  +L SVATC+K EQ++ ++ +            +   +   
Sbjct: 732  LHYLMKEATSKKLESNQSSFILRSVATCIKLEQEKTMVHDAIFKSKDKSPLSASGSEGSN 791

Query: 842  DISPDDIYEMWCKDSTFEKMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLIH 901
             ++ D IYE WC+D+ FEKM+Y N+++ WR+MDEMLMCSG+RRVLIWFITH+EL+HS+IH
Sbjct: 792  GLTSDFIYEKWCEDALFEKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLELSHSVIH 851

Query: 902  YIFELVMGLR-----KSFXXXXXXXXXXXSISEMTKEAPEVRTSLPFSRQGSIQLSSIET 956
            YIFELVMG+R     K              +   +  +  +  S+PFSRQG I LS+IE 
Sbjct: 852  YIFELVMGMRGNVAYKDLEEEYIINRNLDLLDSFSLGSSCIPASIPFSRQGPIVLSTIEV 911

Query: 957  KMLLQEFFTNAAIFLTEKSKEWIGEEPMEDE-------------ATINDGENGNVSLYAV 1003
             MLLQEFF NAAI+ +   ++    E ++ E                   E    S + +
Sbjct: 912  NMLLQEFFINAAIYFSNYLRDTASYEHLDVEQPEEQTEIEEGEAEDEIADERLTASSHVL 971

Query: 1004 GLMKLICLMVRAFIKKGKFDFRESECVFELQTLLMNWIAIIPEAKDLFFELKA------- 1056
            GLMKL+C MV   I+K K DF +SE +FELQTLLMNWI ++PEA+ LFF+LK+       
Sbjct: 972  GLMKLLCFMVDMLIEKKKLDFTDSEYLFELQTLLMNWIGLVPEARTLFFKLKSTLLNSSA 1031

Query: 1057 --------LVAEVHSDPMDDEELSNNPPDSNKKLSSMVENDNING--------------- 1093
                    L  E+ S+  DD E    P D+ +    M +++ ++G               
Sbjct: 1032 LNGSALSHLEGELASNDNDDSE----PVDTAEDAGPMDKSNGLDGLPLCDIGALTNGQPT 1087

Query: 1094 ----------NEAVDSEYNRKLISLLSPVMHRKEENAAVVALRNFIKKYSFDTTVPLIGR 1143
                      +E+  S  N+ LI LL P  H  +ENAAV ALR+FI K+   T   + GR
Sbjct: 1088 SAANSAPNGMSESNISYCNQMLIKLLPP--HSADENAAVTALRSFIAKHPLTTKTAIFGR 1145

Query: 1144 KVVYEGNEILPLPESETPMSLLDYLVD 1170
            +V+Y+ N I+ L  ++  +   ++L +
Sbjct: 1146 RVIYQDNAIMGLYMADKELQQREFLAE 1172

>KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4- NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1113

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/1111 (39%), Positives = 629/1111 (56%), Gaps = 98/1111 (8%)

Query: 90   EMVIVALLTTRAGLSVLAL---LKPSGSNPSIPKCISNQRKWLAQVERK--GKLHSDLIS 144
            E +++ L TTR GLS L L   L     N      +   +KW     ++     +  ++ 
Sbjct: 51   EKLVLGLFTTRPGLSTLRLYYELSCGRVN------LLRYKKWQQSKPQRVSDAAYKRMVK 104

Query: 145  QWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKVPLSFLIQSKYRAAELILDPSYNLL 204
            +W S  +     +   L+N++  L   +      K+ ++FL+  +     L++D  YNLL
Sbjct: 105  RWTSSTEHVGLLMDHFLRNDNWALDYASFYSPAHKLSVAFLLDPETEV--LVIDDEYNLL 162

Query: 205  VDYFLAVVPLCEKWLRR--------AISYGNGVHLKRTVINYNRVYDFSGYFTWYTLQTR 256
            +D+ L    L E+ L +          +YG+G           R++   G + WYT    
Sbjct: 163  LDFALQCRALVEQLLNQIDLPSLLAKCAYGHG-----------RLFQLCGRYVWYTFSAE 211

Query: 257  GSNHPFVSQQILFD----LIDSDDKEIEAVSQIESNXXXXXXXXXXXXXSAIQDISSASL 312
              +    +Q I +     L D    + + + QI+                  + ISS+  
Sbjct: 212  QFDE---AQDICYKYLSVLTDKLTAQQDLIPQIQP---------------LFEIISSSKA 253

Query: 313  NSGFYGD---EDRSALEEYSDNYH---HQVNQNEQVFSFDLNQDGSLELPNLMSHAAVRH 366
            +   YGD    +    +  SD+ H    +++  E+V+SFDL  DG+LE  N+ +    RH
Sbjct: 254  SHWVYGDGLFTENPESDSNSDSDHWPQKRLSAQERVYSFDLKDDGTLEASNVFNRTRRRH 313

Query: 367  EILMKVXXXXXXXXX-XXXXXFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLGFLTPEI 425
            + L +V               F  +  LVDP+TQP PND H++S+DLL  MFLG L  EI
Sbjct: 314  QALYQVLNLQKQNTAPLLSSQFFTLCALVDPVTQPTPNDSHIVSIDLLSDMFLGLLYSEI 373

Query: 426  QQTLEFEEGCDWRFHVCFNMQKIIDASLVRLNFDDFERLNSINNSDDNVDWRSQLDKWLP 485
                  E   DWRFHVCFN+QKI+ A+L RLN  DF+RLNS+NNSDD++DWR  L KWLP
Sbjct: 374  N-----ELHIDWRFHVCFNLQKIVQATLPRLNCHDFQRLNSVNNSDDSIDWRRNLHKWLP 428

Query: 486  HGFNTQDLELICMVDIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILLGLEIDRI 545
             G NTQDLELI M+DI+A+Y I+KLY  LP Q+NPFL+S+ISLWKNLT V+LLGLEIDR 
Sbjct: 429  QGLNTQDLELIYMIDILAIYIIHKLYRDLPAQMNPFLASMISLWKNLTFVVLLGLEIDRF 488

Query: 546  EEELETFDTPLMVRATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSPHGRKLCQ 605
            EEE ETF TP++VRA IRG++ALR++VAT+LNGHVE  +HD +HE +N FMSPHGRKLC 
Sbjct: 489  EEEQETFSTPVLVRAAIRGSSALRSVVATILNGHVEYKRHDFQHEPINIFMSPHGRKLCH 548

Query: 606  GALYXXXXXXXXXXXXXXXXXXDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYNDLSSREE 665
            GALY                  DVT+L SDLQPGDRFDEDV+YMF+YE+++YN++ + E 
Sbjct: 549  GALYTDVRSHAAAMLALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNEVDTEEL 608

Query: 666  DYSGFDKYDDYTDSSKTHARKGFGRRCNCIFXXXXXXXXXXXXXXXXGHKAPKQILPQQN 725
            D     + +D     +    + + +RC+C F                   +P ++     
Sbjct: 609  DED---ELEDVESRERIKEMRAYYKRCHCQFDDDELLPEDEEDGRPDA--SPYRVTRDAP 663

Query: 726  PTTSVSMSTTGKPHAIRS-GGSFEFDYSGKDWRDIPRMSNLYYSPNYHFVEDLDPNTIIS 784
            P  +V +S T KP A+RS   S EFD++G+DWR IPR  N Y++ NY F + L      S
Sbjct: 664  PDNNVKLSNTSKPMALRSQKDSVEFDFNGRDWRGIPRGLNFYFNENYEFEKHLSSGQAHS 723

Query: 785  LTNKATKQSLSKIESLLLLGSVATCVKNEQDEIVLGNITELHHQNGSRGSQVIDKLKDIS 844
            L   A ++ L   E   LL  +ATCV  EQ+  VL +   L     S     +    D++
Sbjct: 724  LMCNAAEKKLPLEEGTQLLRVIATCVAKEQELTVLRSALLLGETPESENHSTLVADGDLT 783

Query: 845  PDDIYEMWCKDSTFEKMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLIHYIF 904
             D +YE WC++S FEK+++ N  + WR+MDEMLMCSG+RRVLIWFITH+E+++S+I YI+
Sbjct: 784  TDFVYEKWCENSMFEKILFHNETLVWRMMDEMLMCSGYRRVLIWFITHLEVSNSMIEYIY 843

Query: 905  ELVMGLRKSFXXXXXXXXXXXSISEMTKEAPEVRTSLPFSRQGSIQLSSIETKMLLQEFF 964
             LV+G R              S  +  K        +PFSRQG+I LS IE KMLLQEFF
Sbjct: 844  TLVLGNRGE---------KAASDGDYAK--------VPFSRQGAIVLSDIEIKMLLQEFF 886

Query: 965  TNAAIFLTEKSKEWIGEEPMEDEATINDGENGNVSLYAVGLMKLICLMVRAFIKKGKFDF 1024
            TNAAIF +++ +E +G+   +++   ++  +G +S + VGLMKL+C MV++ ++K  FDF
Sbjct: 887  TNAAIFFSKQLRESLGDGEDDEDQGDDEKGSG-ISPHVVGLMKLVCYMVKSLMQKEMFDF 945

Query: 1025 RESECVFELQTLLMNWIAIIPEAKDLFFELKALVAEVHSD-PMDDEELSNN-PPDSNK-- 1080
            ++ + +FELQTLLM+WI I+PEA+DLFF L++LV E   +  ++ E +++   PDS    
Sbjct: 946  KDPDYIFELQTLLMSWICILPEARDLFFALRSLVDEQSQNIKLESESIASACEPDSQSEP 1005

Query: 1081 KLSSMVEND-NINGNEAVDSEYNRKLISLLSPVMHRKEENAAVVALRNFIKKYSFDTTVP 1139
            +L      +       AV S YN+KL+SLL P      EN+A+ ALR+FI K+S  T   
Sbjct: 1006 QLPQGTHAELEPEATHAV-SIYNKKLMSLLPPAA--GTENSAITALRSFISKHSLTTKTA 1062

Query: 1140 LIGRKVVYEGNEILPLPESETPMSLLDYLVD 1170
            L GR+V+ + + I+P+  S+  M    +L +
Sbjct: 1063 LFGRRVISQDDTIMPMYMSDREMDNRQFLAE 1093

>TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_3.497
            YGR134W
          Length = 1307

 Score =  720 bits (1858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/1299 (37%), Positives = 669/1299 (51%), Gaps = 216/1299 (16%)

Query: 50   LEELLAERELDYDARFEFLDRLLRDSKSWKDPQLKYSLLLEMVIVALLTTRAGLSVLALL 109
            L +L     +DY    + L+ L+  +K   D +   SLL E +I+AL TT  GLSVL ++
Sbjct: 7    LSDLRDSLPIDYKPNIQLLETLIDYAKP--DSEYLDSLLFESLILALFTTNCGLSVLNII 64

Query: 110  ------------------------------KPSGSNPSIPKCISNQRKWLAQ--VERKGK 137
                                          K    + ++ +  +  R  +A+  + +K  
Sbjct: 65   STLKSFTNDKQKKNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNILKKQA 124

Query: 138  LHSDLISQWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKVPLSFLIQSKYRAAE--- 194
             H  L+ +W++D    LKF  F+LKN +  L          K+PL FL+ +    +    
Sbjct: 125  HHPKLLEKWRNDKITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCSNDNN 184

Query: 195  -------------LILDPSYNLLVDYFLAVVPLCEKWLRRAISYGNGVHLKRTVINYNRV 241
                         L++D +YNLL+DY     PL    L   +   + +     + +YN+ 
Sbjct: 185  ATSQKLFSIYNNTLLMDKNYNLLLDYLHVSTPLLISLLHTNL---DPLLFNNIISSYNKS 241

Query: 242  YDFSG--YFTWYTLQTRGSNHPFVSQQILFDLIDSDDKEIEAVSQIESNXXXXXXXXXXX 299
            ++ +      WY          F +     D+I++          +E             
Sbjct: 242  FELTNDNKCLWYDFIDSKDTTNFGTITNCIDIINN---------FLEIFDMHKNFTLNAE 292

Query: 300  XXSAIQDISSASLNSGFYGDEDRSA-----LEEYSDNYHHQVNQNEQVFSFDL---NQDG 351
              +++ +ISS+S       +E+  A     ++E S          E   SF+L   N + 
Sbjct: 293  ISNSLFNISSSSTTKSNMHNENEGADLNLLMDENS--------MGEHTLSFNLFENNINH 344

Query: 352  SLELPNLMSHAAVRHEILMKVXXXXXXXXXXXX----XXFKIVAGLVDPLTQPAPNDKHV 407
             +  P+LM+H + RH+IL K+                  FK++  LVDPLTQP PN K++
Sbjct: 345  GILHPDLMAHISKRHDILAKILNVGDNDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNI 404

Query: 408  ISLDLLYQMFLGFLTPEIQQTLEFEEGCDWRFHVCFNMQKIIDASLVRLNFDDFERLNSI 467
            IS+DLL+Q+FLGFL PE+ +    E+G +W+F VCFNM+KII++ + +LN  DF  LNSI
Sbjct: 405  ISIDLLFQLFLGFLKPELDRYSSAEDGTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSI 464

Query: 468  NNSDDNVDWRSQLDKWLPHGFNTQDLELICMVDIIAVYTIYKLYEHLPIQLNPFLSSLIS 527
            NNSD++V WR+QL KWLP GFNTQDLEL+ MV+I+A YTIYKL E LPIQLNPFLSS++S
Sbjct: 465  NNSDESVHWRTQLHKWLPRGFNTQDLELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVS 524

Query: 528  LWKNLTCVILLGLEIDRIEEELETFDTPLMVRATIRGAAALRAIVATVLNGHVEATKHDI 587
             WKNL+C ILLGLEIDR+EEE ETFDTPL+VRAT+R + ALR+I+AT+LN HV A  HD 
Sbjct: 525  HWKNLSCTILLGLEIDRLEEENETFDTPLIVRATVRSSTALRSIIATILNEHVNAFAHDF 584

Query: 588  KHESLNTFMSPHGRKLCQGALYXXXXXXXXXXXXXXXXXXDVTSLFSDLQPGDRFDEDVR 647
            KHESLNTFMSP+GRKLC GALY                   VT L SDLQPGDRFDEDV+
Sbjct: 585  KHESLNTFMSPYGRKLCNGALYTDFRSHASTILALTGDLEHVTQLISDLQPGDRFDEDVK 644

Query: 648  YMFEYEFEDYNDLSS---REEDYSGFDKYDD------------YTDSSKTHARK------ 686
            YMF  EFEDYN L +    E+D +  D   +              D+ +   R+      
Sbjct: 645  YMF--EFEDYNTLPNVLGGEDDETSTDTLKNREMLKEIHNGNFIPDNEENDEREIRNYLE 702

Query: 687  ------GFGRRCNCIFXXXXXXXXXXXXXXXXGHKAPKQI-------------------- 720
                     RRCNCIF                G+ +   I                    
Sbjct: 703  QKLREMNCHRRCNCIFSDDEIKDTSISDKNYMGNSSSNGIESRIALLLNNNSSRKGGNGT 762

Query: 721  -----------------LPQQNPTTSVSMSTTG--KPHAIRSG---------------GS 746
                               Q + T   S+  TG  KPHA+R+                  
Sbjct: 763  NSEDDEDVIRKNIENLTKDQLSSTEMESLRVTGFNKPHAVRTSNLNNNPSSVNNKNNQNI 822

Query: 747  FEFDYSGKDWRDIPRMSNLYYSPNYHFVEDLDPNTIISLTNKATKQSLSKIESLLLLGSV 806
            F+FDY+GKDWRD PR  NLYY+ NY F+E  + + +  LT KAT   L K +S LLL  V
Sbjct: 823  FDFDYNGKDWRDTPRGMNLYYNLNYEFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLV 882

Query: 807  ATCVKNEQDEIVLGN------ITEL--------------HHQNGSRGSQVIDKLKDISPD 846
            A+ VKNEQD I+  +      + E+              H++N        + + +I+PD
Sbjct: 883  ASSVKNEQDRIIFSDNQVSKEVKEIMEQNEDGVENEKLPHNKNRIENGNEKEIITEITPD 942

Query: 847  DIYEMWCKDSTFEKMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLIHYIFEL 906
            DIYE+WC++S FE+M+  N+EV +RLMDEMLMC G+RRVLIWFITH+EL+HS+IHYIFEL
Sbjct: 943  DIYEIWCEESAFERMMQLNYEVTFRLMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFEL 1002

Query: 907  VMGLR----------------KSFXXXXXXXXXXXSISEMTKEAPEV-RTSLPFSRQGSI 949
            VMG R                K              ++ +  +  ++    LPFSRQG+I
Sbjct: 1003 VMGFRGTSEENGATEDKHTNTKGNVNELENKNENELVNMLLNDYSKIFDLQLPFSRQGNI 1062

Query: 950  QLSSIETKMLLQEFFTNAAIFLTE----KSKEWIGEEPMEDEATINDGENGN-VSLYAVG 1004
            +LS IE KML+QEF TNAAI   E    K      +    +E  IN  E+ + +SLY++G
Sbjct: 1063 ELSEIERKMLIQEFLTNAAIHFNERNNLKHNPNSNDNSNSNEDNINKDEDEDEISLYSIG 1122

Query: 1005 LMKLICLMVRAFIKKGKFDFRESECVFELQTLLMNWIAIIPEAKDLFFELKALVAEVHSD 1064
            LM+LIC M++AF+   K      + +FELQTLLMNWI IIPEAK LFF++K +++    D
Sbjct: 1123 LMRLICFMIQAFLDNNKLKIEVDDSIFELQTLLMNWITIIPEAKKLFFQIKDIISNNQID 1182

Query: 1065 PMDDEELSNNPPDSNKKL----SSMVENDNINGNEAVDSE--YNRKLISLLSPVMH-RKE 1117
              +         D +       +S   ND ++ +  VDS   +N+KLI L   + H  KE
Sbjct: 1183 NNNFNNNLILDLDQDNNTIENQTSKDNNDKMDESSKVDSNSSFNKKLIELFPKMSHTNKE 1242

Query: 1118 ENAAVVALRNFIKKYSFDTTVPLIGRKVVYEGNEILPLP 1156
            EN A+  L+N++KK+ F   VP+IGRKV+YE  +IL +P
Sbjct: 1243 ENTAIDTLKNYLKKFRFHQEVPIIGRKVIYEDGKILKIP 1281

>KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1038

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/1124 (39%), Positives = 617/1124 (54%), Gaps = 139/1124 (12%)

Query: 84   KYSLLLEMVIVALLTTRAGLSVLALLKPSG----SNPSIPKCISNQRKWLAQVERKGKLH 139
            ++  LLE  +V L TT  G  V  +L+       S    P  I  Q +            
Sbjct: 7    QFDSLLEECVVTLFTTYRGQHVCQMLEQLDLGVFSLSKTPSRIVQQVR------------ 54

Query: 140  SDLISQWQSDDDIFLKFLHFLLKNEDVW------LPCENVNQCEWKVPLSFLIQSKYRAA 193
                + W   ++   K++H   ++  VW            N+  +K+ +S L  S++  A
Sbjct: 55   ----TAWT--EEALSKYIHLFFQH--VWRDAGDRFAIMQYNEPAFKLQVSDLFPSEFSKA 106

Query: 194  ELILDPSYNLLVDYFLAVVPLCEKWLRRAISYGNGVHLKRTVINYNRVYDFSGYFTWYTL 253
             L+L+  Y++L+D+   V P  +  +R+A+    G  +   V  Y RVY+F  YF W+ L
Sbjct: 107  RLVLNTDYDVLLDFVNTVRPQLKGLIRQAV---QGSLVDPIVRKYGRVYEFHDYFHWFNL 163

Query: 254  QTRGSNHPFVSQQILFDLIDSDDKEIEAVSQIESNXXXXXXXXXXXXXSAIQDISSASLN 313
                S   F ++ +L     + D     ++   S               A  D+      
Sbjct: 164  ----SKKKFANRDVLILNKGTPDLFHYYINSFCS--------------KAPYDVHPLH-- 203

Query: 314  SGFYGDEDRSALEEYSDNYHHQVNQNEQVFSFDL-----NQDGSLELP-NLMSHAAVRHE 367
              F G+      E  ++  + Q+  NE V+ FDL     N  G+  +  +LM  +  RHE
Sbjct: 204  -PFLGE----LFEGNNNVKYQQLGTNEHVYEFDLDEETHNGSGNRTVAVDLMQQSNQRHE 258

Query: 368  ILMKVXXXXXXXXXXXXXXFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLGFLTPEIQQ 427
            IL ++              FK +  LVDPLTQP P+D +V+SLDLLY++FL FL P+ Q 
Sbjct: 259  ILTRMLNLKEIDSPHLYEQFKCMISLVDPLTQPPPSDTYVVSLDLLYKLFLAFL-PKNQD 317

Query: 428  TLEFEEGCDWRFHVCFNMQKIIDASLVRLNFDDFERLNSINNSDDNVD-----WRSQLDK 482
            T + +      F +CFNMQKII  +L RL   D+ +L SI+      D     +R  L +
Sbjct: 318  TEQNDT-----FLLCFNMQKIITRTLWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKE 372

Query: 483  WLPHGFNTQDLELICMVDIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILLGLEI 542
            W+P+G NTQDLEL+ MVDI+AVYTIY  Y HLPIQLNPFLS LISLWKNL+ V+LL LE+
Sbjct: 373  WVPNGLNTQDLELLYMVDIMAVYTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEV 432

Query: 543  DRIEEELETFDTPLMVRATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSPHGRK 602
            DR EE  +TFDTPL+VRATIRGA+ALRA+VA VLNGHV   +HD KHE LNTFMSPHGRK
Sbjct: 433  DRCEEANDTFDTPLLVRATIRGASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRK 492

Query: 603  LCQGALYXXXXXXXXXXXXXXXXXXDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYN--DL 660
            LCQG+LY                  DVT L SDLQPGDRFDED+RYMFEYE+EDYN  D 
Sbjct: 493  LCQGSLYADLRSHAAAMLSLGVDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDF 552

Query: 661  SSREEDYSGFDKYDDYTDSSKTHARKGFG----RRCNCIFXXXXXXXXXXXXXXXXGHKA 716
               +ED +        + ++ T A +G G    RRCNCIF                G K 
Sbjct: 553  EDEDEDAAAAATTATASAAAITAANEGTGASQKRRCNCIFTDDKIIQSDESKVSLGGGK- 611

Query: 717  PKQILPQQNPTTSVSMSTTGKPHAIRSGGSFEFDYSGKDWRDIPRMSNLYYSPNYHFVED 776
                                +P+++R+  SFEFDYSG DWRD+PR  NLY+ P+Y F+  
Sbjct: 612  -------------------NRPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLAR 652

Query: 777  LDPNTIISLTNKATKQSLSKIESLLLLGSVATCVKNEQDEIVLGNITELHHQNGSRGSQV 836
                   ++++KA    L+ +ES  LL  VA+ +K EQ+ I++G +        + G  V
Sbjct: 653  PGLAEFRNVSSKAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTVYP-----QTEGIAV 707

Query: 837  IDKLKDISPDDIYEMWCKDSTFEKMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELN 896
             D    ++PD+IY+ W +D  F+++++ N E+AW+LMDE+LMC G+RRVL+WF+THMELN
Sbjct: 708  GDD-GLLTPDNIYDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELN 766

Query: 897  HSLIHYIFELVMGLRKSFXXXXXXXXXXXSISEMTKEA----PEVRT----SLPFSRQGS 948
            HS+IHYIFELVMGLR              ++ E  K+A     E+ T    +L FSRQG+
Sbjct: 767  HSVIHYIFELVMGLRGQ------ELSADVTLEEQRKQALHNLMEIDTPNGGTLMFSRQGN 820

Query: 949  IQLSSIETKMLLQEFFTNAAIFLTEKSKEWIGEEPMEDEATINDGENGNVSLYAVGLMKL 1008
            + LS IE KMLLQEFFTNAAIFL+               +   + E  +VSLY++GL+KL
Sbjct: 821  LALSEIEVKMLLQEFFTNAAIFLSASE------------SEEPESETSDVSLYSIGLVKL 868

Query: 1009 ICLMVRAFIKKGKFDFRESECVFELQTLLMNWIAIIPEAKDLFFELKALVAEVHSDPMDD 1068
            IC MV+  I   KF+F +SEC FELQTLLMNW+ I+P+A++LFF LK  +++  +     
Sbjct: 869  ICFMVKTLIVNHKFEFSKSECTFELQTLLMNWLGIVPDAQELFFLLKKNISDTKTATTTT 928

Query: 1069 EELS--NNPPDSNKKLSSMVENDNINGNEAVDSEYNRKLISLLSPVMHR--KEENAAVVA 1124
               S    P D    L+   +++N        SE+N+KL+ LL        K  + A+ A
Sbjct: 929  TTTSALGAPGDIFPTLTDADDDNNAVAENL--SEFNKKLVMLLPRATQSEGKGSSQAIDA 986

Query: 1125 LRNFIKKYSFDTTVPLIGRKVVYEGNEILPLPESETPMSLLDYL 1168
            LRNF++K+S  + +P++GR++V  G++ILP    E  ++L +YL
Sbjct: 987  LRNFMRKHSLSSEIPVLGRRIVRRGSQILPQATPERTVTLREYL 1030

>NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1279

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/903 (42%), Positives = 543/903 (60%), Gaps = 88/903 (9%)

Query: 326  EEYSDNYHHQVNQ----NEQVFSFDLNQDGSLELP-NLMSHAAVRHEILMKVXXXXXXXX 380
            +EY D+Y H+++      E+V+SFDLN DGS+ +P NLM +   RH+IL K+        
Sbjct: 377  DEYDDDYLHRIDDLKDGEEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDS 436

Query: 381  X-XXXXXFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLGFLTPEIQQTLEFEEGCDWRF 439
                   FK++ GLVDPL+QP PNDKH+ISLDLLYQ+F+  L P  +   +   G +W+ 
Sbjct: 437  SPLLELQFKLMLGLVDPLSQPPPNDKHIISLDLLYQLFIAILYPNFE-IFQNNLGFNWKT 495

Query: 440  HVCFNMQKIIDASLVRLNFDDFERLNSI------NNSDD-------------------NV 474
            HVCF M KII+  + +LN +D ++L  +      NN ++                   + 
Sbjct: 496  HVCFQMVKIINNCMEKLNCNDLQKLYDLTGFQGENNKEELLQQQQQQQQQQQQTDRFVDG 555

Query: 475  DWRSQLDKWLPHGFNTQDLELICMVDIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTC 534
            +WRS L++WLPHG NTQDLEL+ MV I+A YT+ KL   +PIQLNPFL +LI+LWK LT 
Sbjct: 556  NWRSTLEQWLPHGLNTQDLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTL 615

Query: 535  VILLGLEIDRIEEELETFDTPLMVRATIRGAAALRAIVATVLNGHVEATKHDIKHESLNT 594
            +++LGL+IDR EE  ET+ TPL+V+ATIRGA+ALR++VAT+LN ++E   HD KHE+LNT
Sbjct: 616  ILVLGLDIDRSEEAHETYKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNT 675

Query: 595  FMSPHGRKLCQGALYXXXXXXXXXXXXXXXXXXDVTSLFSDLQPGDRFDEDVRYMFEYEF 654
            FMSPHGRKLC GALY                  ++ +L S L+PGDRFDED+ YMFEYE+
Sbjct: 676  FMSPHGRKLCNGALYCDIKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEY 735

Query: 655  EDYN-DLSSREEDYSGFDKYDDYTDSSKTHARK-----GFGRRCNCIFXXXXXXXX---- 704
            +DYN  L    ED     K +D  D+S  +         + RRCNCIF            
Sbjct: 736  DDYNAALKENHEDLGKTLKSND--DNSDIYVLNEVKLDRYQRRCNCIFEDDKILQDDDDG 793

Query: 705  ---XXXXXXXXGHKAPKQILPQQNPTTSVSMSTTGKPHAIRSGGSFEFDYSGKDWRDIPR 761
                           PK +   Q+P    ++      +A+RS  +FEFDYSGKDWRDIPR
Sbjct: 794  NGDEQQGEQEEQEGTPKNVASFQDPLGKRNLD-----YAVRSKTTFEFDYSGKDWRDIPR 848

Query: 762  MSNLYYSPNYHFVEDLDPNTIISLTNKATKQSLSKIESLLLLGSVATCVKNEQDEIVLGN 821
              N+YYS +Y F++D   +T+I+LT+KA+ Q L+  +S+ LL  +A+ +K EQ+++++ +
Sbjct: 849  GFNIYYSTSYSFIDDSSLDTMINLTSKASTQKLNHDDSIQLLQLLASSIKEEQNDMIMKD 908

Query: 822  ITELHHQNGSRGSQVIDKLKD-----------ISPDDIYEMWCKDSTFEKMVYCNHEVAW 870
            + +   Q     S +I+ L +            +PDDI++ W     F +M++ N E++W
Sbjct: 909  LLKGKDQ---LHSNIINPLVNSKEEKERSTVVATPDDIFDYWFDKDVFVEMLHFNEELSW 965

Query: 871  RLMDEMLMCSGFRRVLIWFITHMELNHSLIHYIFELVMGLRKSFXXXXXXXXXXXSISEM 930
            RLMDEMLMC+G+RRVLIW+ITHM+LNHSLI YIFEL+MGLR S                M
Sbjct: 966  RLMDEMLMCNGYRRVLIWYITHMKLNHSLIQYIFELLMGLRGSPFANNNECKNELLHELM 1025

Query: 931  TKEAPEVRTSLPFSRQGSIQLSSIETKMLLQEFFTNAAIFLTEKSKEWIGEEPME---DE 987
              +      + PFSRQG + LS IETKMLLQEFF+NAAI+         G+  +E   ++
Sbjct: 1026 LGKKIVDNHTYPFSRQGPLILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTED 1085

Query: 988  ATIN-----DGENGNVSLYAVGLMKLICLMVRAFIKKGKFDFRESECVFELQTLLMNWIA 1042
             +IN     + EN  VS+Y++GLMKLIC+MV + I+  KFDF +S+C FELQTLLMNWI 
Sbjct: 1086 ISINSDEIENNENHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIG 1145

Query: 1043 IIPEAKDLFFELKALVAEV--HSDPMDDEELSNNPPDSNKKLSSMVENDNINGNEAVD-S 1099
            I+ EAK+LFF+LK+ + E    +D  DD++  +   DS K   S   N    G+     +
Sbjct: 1146 ILKEAKELFFKLKSDIEETSESTDGGDDDDFES--IDSRKSSES---NGKWEGSRIGKMN 1200

Query: 1100 EYNRKLISLLSPVMHRKEE---NAAVVALRNFIKKYSFDTTVP--LIGRKVVYEGNEILP 1154
            ++N++L+ LL+P+     +   +      R  +K YSF T+ P  + GRKVVY  +EILP
Sbjct: 1201 DFNKRLLRLLAPIHSGDTDLNSDTVTTPFRGLLKNYSF-TSKPKKVAGRKVVYTDDEILP 1259

Query: 1155 LPE 1157
            LP+
Sbjct: 1260 LPK 1262

 Score = 73.6 bits (179), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 85/176 (48%), Gaps = 29/176 (16%)

Query: 84  KYSLLLEMVIVALLTTRAGLSVLALLKPSGSNPSIPKCISNQRKWLAQVERKGKLHSDLI 143
           K+S++LE +++A  TT++G S+L  L  +   P      + Q K L +            
Sbjct: 113 KFSIMLETLVIAYFTTKSGQSILNYLFDTKRKPP-----TVQNKILRKT----------- 156

Query: 144 SQWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKVPLSFLIQ----SKYRAAELILDP 199
             W+ ++ ++  F+ FL++N++  +  +  N+ E K+ + FL+     S      +ILD 
Sbjct: 157 --WEVNEFLYFCFIDFLIRNKNNEINIDKFNEPENKLSIKFLLTFHPLSNIETPSIILDS 214

Query: 200 SYNLLVDYFLAVVPLCEKWLRRAISY---GNGVHLKRTVINYNRVYDFSGYFTWYT 252
           +YN+L DY  A       WL   I       G     T+I YNR+  F+G+F WYT
Sbjct: 215 NYNMLTDYLDAT----SNWLILLIKMTILNVGPFFYNTIIRYNRIPQFNGHFQWYT 266

>CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa]
            {ON} similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134w
          Length = 1163

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/1128 (36%), Positives = 614/1128 (54%), Gaps = 96/1128 (8%)

Query: 65   FEFLDRLLRD----SKSWKDPQLKYSLLLEMVIVALLTTRAGLSVLALLKPSGSNPSIPK 120
            FE+L+++ RD    + S+  P+ + +   E++ +AL TT+ G  +L   K +G + +I  
Sbjct: 89   FEYLEKIYRDEDLSTTSYSRPRFEDNFFYELLTIALFTTKPGNKILHFFKNTGLDSAIEH 148

Query: 121  CISNQRKWLAQVERKGKLHSDLISQWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKV 180
              S+   + +      K+       W+ +D+     L F+LKN +V +   N  +  +K 
Sbjct: 149  NDSDDTLFHSPAYEHLKM------LWKWEDEYLHNLLQFILKNRNVDIDLGNYCKTSYKR 202

Query: 181  PLSFLIQS-----KYRAAELILDPSYNLLVDYFLAVVPLCEKWLRRAISYGNGVHLK--- 232
            PL+FL+       K+R    +L   +N+L +Y  A     +  +  AI    G H+    
Sbjct: 203  PLTFLLTCPNNNIKHR---FLLSEEFNILEEYLYAAQSNIKSKIAIAIQSTIGKHMNFFT 259

Query: 233  RTVINYNRVYDFSGYFTWYTLQTRGSNHPFVSQQILFDL-------IDSDDKEIEAVSQI 285
             T+  Y+RV +++  +  Y + T   N      + L D+       + +DD  IEA+   
Sbjct: 260  MTLHLYDRVTEYNQSYLRYEI-TDDENALCQFDESLLDVLLEFERYVTTDD--IEAI--- 313

Query: 286  ESNXXXXXXXXXXXXXSAIQDISSASLNSGFYGDEDRSALEEYSDNYHHQVNQNEQVFSF 345
                            + ++DISSA +  G Y  E +  L   + N H   N+ E + SF
Sbjct: 314  ---------LLQSGRINKVKDISSA-IERGDYKWE-QGTLRSLTPNNHKADNEEEVILSF 362

Query: 346  DLNQDGSLELPNLMSHAAVRHEILMKVXXXXXXXXXX--XXXXFKIVAGLVDPLTQPAPN 403
            D+N++G  E+PN+M  + +RH IL +                 FK +AGLVDPLTQP PN
Sbjct: 363  DINENGLQEVPNIMKDSMLRHSILFEFLGLSQRNTLAPYLEMQFKTLAGLVDPLTQPTPN 422

Query: 404  DKHVISLDLLYQMFLGFLTPEIQQTLEFEEGCDWRFHVCFNMQKIIDASLVRLNFDDFER 463
            D H+IS+DLL+ ++ G + P + ++ +     DW++   FN+ KI+  SL +L+   ++ 
Sbjct: 423  DTHIISIDLLHGLYTGLVHPALIKSGK-ARNYDWKYLCGFNLIKIVWKSLKKLHCSSYDT 481

Query: 464  LNSINNSDDNVDWRSQLDKWLPHGFNTQDLELICMVDIIAVYTIYKLYEHLPIQLNPFLS 523
            LN+I N ++  DWR  L+ W+P   NTQDLEL+ M+DI++VY IYKLYE  PIQ NPFL 
Sbjct: 482  LNNIGNFEEGNDWRQTLEYWIPKNLNTQDLELLYMIDILSVYAIYKLYEDQPIQNNPFLF 541

Query: 524  SLISLWKNLTCVILLGLEIDRIEEELETFDTPLMVRATIRGAAALRAIVATVLNGHVEAT 583
             L S+WK +T +I LGL++DRIEE+ ++ +TPLM+RAT+RGA+A RA + T+LN  +E  
Sbjct: 542  ELFSVWKYITKIIFLGLQVDRIEEQNDSEETPLMIRATVRGASAFRAALTTILNRQIENN 601

Query: 584  KHDIKHESLNTFMSPHGRKLCQGALYXXXXXXXXXXXXXXXXXXDVTSLFSDLQPGDRFD 643
            +HD KHE +NTFMSPHGRKLC G+LY                  D+T+L +DLQPGDRFD
Sbjct: 602  EHDFKHEPINTFMSPHGRKLCSGSLYADMRVSTKIFVENGVELDDITNLLTDLQPGDRFD 661

Query: 644  EDVRYMFEYEFEDYNDLSSREEDYSGFDKYDDYTDSSKTHARKG-FGRRCNCIFX--XXX 700
            EDV YMF+YE+EDYN +S  E+        D+  D+     R     RRCNC+F      
Sbjct: 662  EDVEYMFDYEYEDYNLVSDSED-------MDEKADNESDGVRPAPIFRRCNCVFEDDKIM 714

Query: 701  XXXXXXXXXXXXGHKAPKQILPQQNPTTSVSMSTTGKPHAIRSGGSFEFDYSGKDWRDIP 760
                          +     +  ++    + + +  +P  +R    F+F+Y GKDWRDIP
Sbjct: 715  DESTIDHQSLITDMELENNAISTKDENDKIKIISQPEPFTVRMRSFFDFNYGGKDWRDIP 774

Query: 761  RMSNLYYSPNYHFVEDLDPNTIISLTNKATKQSLSKIESLLLLGSVATCVKNEQDEIVL- 819
            R  NLYY+  + FV++   +   S  +KA    L   ES  L+  VA+C++ EQD +V+ 
Sbjct: 775  RGENLYYNGEFVFVQECSSSEFASYFSKAVNSVLDISESNRLIQLVASCIREEQDRMVIY 834

Query: 820  GNITELHHQNGSRGSQVIDKLKDISPDDIYEMWCKDSTFEKMVYCNHEVAWRLMDEMLMC 879
              +++L   NG      ++K K ++ D+IY+     + F KM+Y + E+A  LMDE+LM 
Sbjct: 835  HGMSQLPLANGD-----VNKSK-LTVDEIYDQISSSNNFAKMLYQDTELACGLMDELLMI 888

Query: 880  SGFRRVLIWFITHMELNHSLIHYIFELVMGLRKSFXXXXXXXXXXXSISEMTKEAPEVRT 939
             G+RRVLIWF+TH+ +   LIHYIFELVMG R  F              +  K++   + 
Sbjct: 889  VGYRRVLIWFLTHINITFPLIHYIFELVMGYRVGFSDGDAN-------GDNNKKSSTGKC 941

Query: 940  SLPFSRQGSIQLSSIETKMLLQEFFTNAAIFLTEKSKEWIGEE--PMEDEATINDGENGN 997
               FSR G++ LSSIE +MLLQEFF NA + L+ KS E  G E    +D A   D +N  
Sbjct: 942  G--FSRLGTVALSSIEKQMLLQEFFLNATVSLSAKSFESNGTEIDNYDDNA---DEDNEY 996

Query: 998  VSLYAVGLMKLICLMVRAFIKKGKFDFRESECVFELQTLLMNWIAIIPEAKDLFFELKAL 1057
            +S YAVG++ LIC MV+  ++ G+ D  +SE   ELQTLL+NWI++IPEAK+LFF LK  
Sbjct: 997  ISSYAVGIVTLICNMVKTLVRAGQMDVSKSEYTVELQTLLVNWISLIPEAKELFFFLKQE 1056

Query: 1058 VAEVHSDPMDDEELSNNPPDSNKKLSSMVENDNINGNEAVDSEYNRKLISLLSPVMHRKE 1117
              E   D  D  E  N         S +  + NIN   A DS     L   ++  +    
Sbjct: 1057 AHEF--DIQDSLEPINE--------SELQTSGNINEPAATDS---IPLDDTINTSLTSST 1103

Query: 1118 ENA-AVVALRNFIKKYSFDTTV--PLIGRKVVYEGNEILPLPESETPM 1162
            +N+ A  AL  F++    +T+V  P IGRKV+Y+G +ILPLPE E P+
Sbjct: 1104 KNSNATDALSTFLETVE-ETSVQPPQIGRKVIYKGTKILPLPEQERPI 1150

>TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_3.497
            YGR134W
          Length = 1074

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/786 (41%), Positives = 463/786 (58%), Gaps = 50/786 (6%)

Query: 387  FKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLGFLTPEIQQTLEFEEGCDWRFHVCFNMQ 446
            F  +  LVDPLTQP PND+HVISLDLLY++FL  + P +Q  +E E   DWR+ +  N+Q
Sbjct: 316  FNRICALVDPLTQPIPNDEHVISLDLLYKIFLAMMLPHVQVLIERESSYDWRYEISNNLQ 375

Query: 447  KIIDASLVRLNFDDFERLNSINNSDDNVDWRSQLDKWLPHGFNTQDLELICMVDIIAVYT 506
            KI+  + + LN  D E+LN +   D+   W+ QL  WLPHG N Q+LEL+ M+ I  VY 
Sbjct: 376  KILFYAFLNLNCYDMEKLNKV---DETKHWKEQLHLWLPHGLNPQNLELLYMICIFCVYA 432

Query: 507  IYKLYEHLPIQLNPFLSSLISLWKNLTCVILLGLEIDRIEEELETFDTPLMVRATIRGAA 566
            I+KLYE  P+  NPFL +L+S WK LT V+L GL++DR EEE E+F+TP+MVRATIRGA+
Sbjct: 433  IFKLYEDKPLHFNPFLPTLLSTWKKLTYVMLYGLQVDRFEEENESFNTPIMVRATIRGAS 492

Query: 567  ALRAIVATVLNGHVEATKHDIKHESLNTFMSPHGRKLCQGALYXXXXXXXXXXXXXXXXX 626
            ALR++VA++LN  ++  KHD +HE LNTFMSPHGRKLC GALY                 
Sbjct: 493  ALRSVVASILNNQMDGKKHDFQHEPLNTFMSPHGRKLCTGALYADLKSYTASMLACGMEF 552

Query: 627  XDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYNDLSSREEDYSGFDKYDDYTDSSKTHARK 686
             D+T L S LQPGD FDEDV+YMFEYE++DYN+    E D  G        ++S+ + + 
Sbjct: 553  KDITELLSYLQPGDCFDEDVKYMFEYEYDDYNEPEEDESDEDG------ERNNSEENIKF 606

Query: 687  GFG-RRCNCIFXXXXXXXXXXXXXXXXGHKAPKQILPQQNPTTSVSMSTTG--KPHAIRS 743
             F  RRC C+F                 +   ++     N   +  +   G  KP     
Sbjct: 607  NFNRRRCRCVFSDDDVLEHGDFNDANSEYSNSEE---NSNDVDNFVLPNDGIDKPK---- 659

Query: 744  GGSFEFDYSGKDWRDIPRMSNLYYSPNYHFVEDLDPNTIISLTNKATKQSLSKIESLLLL 803
                EFD+ GKDWR +PR  N++YS +Y F+E+     I SL ++A+  +LSK +S LLL
Sbjct: 660  -NGVEFDFDGKDWRAVPRHLNMFYSFDYIFIENPLEVLIRSLISEASASALSKKKSHLLL 718

Query: 804  GSVATCVKNEQDEIVLGNITELHHQNGSRGSQVIDKLKDISPDDIYEMWCKDSTFEKMVY 863
             ++A+ +K  QD  +LG+       NG+  S+  + L   S  D+ ++     TFE ++ 
Sbjct: 719  RNIASVIKINQDSRILGSK---RSPNGTDSSKSQNGL---STGDLIKLITAGDTFENILK 772

Query: 864  CNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLIHYIFELVMGLRKSFXXXXXXXXX 923
             N E+   LMDE+LM  G+RRVL+WF+TH+ L+H++I+YIFEL+M  R            
Sbjct: 773  FNRELGCFLMDELLMILGYRRVLLWFLTHLTLSHTIIYYIFELLMHHRG----------- 821

Query: 924  XXSISEMTKEAPEVRTSLPFSRQGSIQLSSIETKMLLQEFFTNAAIFLTEKSKEWIGEEP 983
               +S+  +E  E+  S  FSRQG ++LS +E +MLLQEFFTNA +F + KS  +  +  
Sbjct: 822  --QVSDTEREQSEL--SYTFSRQGELRLSDLEREMLLQEFFTNATMFFSSKSVLFASDTG 877

Query: 984  MEDEATIN-DGENGNVSLYAVGLMKLICLMVRAFIKKGKFDFRESECVFELQTLLMNWIA 1042
              +E   + DGE G  SLYAVGLM++ C+M+ +      FD   SE +FELQTLLM WI 
Sbjct: 878  DNNEINTDVDGEEGLYSLYAVGLMRVTCIMIISLFDNADFDLSSSESIFELQTLLMGWIN 937

Query: 1043 IIPEAKDLFFELKALVAEVHSDPMDDEELSNNPPDSNKKLSSMVENDNINGNEAVDSEYN 1102
            IIPEAK LFF+LK  V   +   +D+ EL +    S     + ++ +      +    +N
Sbjct: 938  IIPEAKLLFFKLKESVKSFNG--IDNPELKSIEESSTTTKKTTIDEN------SEQYRFN 989

Query: 1103 RKLISLLSPVMHRKEENAAVVALRNFIKKYSFDTTVPLIGRKVVYEGNEILPLPESETPM 1162
            +KL+          + +  +   ++F++ YSFD+  P IGRKV+YE +EIL L + E P+
Sbjct: 990  KKLLKTFPKSFSGDDGDILLKTFKDFLRNYSFDSEPPYIGRKVIYESDEILQLTDIEKPI 1049

Query: 1163 SLLDYL 1168
            SL  +L
Sbjct: 1050 SLHKFL 1055

>KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] {ON}
            weakly similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4-NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  400 bits (1029), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 314/1143 (27%), Positives = 532/1143 (46%), Gaps = 132/1143 (11%)

Query: 80   DPQLKYSLLLEMVIVALLTTRAGLSVLALL----KPSGSNPSIPKCIS-NQRKWLAQVER 134
            D  +  S+LLE +++AL TT  G +V+  L    K +     +   I  N   W+A    
Sbjct: 15   DSDVDESVLLEKLVIALFTTVPGQAVVTQLINDAKRTNDVDGVECLIRMNDPYWVA---- 70

Query: 135  KGKLHSDLISQWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKVPLSFLIQSKYRAAE 194
                   L   W +D  I   FL ++L+NE   +  E  +   +K+ + FL+ ++     
Sbjct: 71   -------LFGTWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPKFT 123

Query: 195  LILDPSYNLLVDYFLAVVPLCEKWLRRAISYGNGVHLKRTVINYNRVYDFSGYFTWYT-- 252
              L  + N+L+DY     PL E  L++     +G    + ++ YNR+Y+F+G + W+T  
Sbjct: 124  APLWDTSNILLDYLHNAKPLIESVLKKL----DGSQFLQCLMKYNRLYEFNGSYQWFTPP 179

Query: 253  LQTRGSNHPFV----SQQILFDLIDSDDKEIEAVSQIESNXXXXXXXXXXXXXSAIQDIS 308
              T  +  P      +   L  L +  +  + A+SQ+++                     
Sbjct: 180  QSTSHAESPTTILERNSTFLSTLGNFGNDMVRALSQLKT--------------------- 218

Query: 309  SASLNSGFYGDEDRSALEEYSDNY-HHQVNQNEQVFSFDLNQDGSLELPNLMSHAAVRHE 367
                     GD   ++LE Y  N  H+    ++Q     LN +G  +  NL     +  E
Sbjct: 219  ---------GDIRLNSLESYGKNSGHNNPPLSKQDDHNPLNLNGKSDRFNLFFKLGLHKE 269

Query: 368  ILMKVXXXXXXXXXXXXXXFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLGFLTPEIQQ 427
                               F  +    DP+TQP PND H+ISLDLL+ ++LG LT  I +
Sbjct: 270  -----------PHPLLAEQFNSLCLFADPMTQPPPNDSHIISLDLLHDLYLGSLTAYIVK 318

Query: 428  TLEFEEGCDWRFHVCFNMQKIIDASLVRLNFDDFERLNSINN--SDDNVDWRSQLDKWLP 485
             +   +   W+ H+  N++ I  A L  L   D+  L+++ +  +     +   +  W+P
Sbjct: 319  LIPNYQKV-WKIHLSANLETITLAILQMLQIWDYRSLDNLKDIQARSPDAYPKYMTSWIP 377

Query: 486  HGFNTQDLELICMVDIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILLGLEIDRI 545
            +  +  ++E++ M+  ++ Y+++K++   P +LNPFL  ++  W+ L+  ++LGL+IDR 
Sbjct: 378  YDLSPPEMEILYMIAGLSFYSMHKMHSDKPPRLNPFLPMMLRAWRGLSSALVLGLQIDRF 437

Query: 546  EEELETFDTPLMVRATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSPHGRKLCQ 605
            EE    + TP++V A IRGA+ALR+I+AT+LNGHV+   HD KH+    FMSPHGRKLC 
Sbjct: 438  EEMQMLYGTPVIVSAVIRGASALRSIIATILNGHVDEKLHDFKHQPFGGFMSPHGRKLCN 497

Query: 606  GALYXXXXXXXXXXXXXXXXXXDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYNDLSSREE 665
            GALY                  ++  L +D+Q GDR DEDVRYMF+YE+ DYND  + + 
Sbjct: 498  GALYTYEMYYFAALLPSGMDYDEIVELLTDIQKGDRIDEDVRYMFDYEYFDYNDADTSKL 557

Query: 666  DYSGF---DKYDDYTDSSKTHARKGFGRRCNCIFXXXXXXXXXXXXXXXXGHKAPKQIL- 721
                       ++    ++    +G  +RC C F                 +   K ++ 
Sbjct: 558  TDGKLMFTSTKNELEQKNRFRMLRGLYKRCLCKFSDEDDNDDDDDDDDDDDYNGEKSVVG 617

Query: 722  ------------PQQNPTTSVSMSTTGKPHAIRSGGSF------EFDYSGKDWRDIPRMS 763
                        PQ    +S +++ T       S   F       +D +G DWRDIPR  
Sbjct: 618  LDENGQINEAETPQTFSESSNAVAFTSLMTHRDSQNDFVSHLTTGYDKNGDDWRDIPRGL 677

Query: 764  NLYYSPNYHFVEDLDPNTIISLTNKATKQSLSKIESLLLLGSVATCVKNEQDEIVLGNIT 823
            NLYY  +Y F+  LD  ++  L  +   ++++  ++  +L S+ATCVK EQ++I+L  IT
Sbjct: 678  NLYYMDDYQFLSKLDKVSLFELLRRLPDRNVTFSQACTVLRSIATCVKLEQEQILLKLIT 737

Query: 824  ELHHQNGSRGSQVIDKLKDISPDD-IYEMWCKDSTFEK---MVYCNHEVAWRLMDEMLMC 879
                   +  ++V  K+   S D+ I  ++  D    K      CN  + W++ DE++M 
Sbjct: 738  -------ATSAEVDLKVLPFSTDEVITAIFNDDGGIIKPFPFSGCNDSLGWKIFDELMMS 790

Query: 880  SGFRRVLIWFITHMELNHSLIHYIFELVMGLR----KSFXXXXXXXXXXXSISEMTKEAP 935
             G RR+LI+ +TH     S IHY++EL+ GLR    +S+            +S       
Sbjct: 791  HGHRRLLIYHLTHRSYTFSSIHYVYELLFGLRGNPARSYDLESTKNKQLGILSWTPTGEF 850

Query: 936  EVRTSLPFSRQGSIQLSSIETKMLLQEFFTN-AAIFLTEKSKEWIGEEPMEDEATINDGE 994
            E   ++ FSRQG I+LS+IE KMLLQEFF   ++  L E +        +++ + +   +
Sbjct: 851  ERVAAIEFSRQGVIELSAIEKKMLLQEFFVGVSSGLLGEYNDAGFEAFSIKNPSKVYVDD 910

Query: 995  NGNVSLYAV-------GLMKLICLMVRAFIKKGKFDFRESE-CVFELQTLLMNWIAIIPE 1046
             G     A        G +K++C ++   +   +F+F   E  V+EL+  LM W     E
Sbjct: 911  YGEEFFSATSRKAEMSGKVKMVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAE 970

Query: 1047 AKDLFFELKA----LVAEVHSDPMDDEELSNN-----PPDSNK-KLSSMVENDNINGNEA 1096
            A  ++  LK+     V ++ ++ +DD   ++      P D +K KLS + +  +   + +
Sbjct: 971  ACSMYALLKSKALGKVLDLGTEGLDDRPNTDPDDQLLPVDFDKLKLSDIDDRWDTETDTS 1030

Query: 1097 VDSEYNRKLI----SLLSPVMHRKEENAAVVALRNFIKKYSFDTTVPLIGRKVVYEGNEI 1152
            +++     ++    S + PV     +    V  R+ ++KY      P+ GR  +   + I
Sbjct: 1031 IENGDKTSIMSERFSRMLPVQSLDGQPVDKV-FRHLLQKYPLTEGTPIHGRITLEYHDHI 1089

Query: 1153 LPL 1155
            LPL
Sbjct: 1090 LPL 1092

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score = 32.3 bits (72), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 32/63 (50%), Gaps = 6/63 (9%)

Query: 411  DLLYQMFLGFLTPEIQQTLEFEEGCDWRFHVC-FNMQKIIDASLVRLNFDDFERLNSINN 469
            +LL   F G +   I++ LEFEE   WR HV  F ++ ++ A   R      +RLN IN 
Sbjct: 1249 NLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRT-----DRLNDINM 1303

Query: 470  SDD 472
              D
Sbjct: 1304 DTD 1306

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 127,118,514
Number of extensions: 5737143
Number of successful extensions: 21761
Number of sequences better than 10.0: 39
Number of HSP's gapped: 22089
Number of HSP's successfully gapped: 58
Length of query: 1180
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1059
Effective length of database: 39,606,813
Effective search space: 41943614967
Effective search space used: 41943614967
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)