Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D09768g3.498ON46046021250.0
TPHA0A056903.498ON4784927524e-94
TDEL0D056603.498ON4422355911e-70
Kpol_480.113.498ON4632395912e-70
KLLA0E03939g3.498ON4354645091e-58
SAKL0F02552g3.498ON4782514883e-55
Ecym_12313.498ON3292494461e-50
AFR317C3.498ON3282304382e-49
CAGL0L08404g3.498ON4104544381e-48
Kwal_47.188953.498ON4432264313e-47
KLTH0G02398g3.498ON4622384112e-44
KAFR0G037203.498ON4092304065e-44
KNAG0A079703.498ON3882363933e-42
Suva_16.4803.498ON4522293946e-42
YPR152C (URN1)3.498ON4652293894e-41
Skud_16.4463.498ON4562283561e-36
Smik_16.4043.498ON4602323482e-35
NCAS0F035803.498ON4132262634e-24
NDAI0B059003.498ON5221452495e-22
TBLA0D029303.498ON2762341869e-15
TBLA0C009302.649ON6581091492e-09
Ecym_33972.649ON575831472e-09
KAFR0A002302.649ON556851454e-09
Smik_11.2432.649ON579841411e-08
KLLA0E18239g2.649ON571831365e-08
YKL012W (PRP40)2.649ON583841365e-08
KLTH0C00924g2.649ON564831322e-07
Kpol_1073.42.649ON530961322e-07
Skud_11.2172.649ON583831312e-07
ZYRO0E00682g2.649ON570851293e-07
Suva_11.2162.649ON585831294e-07
NCAS0C051102.649ON604841294e-07
CAGL0L05368g2.649ON590881286e-07
Kwal_14.9392.649ON5621011241e-06
SAKL0G19360g2.649ON568831204e-06
NDAI0G046002.649ON647941205e-06
TDEL0B074402.649ON570831188e-06
KNAG0M024702.649ON606881152e-05
TPHA0L020202.649ON583841116e-05
ADR159C2.649ON56984960.003
Kpol_1031.398.134ON81598870.052
SAKL0H24552g8.134ON79098860.059
TDEL0F009908.134ON78998860.060
KLLA0E13575g8.134ON81998860.060
Kwal_47.173028.134ON78798860.060
KLTH0E06908g8.134ON79198860.060
KAFR0B021008.134ON80098860.060
Smik_5.2718.134ON80898860.062
KNAG0D021808.134ON81198860.063
CAGL0K02255g8.134ON82298860.064
NCAS0B045408.134ON83598860.066
NDAI0B024608.134ON83698860.067
YER125W (RSP5)8.134ON80998860.068
Skud_5.2538.134ON80998860.069
ZYRO0G18920g8.134ON81998860.071
TBLA0G027908.134ON84498860.072
TPHA0D010308.134ON82298860.073
Ecym_83948.134ON84198860.073
Suva_5.2468.134ON80998850.074
ADL055C8.134ON81798840.11
NCAS0A153007.546ON139847790.47
ZYRO0E04224gna 1ON1248108780.59
NCAS0I018203.173ON47360705.2
Kpol_1010.415.135ON16428676.1
NDAI0K010108.736ON167247697.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D09768g
         (460 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} simila...   823   0.0  
TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa] ...   294   4e-94
TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa] ...   232   1e-70
Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON} (21829..2...   232   2e-70
KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} simila...   200   1e-58
SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} simila...   192   3e-55
Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to...   176   1e-50
AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON} ...   173   2e-49
CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} simil...   173   1e-48
Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]...   170   3e-47
KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} simila...   162   2e-44
KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {O...   160   5e-44
KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa] ...   155   3e-42
Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {...   156   6e-42
YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON} ...   154   4e-41
Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {...   141   1e-36
Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {...   138   2e-35
NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {O...   105   4e-24
NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa] ...   100   5e-22
TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.49...    76   9e-15
TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa] {O...    62   2e-09
Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar t...    61   2e-09
KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649...    60   4e-09
Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012...    59   1e-08
KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON} simi...    57   5e-08
YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1 s...    57   5e-08
KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar ...    55   2e-07
Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON} (4004..559...    55   2e-07
Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012...    55   2e-07
ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar ...    54   3e-07
Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012...    54   4e-07
NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON} Anc_2...    54   4e-07
CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa] ...    54   6e-07
Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W ...    52   1e-06
SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]...    51   4e-06
NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa] ...    51   5e-06
TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa] ...    50   8e-06
KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2....    49   2e-05
TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa] {...    47   6e-05
ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON} S...    42   0.003
Kpol_1031.39 s1031 (93761..96208) [2448 bp, 815 aa] {ON} (93761....    38   0.052
SAKL0H24552g Chr8 (2129859..2132231) [2373 bp, 790 aa] {ON} high...    38   0.059
TDEL0F00990 Chr6 complement(173710..176079) [2370 bp, 789 aa] {O...    38   0.060
KLLA0E13575g Chr5 (1198133..1200592) [2460 bp, 819 aa] {ON} high...    38   0.060
Kwal_47.17302 s47 complement(342098..344461) [2364 bp, 787 aa] {...    38   0.060
KLTH0E06908g Chr5 complement(634745..637120) [2376 bp, 791 aa] {...    38   0.060
KAFR0B02100 Chr2 (412007..414409) [2403 bp, 800 aa] {ON} Anc_8.1...    38   0.060
Smik_5.271 Chr5 (419111..421537) [2427 bp, 808 aa] {ON} YER125W ...    38   0.062
KNAG0D02180 Chr4 complement(369157..371592) [2436 bp, 811 aa] {O...    38   0.063
CAGL0K02255g Chr11 complement(200548..203016) [2469 bp, 822 aa] ...    38   0.064
NCAS0B04540 Chr2 (825546..828053) [2508 bp, 835 aa] {ON} Anc_8.134     38   0.066
NDAI0B02460 Chr2 (618295..620805) [2511 bp, 836 aa] {ON} Anc_8.134     38   0.067
YER125W Chr5 (410189..412618) [2430 bp, 809 aa] {ON}  RSP5E3 ubi...    38   0.068
Skud_5.253 Chr5 complement(408930..411359) [2430 bp, 809 aa] {ON...    38   0.069
ZYRO0G18920g Chr7 (1563386..1565845) [2460 bp, 819 aa] {ON} high...    38   0.071
TBLA0G02790 Chr7 (733955..736489) [2535 bp, 844 aa] {ON} Anc_8.1...    38   0.072
TPHA0D01030 Chr4 (207354..209822) [2469 bp, 822 aa] {ON} Anc_8.1...    38   0.073
Ecym_8394 Chr8 (808813..811338) [2526 bp, 841 aa] {ON} similar t...    38   0.073
Suva_5.246 Chr5 (385807..388236) [2430 bp, 809 aa] {ON} YER125W ...    37   0.074
ADL055C Chr4 complement(584032..586485) [2454 bp, 817 aa] {ON} S...    37   0.11 
NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON}            35   0.47 
ZYRO0E04224g Chr5 (317895..321641) [3747 bp, 1248 aa] {ON} conse...    35   0.59 
NCAS0I01820 Chr9 complement(334312..335733) [1422 bp, 473 aa] {O...    32   5.2  
Kpol_1010.41 s1010 complement(95811..96305) [495 bp, 164 aa] {ON...    30   6.1  
NDAI0K01010 Chr11 complement(230318..235336) [5019 bp, 1672 aa] ...    31   7.4  

>ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
          Length = 460

 Score =  823 bits (2125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/460 (91%), Positives = 419/460 (91%)

Query: 1   MARIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYH 60
           MARIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYH
Sbjct: 1   MARIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYH 60

Query: 61  GWHLVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKNKLVALIGLARGYSPGGLHI 120
           GWHLVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKNKLVALIGLARGYSPGGLHI
Sbjct: 61  GWHLVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKNKLVALIGLARGYSPGGLHI 120

Query: 121 YEELVTDLVKLRQEREAKRAEGDQEKDXXXXXXXXXXXXXXXXXXXXXVKEEDRDQNDGE 180
           YEELVTDLVKLRQEREAKRAEGDQEKD                     VKEEDRDQNDGE
Sbjct: 121 YEELVTDLVKLRQEREAKRAEGDQEKDEATGEEVKDEDEEKDKANGEEVKEEDRDQNDGE 180

Query: 181 DNDAQNGLVAXXXXXXXXXXXXXXXXXXXXPLNIPITESVEEPVDISGDKKALWDLFTRY 240
           DNDAQNGLVA                    PLNIPITESVEEPVDISGDKKALWDLFTRY
Sbjct: 181 DNDAQNGLVAGYSSSSESEDEGEGEGEGEEPLNIPITESVEEPVDISGDKKALWDLFTRY 240

Query: 241 DLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAISGDQVEPVDEIKSEDFDE 300
           DLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAISGDQVEPVDEIKSEDFDE
Sbjct: 241 DLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAISGDQVEPVDEIKSEDFDE 300

Query: 301 EEDLEPTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSFKKYNIKDFLTSKKDQESFVSKL 360
           EEDLEPTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSFKKYNIKDFLTSKKDQESFVSKL
Sbjct: 301 EEDLEPTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSFKKYNIKDFLTSKKDQESFVSKL 360

Query: 361 LFYYKRMKLEERKEVFVQLLKQNGKTIEENLSNDMDKVRHCLAQEIDSNDPYAVETKLFK 420
           LFYYKRMKLEERKEVFVQLLKQNGKTIEENLSNDMDKVRHCLAQEIDSNDPYAVETKLFK
Sbjct: 361 LFYYKRMKLEERKEVFVQLLKQNGKTIEENLSNDMDKVRHCLAQEIDSNDPYAVETKLFK 420

Query: 421 MEKFMGLWGNLSDLVEEPKYYILGIRDKMLELNDYLKIYV 460
           MEKFMGLWGNLSDLVEEPKYYILGIRDKMLELNDYLKIYV
Sbjct: 421 MEKFMGLWGNLSDLVEEPKYYILGIRDKMLELNDYLKIYV 460

>TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa]
           {ON} Anc_3.498 YPR152C
          Length = 478

 Score =  294 bits (752), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 184/492 (37%), Positives = 269/492 (54%), Gaps = 57/492 (11%)

Query: 3   RIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGW 62
           R+W+E++AP+G+KYYYN  TK++TW +PESL E      V + +K ES P  A  L++ W
Sbjct: 4   RVWKEFIAPNGQKYYYNLKTKKTTWDEPESLFE---GNAVSQGQKDES-PVFAFPLFNDW 59

Query: 63  HLVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKNKLVALIGLARGYSPGG-LHIY 121
           +LVI   GKKFY+N   N S   L DE +  L+ ++DK KL+ L+G+ARG+     L +Y
Sbjct: 60  YLVISSLGKKFYFNAVENISVLELHDELNTQLLQSIDKQKLILLVGVARGFIYDEYLQVY 119

Query: 122 EELVTDL---------------VKLRQEREAKRAEGDQEKDXXXXXXXXXXXXXXXXXXX 166
           EE++ +L               V + QE E + A+     D                   
Sbjct: 120 EEIMENLDFVKNEISNEYKELQVNVAQESE-ESADKQDPGDLIATDNGIVNDYYSSSDEE 178

Query: 167 XXVKEEDRDQND-GEDNDAQNGLVAXXXXXXXXXXXXXXXXXXXXPLNIPITESVEEPVD 225
             ++E+  ++ D  EDN  QN  +                       N     SVE  +D
Sbjct: 179 VDIREDKFNEIDLAEDNLQQNDGI------------RTEVIRTETDFNEENLNSVE-TLD 225

Query: 226 ISGDKKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCA----HA 281
            +  K+  + LF +Y LN +S W  + K + DDPDF  + D+S+RED+FEEWC+    H 
Sbjct: 226 FNASKEKYFQLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHH 285

Query: 282 ISGDQVEPVDEIKS----------------EDFDEEEDLEPTKYHYLAHIVSKSNITPTT 325
            S   V+  D+  S                +  +EEE+LEPTKYHYL+HI+SK+NI+P T
Sbjct: 286 NSITSVDKDDQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDT 345

Query: 326 IFMDIKNDNKSSFKKYNIKDFLTSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGK 385
           IF DIK DNK  FK++ I  F+TSK+D ESF SKL+FYYK+    +R+++F  +L+QN  
Sbjct: 346 IFQDIKKDNKKLFKQFKINKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKT 405

Query: 386 TIEENLSNDMDKVRHCLAQEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGI 445
            I +++    DKV   L   +  N+ +  ET+L K+E  +GL G+L  L  +PKYYILGI
Sbjct: 406 AINKHVVEHSDKVLETLNTSV--NEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGI 463

Query: 446 RDKMLELNDYLK 457
           +DK+  L +YL+
Sbjct: 464 KDKLECLKNYLR 475

>TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa]
           {ON} Anc_3.498 YPR152C
          Length = 442

 Score =  232 bits (591), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 115/235 (48%), Positives = 162/235 (68%), Gaps = 8/235 (3%)

Query: 233 LWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAISGDQVEPVDE 292
            + L  R+  +PYS W  + +KI++DP F R+ DDS+RE +FEEWC  AI+     P D 
Sbjct: 209 FFQLLQRHQCDPYSTWSIQARKIQEDPLFYRITDDSIRESMFEEWCEKAINR-TTNPQDL 267

Query: 293 IKSEDFDEEEDLE-------PTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSFKKYNIKD 345
           +  ++ D++   E       P  +HYLAHIVSK+NITP+TIF DIK+ NK+ FKKY IK 
Sbjct: 268 VDEDNLDDDSREEEEEDELEPLPFHYLAHIVSKANITPSTIFQDIKDQNKADFKKYKIKQ 327

Query: 346 FLTSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIEENLSNDMDKVRHCLAQE 405
           F+ SK  QE+FVSKLLFYYK+  L+ERKE+F  LL+ + ++I++NL  + + +R  L++E
Sbjct: 328 FVKSKSQQETFVSKLLFYYKKFTLDERKEIFHDLLESHSRSIKKNLEQESESMRSTLSEE 387

Query: 406 IDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDKMLELNDYLKIYV 460
             SND YA+ETKL KME  +GL  ++ +L  +PKYY+LGI+DKM+EL  YL  Y+
Sbjct: 388 AGSNDAYAIETKLLKMENLIGLARDMEELANDPKYYVLGIKDKMIELMHYLTSYI 442

 Score =  115 bits (289), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 57/134 (42%), Positives = 83/134 (61%), Gaps = 3/134 (2%)

Query: 1   MARIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYH 60
           M R+W  + AP G KYYYN  TK+STW +PES  E   N+  K  +  E +P  A+ L +
Sbjct: 1   MGRLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTR--EPEPFYAIPLVN 58

Query: 61  GWHLVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKNKLVALIGLARGYSPG-GLH 119
            W LVI D G K+Y++  T E++W L D  S  L+  +DKNK++ L+ +ARGY+   G  
Sbjct: 59  DWFLVIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKNKIILLVAIARGYNTNVGDR 118

Query: 120 IYEELVTDLVKLRQ 133
           +Y+E++ DL  LR+
Sbjct: 119 VYQEVIDDLKALRK 132

>Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON}
           (21829..23220) [1392 nt, 464 aa]
          Length = 463

 Score =  232 bits (591), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 113/239 (47%), Positives = 169/239 (70%), Gaps = 8/239 (3%)

Query: 224 VDISGDKKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAIS 283
           +D+   K     LF  + L+PYS+W  ++KKI++ PD+ ++ D+S RE++FE WC+   +
Sbjct: 225 IDLEKSKSLFTRLFEEFQLDPYSSWRLQLKKIQNHPDYFQITDNSTREELFESWCSSKFN 284

Query: 284 GDQVEPVDEIKSED-----FDEEEDLEPTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSF 338
           G +   V   + ED      DEE+D EPTK+HYLAHI+SK++I   TIF+DIK +NKS F
Sbjct: 285 GGK-SNVTNFEGEDEETLTSDEEDDFEPTKFHYLAHIISKADIAADTIFLDIKENNKSLF 343

Query: 339 KKYNIKDFLTSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIEENLSNDMDKV 398
           K++ IKDF+ SKKDQE+F SKLLF+YK+ +L ERK +F+QLLK+N   I  N++++++ V
Sbjct: 344 KEFKIKDFIKSKKDQEAFSSKLLFFYKKFQLNERKNLFLQLLKENENLIIPNINSNIEIV 403

Query: 399 RHCLAQEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDKMLELNDYLK 457
           RH +  ++D  + Y +ET+L ++EK +GL   L DL  +PKYYILGI+DK++ L +YLK
Sbjct: 404 RHIIKNDVD--EAYEIETQLLQIEKIIGLQNMLVDLANDPKYYILGIKDKLILLKEYLK 460

 Score =  109 bits (272), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 85/130 (65%), Gaps = 7/130 (5%)

Query: 2   ARIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENR-GVKRFKKIESKPHVALELYH 60
            +IW+E+ APDGRKYYYN  +K+STW KP+SL + ++ + G  R       P     L +
Sbjct: 3   VKIWKEFNAPDGRKYYYNIKSKESTWTKPDSLYDTEKGKVGSDR----AGAPLFVFPLLN 58

Query: 61  GWHLVICDTGKKFYYNVETNES-AWNLPDEGSRNLIDALDKNKLVALIGLARGYS-PGGL 118
           GWHL+IC  G+K+YYN   N++ +  L D+ S  L++A+DK+KL+ LI +ARGY+ P   
Sbjct: 59  GWHLIICVGGEKYYYNKVLNDTISKELSDDSSLQLLNAVDKDKLILLIAVARGYNWPDYE 118

Query: 119 HIYEELVTDL 128
            +Y+EL+ + 
Sbjct: 119 KLYDELLKEF 128

>KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 435

 Score =  200 bits (509), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 146/464 (31%), Positives = 233/464 (50%), Gaps = 48/464 (10%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWHL 64
           W+ +  P G  YY+N  +K ST  KP+      +  G+K  +     P   L L + W+L
Sbjct: 4   WKRFKDPSGNFYYFNTRSKVSTKEKPKEFG--SQQAGMKELRV----PVFCLPLRNYWNL 57

Query: 65  VICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKNKLVALIGLARGYS-PGGLHIYEE 123
           VIC  G KF++N E+N S + L D+ S+ L+D +D + L  LIG+ARG++      +Y E
Sbjct: 58  VICKDGSKFFHNDESNVSQFKLADDESKALLDKVDTSLLALLIGVARGFNLRNDRDVYGE 117

Query: 124 LVTDLVKLRQEREAKRAEGDQEKDXXXXXXXXXXXXXXXXXXXXXVKEEDRDQNDGEDND 183
           +       R   +AK    D+E++                     V  ED+       ++
Sbjct: 118 I-------RDVLQAKLDSNDKEQNDITEERPQVTNSN--------VDTEDK-------SE 155

Query: 184 AQNGLVAXXXXXXXXXXXXXXXXXXXXPLNIPITESVEEP-VDISGDKKALWDLFTRYDL 242
           + N LV+                    P +I + E    P ++ +  +     L     L
Sbjct: 156 SSNILVSGYSSSSDDSGEESEVEEKNDPSSIDVKEEDTLPSLNNTEIESKFIQLLNEIQL 215

Query: 243 NPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAISGDQVEPVDEIK--SEDFDE 300
           +PYS W  + K+I  DP +  +  +  R+++F+ WC+  ++    +  +  +  +E+ DE
Sbjct: 216 DPYSTWSIQAKRIMHDPRYYLITSNDKRDELFQTWCSQQLNNSNNDNENNAQDSAENSDE 275

Query: 301 EED---LEPTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSFKKYNIKDFLTSKKDQESFV 357
           E+    LEPTKYHYLAHI+SK+NITP T+F +IK +NKS FK+  I   LT KK+QE F 
Sbjct: 276 EDSDVTLEPTKYHYLAHIISKANITPETLFSNIKKENKSLFKELEINKTLT-KKEQEQFA 334

Query: 358 SKLLFYYKRMKLEERKEVFVQLLKQNGK--TIEENLSNDMDKVRHCLAQEIDSNDPYAVE 415
           SK++ YYKRM   +R E+F +++K   +   I E LS         L  E   +D + +E
Sbjct: 335 SKVIAYYKRMDNLQRTELFKKMMKNKLRFPPISEKLSQ--------LMLEETPSDSFKLE 386

Query: 416 TKLFKMEKFMGLWGNLSD--LVEEPKYYILGIRDKMLELNDYLK 457
           T+L ++E  + +  NL +  +  E  YYILGI+DK+  L + L+
Sbjct: 387 TQLLQLENALLILDNLQNSYMQNEIMYYILGIKDKLAALKEILR 430

>SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 478

 Score =  192 bits (488), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 109/251 (43%), Positives = 149/251 (59%), Gaps = 28/251 (11%)

Query: 236 LFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAISGDQVEPVD-EIK 294
           LF +Y+L+PYS W F+ +KI  DPDF  V + S R+D+FE+WC   I+  +    D  I 
Sbjct: 230 LFDKYNLDPYSMWEFQSRKINKDPDFYLVTNGSSRKDLFEQWCTETIANSKDAISDANIN 289

Query: 295 SEDFDE-------------------------EEDLEPTKYHYLAHIVSKSNITPTTIFMD 329
             D D+                         +E+LEPT++HYL+HI+SKS+I  TTIF+D
Sbjct: 290 ENDADQRQESEATQKEEQEEKKEVEEDGEPDDENLEPTRFHYLSHIISKSSIEQTTIFLD 349

Query: 330 IKNDNKSSFKKYNIKDFLTSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIEE 389
           IK +NK+ FK + IK  L  KKDQE F SKLLFYYKRM LE+RK +F +LL      I  
Sbjct: 350 IKKENKALFKTFRIKSSL-KKKDQEDFASKLLFYYKRMDLEQRKLIFQKLLLSKLDIIRS 408

Query: 390 NLSNDMDKVRHCLAQEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDKM 449
           NL N ++K+R    ++    D YA+ET+L  ME  M + G LS L  E  YYILGI+DK 
Sbjct: 409 NLRN-VEKLRDIATEQSTPADSYAIETQLLMMEDCMDIHGKLSFLQGEVHYYILGIKDKT 467

Query: 450 LELNDYLKIYV 460
           ++L  +L+ + 
Sbjct: 468 IQLKQFLQKFT 478

 Score =  120 bits (300), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 89/152 (58%), Gaps = 10/152 (6%)

Query: 1   MARIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYH 60
           MA  W E+  P G KYYYN  TKQST  KP   D+    +  ++ +K++ KP   + L  
Sbjct: 1   MAPNWNEFTTPSGDKYYYNLETKQSTLEKPAGFDD----QKSRKRQKLQHKPKYLVPLDK 56

Query: 61  GWHLVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKNKLVALIGLARGYSPGGLHI 120
           GW LV+C+TG KFY+N  TNES W L D  S  L+  LDK KLV LIG++RGY     ++
Sbjct: 57  GWSLVLCNTGTKFYHNKITNESHWTLDDPCSIELLQQLDKEKLVLLIGISRGYYCPRRNV 116

Query: 121 YEELVTDLVKL------RQEREAKRAEGDQEK 146
           Y+E++ DL  L      +Q  E + A  D+E+
Sbjct: 117 YDEIINDLKFLKDKSLEKQGVEPEMARADEEQ 148

>Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to
           Ashbya gossypii AFR317C
          Length = 329

 Score =  176 bits (446), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 154/249 (61%), Gaps = 16/249 (6%)

Query: 220 VEEPVDIS----GDKKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFE 275
           + +P+D+      +      LF RY+LNPYS+W  + +K++ DP+F  +LDD  R ++FE
Sbjct: 73  ISKPLDVRVGYDSEHARFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFE 132

Query: 276 EWCAHAIS---GDQVEPVD----EIKSEDFDEEEDLEPTKYHYLAHIVSKSNITPTTIFM 328
           +WC   ++   GD    +     E + +D DE+E LEP K+HYL+HIVSKS I P T+F 
Sbjct: 133 DWCTMKLAKAGGDSSASLTGEEEEEEDDDDDEDESLEPVKFHYLSHIVSKSTIKPQTVFS 192

Query: 329 DIKNDNKSSFKKYNIKDFLTSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIE 388
           D+K +NK  FK +NI D    K++Q  FVS LLFYYK+   +ER E+F  LL    K   
Sbjct: 193 DVKTENKLLFKNFNI-DETHPKQEQRQFVSSLLFYYKKKSSKERVEIFKNLLDTKVK--- 248

Query: 389 ENLSNDMDKVRHCLAQEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDK 448
            +  N+ D+++  L QE   ND Y +E++L  MEK++G+  +L  L E+ KYY++G+RDK
Sbjct: 249 -HEINNEDQLQQILDQENLPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRDK 307

Query: 449 MLELNDYLK 457
            + + ++L+
Sbjct: 308 TILIKEFLR 316

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 19/32 (59%)

Query: 4  IWREYVAPDGRKYYYNAVTKQSTWHKPESLDE 35
          +W+     +G  YYY  V+ + TW +PE+ +E
Sbjct: 2  VWKRAKTGEGEFYYYETVSGEKTWERPETFEE 33

>AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR152C
          Length = 328

 Score =  173 bits (438), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 140/230 (60%), Gaps = 5/230 (2%)

Query: 228 GDKKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAISGDQV 287
           G K  LW LF R +L+PYSAW FE  KI  D  F  V DD  R+++FE+WCA  I+ D+ 
Sbjct: 95  GKKAELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARKIA-DEG 153

Query: 288 EPVDEIKSEDFDEEEDLEPTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSFKKYNIKDFL 347
             V  ++  +  EE +L PT++HYLAHIVSKS + P T++ D++ ++K  F +  +   +
Sbjct: 154 NAV--LEDGEEAEEVELVPTRFHYLAHIVSKSTVRPDTVYSDVRREHKELFDQLEVD--I 209

Query: 348 TSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIEENLSNDMDKVRHCLAQEID 407
             KK+Q  FV+ LLFYYK+M    R EVF +LL  +   I      +  ++R  L  +  
Sbjct: 210 LDKKEQRRFVAGLLFYYKKMDAALRGEVFRKLLHAHRAAITAAFLENDAQLRELLEYDEL 269

Query: 408 SNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDKMLELNDYLK 457
             D Y++ET LF +EK +GL G LS L  E KYY+LG++DK++ + + L+
Sbjct: 270 PQDSYSIETDLFIVEKCIGLHGALSKLQSEIKYYVLGVKDKLVVMKEVLR 319

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 29/44 (65%), Gaps = 1/44 (2%)

Query: 4  IWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMD-ENRGVKRFK 46
          +W+   + DG+ YYYN  T ++TW KP++++  D E RG +R +
Sbjct: 2  VWKRAKSEDGKAYYYNTETNETTWDKPDAVEPSDGEERGDERAR 45

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 62 WHLVICDTGKKFYYNVETNESAWNLPD 88
          W     + GK +YYN ETNE+ W+ PD
Sbjct: 3  WKRAKSEDGKAYYYNTETNETTWDKPD 29

>CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152c
          Length = 410

 Score =  173 bits (438), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 141/454 (31%), Positives = 227/454 (50%), Gaps = 71/454 (15%)

Query: 2   ARIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHG 61
           +++W+EY AP+G KYYYN  T+++TW KP++     E +     K+IE KP VA EL  G
Sbjct: 6   SKLWKEYTAPNGLKYYYNTKTQETTWTKPDT-----EQKDETADKEIEIKPLVAFELLAG 60

Query: 62  WHLVICDTGKKFYYNVETNESAWN--LPDEGSRNLIDALDKNKLVALIGLARGYS--PGG 117
           W L+I   G K YYN   NES W+  +       LID L+K++L+ LIG+ RGY      
Sbjct: 61  WALIIFSDGSKKYYNC--NESQWSRKISHPECLKLIDLLNKDRLLLLIGIIRGYRCRTNA 118

Query: 118 LHIYEELVTDLVKLRQEREAKRAEGDQEKDXXXXXXXXXXXXXXXXXXXXXVKEEDR--D 175
             +  E+  D+  +R++  A +   D +                        +E  +  +
Sbjct: 119 KDLVNEIREDIDFIREDMNAAKTSEDMKSGSTVNNLENTKNALLGYYSSDDEEEPAKRDE 178

Query: 176 QNDGEDNDAQNGLVAXXXXXXXXXXXXXXXXXXXXPLNIP-ITESVEEPVDISGDKKALW 234
           Q   E+ D  N L                         +P IT+ + + +     K + +
Sbjct: 179 QAVVEEPDETNTL------------------------EVPDITQELGQDI-----KDSYF 209

Query: 235 DLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAISGDQVEPVDEIK 294
            LF +++LN YS W  E +K+  DP+F +++DD+VRE++FEEWC    +   VE  +E  
Sbjct: 210 ALFAKHELNKYSTWRIESEKVSQDPEFYKIIDDAVRENIFEEWC----NAGSVESNEESG 265

Query: 295 SEDFDEEEDLEPTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSFKKYNIKDFLTSKKDQE 354
               D+    EPTKYHYL+ +V+  ++ P TI  +    +K   KKY IKD+ T+K +Q 
Sbjct: 266 DPGDDQ---FEPTKYHYLSQLVANYDLKPDTI-PEDIIKDKKLIKKYRIKDY-TTKSEQR 320

Query: 355 SFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIEENLSNDMDKVRHCLAQEIDSNDPYAV 414
            F+SK+L +YK M LE+RK++F   +               D++      +IDS+    V
Sbjct: 321 QFLSKMLAWYKHMSLEDRKQMFQTYI---------------DRIPVGKYTDIDSDAQEDV 365

Query: 415 ETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDK 448
           E++L ++E  +G+  + +DL    +YY + +R K
Sbjct: 366 ESQLLELENQLGIPTSENDL----EYYCIDLRSK 395

>Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]
           {ON} YPR152C - Hypothetical ORF [contig 189] FULL
          Length = 443

 Score =  170 bits (431), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 98/226 (43%), Positives = 150/226 (66%), Gaps = 6/226 (2%)

Query: 236 LFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAISG-DQVEPVDE-- 292
           LF++Y ++PYS W  + +KIRDDP F ++ +D+ R+++FE WC +  S   +V  +DE  
Sbjct: 217 LFSKYAVDPYSTWNMQSRKIRDDPLFYKITNDADRKELFENWCMNECSNQSEVPAIDEQI 276

Query: 293 IKSEDFDEEED-LEPTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSFKKYNIKDFLTSKK 351
           I S+D D   D LEP++YHYLAHIVSKS IT +T+  DI+ D K  FK++ IKD L SK+
Sbjct: 277 ISSDDEDPAIDSLEPSRYHYLAHIVSKSKITSSTLPKDIRTDQKELFKQFRIKDSL-SKR 335

Query: 352 DQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIEENLSNDMDKVRHCLAQEIDSNDP 411
           +Q++F+SKLLFYYKRM  E+R  +F + L+   K +++ L N  +++   L+      + 
Sbjct: 336 EQDAFLSKLLFYYKRMTPEQRIAIFKRFLEGKKKALKKGLKN-QERLSTILSTPSLPQEN 394

Query: 412 YAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDKMLELNDYLK 457
           YA+ET+L  +E  +   G+ + L E+ +YY+LGI+DK + L D LK
Sbjct: 395 YAIETQLLILEDCIDTHGSNAFLQEDVQYYVLGIKDKTVALRDILK 440

>KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 462

 Score =  162 bits (411), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 90/238 (37%), Positives = 143/238 (60%), Gaps = 10/238 (4%)

Query: 228 GDKKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAISGDQV 287
             K+    LF  YDL+PYS W  + KKI D+P F +V  D+ R ++FE+WC   +  + V
Sbjct: 221 ATKQMFTSLFDEYDLDPYSTWNMQSKKICDNPLFYQVASDAERRELFEDWCVAKVKLEDV 280

Query: 288 --EPVDEI------KSEDFDEEEDLEPTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSFK 339
             +P  +         +D    ++LEPT+YHYLAHIVSK+ + P+T+  D++++ K  FK
Sbjct: 281 IEDPAHQAVSSDGDGDDDDTSTDELEPTRYHYLAHIVSKAEVAPSTLPRDLRSEQKQLFK 340

Query: 340 KYNIKDFLTSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIEENLSNDMDKVR 399
           ++ IK+ L  KK Q+ F+SKLLFYYK M  E+R EV V+ LK   K I +   N ++++ 
Sbjct: 341 QFKIKESL-GKKQQDEFLSKLLFYYKNMTEEQRLEVLVKFLKTRRKLIMKGFRN-IEQLE 398

Query: 400 HCLAQEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDKMLELNDYLK 457
             L+Q+      +A+E++L ++E  + + G    L +E +YY+LGI+ K   L ++LK
Sbjct: 399 SVLSQQDLPTSGFAIESQLLRLEDCIDIHGVSKALQDEVQYYVLGIKQKTTALKEFLK 456

 Score =  113 bits (283), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 55/135 (40%), Positives = 80/135 (59%), Gaps = 2/135 (1%)

Query: 1   MARIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYH 60
           M R WREY  PDG KYYYN  TK+ST  KP+  +E    R   R  +++      + L +
Sbjct: 6   MPRYWREYKTPDGTKYYYNVNTKRSTTDKPDDFEESQSFRSKSR--RVDPGVTFVVPLSN 63

Query: 61  GWHLVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKNKLVALIGLARGYSPGGLHI 120
            W L +C+ G++F+Y   T ES W++ DE S  ++  +DKNKLV L+  ARG+  G   +
Sbjct: 64  DWVLSVCENGQRFFYKSSTEESRWDIEDEESLRILSLVDKNKLVLLLATARGFDIGERDV 123

Query: 121 YEELVTDLVKLRQER 135
           Y+EL+ D+  L+Q R
Sbjct: 124 YQELLEDINNLKQSR 138

>KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {ON}
           Anc_3.498 YPR152C
          Length = 409

 Score =  160 bits (406), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 103/230 (44%), Positives = 136/230 (59%), Gaps = 15/230 (6%)

Query: 226 ISGDKKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCA-HAISG 284
           +SGDK    +LF RY L+ +S W  EM K+  DPDF  V DD  RED+FE WC+   I  
Sbjct: 183 LSGDKAKFMELFDRYGLDKFSEWSMEMNKVSKDPDFYLVTDDQEREDLFERWCSGQGIHS 242

Query: 285 DQVEPVDEIKSEDFDEEEDLEPTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSFKKYNIK 344
              E   E    +  EE  LEPTK+HYL+ IVSKS I  TTIF DIK  NK  FK+Y IK
Sbjct: 243 TSDEEAKEGGEPEEHEERPLEPTKFHYLSQIVSKSEIRRTTIFQDIKRQNKRLFKEYKIK 302

Query: 345 DFLTSKKDQESFVSKLLFYYKRM-KLEERKEVFVQLLKQNGKTIEENLSNDMDKVRHCLA 403
           DF+ S K+QE FVSKLLFYYK   ++E+R + F   L++  K       +DM+     L+
Sbjct: 303 DFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQFNDFLRE--KNANYTSMSDMN----TLS 356

Query: 404 QEIDSNDPYAVETKLFKMEKFMGLWGNL-SDLVEEPKYYILGIRDKMLEL 452
           + I  ND YA+ET L ++E       N   D++ + +YYIL ++ K +EL
Sbjct: 357 EHIKRNDTYAIETTLLQIE------CNFPQDVLSDVRYYILDLKQKTIEL 400

 Score =  107 bits (266), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 86/150 (57%), Gaps = 20/150 (13%)

Query: 1   MARIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYH 60
           M +IW+EY AP+G+KYYYN  TK++TW KPE+             K+ E +P   + L +
Sbjct: 1   MNKIWKEYRAPNGKKYYYNTETKKTTWEKPEAA------------KREEIEPVFVIRLMN 48

Query: 61  GWHLVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKNKLVALIGLARGYSPGGLH- 119
            W LVIC+ G K+Y + E NE    L DE S  LI+  DK KLV LIG+ARGY+   +  
Sbjct: 49  DWKLVICNNGMKYYLDNE-NEPTKELSDEESLRLIELFDKEKLVCLIGIARGYAIENVEK 107

Query: 120 IYEELVTDL------VKLRQEREAKRAEGD 143
           IY  +V ++      +K  QER  K AE +
Sbjct: 108 IYGNIVEEVEFLKEDMKNEQERLKKEAESE 137

>KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa]
           {ON} Anc_3.498 YPR152C
          Length = 388

 Score =  155 bits (393), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 92/236 (38%), Positives = 133/236 (56%), Gaps = 27/236 (11%)

Query: 223 PVDISGDKKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAI 282
           P D   ++ + ++LF+ Y L+ YS W  E  KI +DP F  + DD  RE++FEEWC   +
Sbjct: 175 PPDTDANRISYFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCCSGV 234

Query: 283 SGDQVEPVDEIKSEDFDE-EEDLEPTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSFKKY 341
                  VD+ + E +   ++DL PTKYHYL+ IV+KS +TPTTIF DIK +  S FK+Y
Sbjct: 235 -------VDDSEDEGYSSGDDDLSPTKYHYLSQIVAKSTVTPTTIFQDIKQEKASLFKQY 287

Query: 342 NIKDFLTSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQN-GKTIEENLSNDMDKVRH 400
            IK FL SK++QE FVS+LLFYYK+  LEER ++F + + ++   T+    S        
Sbjct: 288 GIKQFL-SKREQEQFVSQLLFYYKKFTLEERVQLFTKFIAESRTGTVPSPTS-------- 338

Query: 401 CLAQEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDKMLELNDYL 456
                 DS  P  +ET L +ME  +        +++   YY L I+ K   L+  L
Sbjct: 339 ----PADSATPEDIETNLLQMESHLP-----PTVLDNTVYYTLDIKTKQSVLHRML 385

 Score = 93.2 bits (230), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 81/148 (54%), Gaps = 11/148 (7%)

Query: 1   MARIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYH 60
           M  +WREY AP+G+KYY+N  T ++TW  P +          K  +++  KP   + L +
Sbjct: 1   MKSVWREYRAPNGKKYYHNTTTGETTWDSPYTR---------KPQRELSIKPQYVIPLLN 51

Query: 61  GWHLVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKNKLVALIGLARGY-SPGGLH 119
            W+LVIC+ G KFY N +  +    L D  S  L+  +D+ KL+ LIG+ARGY    G  
Sbjct: 52  AWNLVICNNGAKFYLNPD-GDPVLTLDDADSSELLSLVDREKLILLIGVARGYHCTSGDK 110

Query: 120 IYEELVTDLVKLRQEREAKRAEGDQEKD 147
           +Y  ++ ++  L+ +    +A   +E++
Sbjct: 111 VYNSVLEEISFLKDDLANDKAPLAEERE 138

>Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {ON}
           YPR152C (REAL)
          Length = 452

 Score =  156 bits (394), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 93/229 (40%), Positives = 138/229 (60%), Gaps = 15/229 (6%)

Query: 227 SGD---KKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAIS 283
           SGD   +   + L  RY+L+ +S W  + KKI +DPDF +V D +VRE +FEEWCA A +
Sbjct: 204 SGDVNERGLFFQLCDRYELDKFSTWSLQCKKIENDPDFYKVGDAAVRESLFEEWCASASA 263

Query: 284 GDQVEPVDEIKSEDFDEEEDLEPTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSFKKYNI 343
                     +SED D+ + LEPTK+HYLA IV+K+ I P  I  DI+   K+ FK Y I
Sbjct: 264 SASGN-----ESEDEDDADLLEPTKFHYLAQIVAKAEIAPDCIPQDIRKQQKALFKAYRI 318

Query: 344 KDFLTSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIE---ENLSNDMDKVRH 400
           K+++ SK+DQ+ FVS+LLFYYK   LE+RKE+F + L+ + +      ++L  D+  +  
Sbjct: 319 KEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIFQECLRDHERDFACAVQSLRQDVGLISR 378

Query: 401 CLA-QEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDK 448
             A     + D  +VE  L  +E   G+ G ++  + +P+YY+LGI DK
Sbjct: 379 WQAILRPTAADGASVEDALLSIEHRCGV-GAIA--LADPRYYVLGILDK 424

 Score =  103 bits (257), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 49/114 (42%), Positives = 75/114 (65%), Gaps = 4/114 (3%)

Query: 4   IWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWH 63
           +W+E+  P G++Y+YN  TK+S W KP+   +    +   +  ++E KP  ALEL   WH
Sbjct: 6   VWQEFKTPAGKRYFYNKNTKESRWDKPD-FKKASGAQDRAKVAQVERKPMFALELIDDWH 64

Query: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRN---LIDALDKNKLVALIGLARGYS 114
           L+IC+ G KFYYN E+N S + + +EG+     L+++LDK KL+ LIG+ARGY+
Sbjct: 65  LIICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYN 118

>YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON}
           URN1Putative protein of unknown function containing WW
           and FF domains; overexpression causes accumulation of
           cells in G1 phase
          Length = 465

 Score =  154 bits (389), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 89/229 (38%), Positives = 136/229 (59%), Gaps = 14/229 (6%)

Query: 229 DKKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAISGDQVE 288
           ++   ++LF RY L+ +S W  + KKI +DPDF ++ DD+VRE +FEEWC    SG+   
Sbjct: 215 ERNIFFELFDRYKLDKFSTWSLQSKKIENDPDFYKIRDDTVRESLFEEWCGER-SGNATA 273

Query: 289 PVDEIKSEDFDEEEDLEPTKYHYLAHIVSKS-NITPTTIFMDIKNDNKSSFKKYNIKDFL 347
              + +    D+ E LEPTKYHYLA IV+ +  I P TI  DI+   K+ +K Y IK+++
Sbjct: 274 EESDSEDNSEDDSEVLEPTKYHYLAQIVANAGTIAPDTIPQDIRKQQKALYKAYKIKEYI 333

Query: 348 TSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIE---ENLSND---MDKVRHC 401
            SK+DQ+ FVS+LLFYYK   LE+RKE+F   L+ + +      E+L  D   +D+ +  
Sbjct: 334 PSKRDQDKFVSQLLFYYKTFDLEQRKEIFCDCLRDHERDFTGAVESLRQDKELIDRWQTL 393

Query: 402 LAQEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDKML 450
           L    DS+   ++E  L  +E    +      +V EP+YY++GI +K +
Sbjct: 394 LKAPADSS---SIEDILLSIEHRCCV---SPIVVTEPRYYVVGILEKTV 436

>Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {ON}
           YPR152C (REAL)
          Length = 456

 Score =  141 bits (356), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 84/228 (36%), Positives = 128/228 (56%), Gaps = 14/228 (6%)

Query: 228 GDKKALW-DLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAISGDQ 286
            D++ L+  LF RY+L+ +S W  + KKI +DPDF  + DD+VRE  FEEWC H  S   
Sbjct: 209 ADERGLFFRLFDRYELDKFSTWSLQSKKIENDPDFYTIGDDAVREGFFEEWCGHEHSDSA 268

Query: 287 VEPVDEIKSEDFDEEEDLEPTKYHYLAHIVSKSN-ITPTTIFMDIKNDNKSSFKKYNIKD 345
               +   SED  +   LEPTKYHYLA I++K+  I P  +  DI+   K  +K Y IK+
Sbjct: 269 A--AEASGSEDVGDV--LEPTKYHYLAQILAKAGTIPPDAVPQDIRKQQKELYKAYRIKE 324

Query: 346 FLTSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIE---ENLSNDMDKVRHCL 402
           ++ SK++Q+ FVS+LLFYYK   LE+RKE+F   L+ + +      +++  +   +    
Sbjct: 325 YVPSKREQDKFVSQLLFYYKTFSLEQRKEIFQDCLRDHERDFAGAVKSIRRESGLISQWQ 384

Query: 403 AQEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDKML 450
           A      D  +VE  L  +E    +      +  +P+YY++GI DK +
Sbjct: 385 AVLEAPADGASVEEVLLNIEYRCNIV-----VAADPRYYVVGILDKTM 427

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/114 (43%), Positives = 69/114 (60%), Gaps = 6/114 (5%)

Query: 4   IWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWH 63
           +W+E+  P G +YYYN  TKQS W  P+      +   V++  ++E KP  +LEL   WH
Sbjct: 1   MWQEFKTPAGIRYYYNKKTKQSQWENPD-FKIFSDQENVEKALRMERKPTFSLELIDAWH 59

Query: 64  LVICDTGKKFYYNVET----NESAWNLPDEGSRNLIDALDKNKLVALIGLARGY 113
           LVIC+ G KFYYN ++    NE +    D     L+++LDK KLV LIG+ARGY
Sbjct: 60  LVICNDGTKFYYNSDSKVFKNEISQE-SDSQCSALVESLDKEKLVLLIGVARGY 112

>Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {ON}
           YPR152C (REAL)
          Length = 460

 Score =  138 bits (348), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 85/232 (36%), Positives = 129/232 (55%), Gaps = 18/232 (7%)

Query: 224 VDISGDKKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAIS 283
           +D   ++   + L  RY L+ +S W  + KKI +DP+F ++ DD+VRE +FEEWC     
Sbjct: 213 IDEGRERSLFFQLCDRYKLDKFSTWSLQSKKIENDPEFYKIRDDTVREGLFEEWC----- 267

Query: 284 GDQVEPVDEIKSEDFDEEEDLEPTKYHYLAHIVSKS-NITPTTIFMDIKNDNKSSFKKYN 342
               E     +S+  DE   LEPTKYHYLA IV+K+ NI P  I  DI+   K+ +K Y 
Sbjct: 268 ----EKHSAKESDSEDESNVLEPTKYHYLAQIVAKAGNIAPDAIPQDIRKRQKALYKAYR 323

Query: 343 IKDFLTSKKDQESFVSKLLFYYKRMKLEERKEVFVQLL----KQNGKTIEENLSNDMDKV 398
           IK+++  K++Q+ FVS+LLFYYK   LE+RK +F   L    +  G  I  +L  D   +
Sbjct: 324 IKEYVPLKREQDRFVSQLLFYYKTFNLEQRKTIFQDCLWDHERDFGGAI-ASLRQDNKLI 382

Query: 399 RHCLAQEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDKML 450
               A   D  D  ++E  L  +E    +    + +V +P+YY++GI +K +
Sbjct: 383 SRWQALLEDPIDGTSIEDVLLSIENRCCV---SAIVVADPRYYVVGILEKTV 431

>NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {ON}
           Anc_3.498 YPR152C
          Length = 413

 Score =  105 bits (263), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 73/226 (32%), Positives = 121/226 (53%), Gaps = 20/226 (8%)

Query: 230 KKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAISGDQVEP 289
           K  L+ LF  ++L+ YS W  + +KI +  D+  V DD+ RE++FE+WCA  ++  Q+  
Sbjct: 187 KDRLFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKVA--QLPE 244

Query: 290 VDEIKSEDFDEEEDLEPTKYHYLAHIVS--KSNITPTTIFMDIKNDNKSSFKKYNIKDFL 347
            +         ++D EPTKYHYL+ I+   +  I   T+  DI   ++  FK+Y+IK F+
Sbjct: 245 DESEAE-----DDDYEPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQYHIKQFI 299

Query: 348 TSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQN-GKTIEENLSNDMDKVRHCLAQEI 406
             +++  + VS+LLFYYKR    ER+ VF   + Q  G    E++ ND          + 
Sbjct: 300 PDRRELRAVVSRLLFYYKRFTARERRAVFHDYVSQRYGLLPGEDVDND----------DA 349

Query: 407 DSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDKMLEL 452
            S     +ET++ + E+     GN S      +YY++G+R+K + L
Sbjct: 350 GSLSGEQMETRILQWERDRQTEGNSSWDPTALEYYVVGLREKYIGL 395

 Score = 88.2 bits (217), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 80/143 (55%), Gaps = 21/143 (14%)

Query: 2   ARIWREYVAPDGRKYYYNAVTKQSTWHKP--ESLDEMDENRGVKRFKKIESKPHVALELY 59
            ++WREY AP+GRKYYYN  TK++TW KP  E   E  +N+ VK           A EL+
Sbjct: 4   GKLWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVK----------FAFELF 53

Query: 60  HGWHLVICDTGKKFYYNVETNESAW-----NLPDEGSRNLIDALDKNKLVALIGLARGYS 114
            GW+L+I   G K +Y+   NE ++         E +  +I+ +DK K++ LIG+ RG+ 
Sbjct: 54  DGWYLLIRGDGGKLFYD-SVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFR 112

Query: 115 PGGLHI---YEELVTDLVKLRQE 134
               HI   Y+++  D+  L+QE
Sbjct: 113 DDRYHIKGVYDDIAQDINFLKQE 135

>NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa]
           {ON} Anc_3.498 YPR152C
          Length = 522

 Score =  100 bits (249), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 59/145 (40%), Positives = 86/145 (59%), Gaps = 15/145 (10%)

Query: 3   RIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKR-----FKKIESKPHVALE 57
           RIW+EY  P+G+KYYYN  TKQSTW KP S  + ++N    +       +IE+K   A +
Sbjct: 10  RIWKEYKTPNGKKYYYNIETKQSTWEKPFSFYKTNKNNSNTKALGQTHHEIENK--FAFK 67

Query: 58  LYHGWHLVICDTGKKFYYNVETNESAWNLPDEG-----SRNLIDALDKNKLVALIGLARG 112
           L + W+L++   G KFYYN  +N S   L ++      S +L+  LDKN L+ LIGL RG
Sbjct: 68  LLNEWYLILRSDGSKFYYNARSNRSVLKLVEDKEDEKLSFDLMKYLDKNNLIKLIGLIRG 127

Query: 113 YSPGGLHI---YEELVTDLVKLRQE 134
           Y+   + I   YEE+V ++  L+Q+
Sbjct: 128 YNDPSIDIKGLYEEIVANIGFLKQD 152

 Score = 99.4 bits (246), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 77/252 (30%), Positives = 132/252 (52%), Gaps = 29/252 (11%)

Query: 230 KKALWDLFTRYDLNPYSAWPFEMKKIRDDPD-FLRVLDDSVREDVFEEWCAHAISGDQVE 288
           K+A ++L  +  L+ YS W  + ++I + P  F  + +DS RE++FE+WC + +    + 
Sbjct: 256 KQAFFELLDKNKLDMYSTWSVQSRRIIERPTIFYSISNDSEREEIFEDWCRNRVHSTGLY 315

Query: 289 PVDEIKSEDFD--------EEED-----------LEPTKYHYLAHIVSK--SNITPTTIF 327
             +  ++ D D        EEED           LEPTKYHYL+ ++ K   +I   +IF
Sbjct: 316 SSNVKENNDGDTLVRGSYYEEEDKDDDDDDDDDDLEPTKYHYLSELIFKLRDSINERSIF 375

Query: 328 MDIKNDNKSSFKKYNIKDFLTSKKDQESFVSKLLFYYKRMKLEERKEVFVQ-LLKQNGKT 386
            DIK   KS FK Y IKD++  KK+ E  VS LLFYYK++  +ER + F + + K  G+ 
Sbjct: 376 QDIKRQGKSLFKDYRIKDWIPDKKELEKTVSLLLFYYKKLSEQERCDKFQEYVTKHYGEK 435

Query: 387 IEENLSNDMDKVRHCLAQEIDSNDPYAVETKLFKMEKFMGLWGN----LSDLVEEP--KY 440
           I+ +       +    + + ++     +E ++ ++E  +   G+    ++  V+ P  +Y
Sbjct: 436 IKLHHEELNKILEPSSSADAEAEADVDIEKEILQIENVILRSGDDHVPVTAAVDTPGLEY 495

Query: 441 YILGIRDKMLEL 452
           YI+G+R K   L
Sbjct: 496 YIIGLRAKHSAL 507

>TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.498
           YPR152C
          Length = 276

 Score = 76.3 bits (186), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 105/234 (44%), Gaps = 42/234 (17%)

Query: 216 ITESVEEPVDISGDKKA-LWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVF 274
           + E ++   D  G+K+   ++L  R +++ YS W  E KKI DDP F  +  D  RE +F
Sbjct: 57  LLEDIDASEDEIGNKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLF 116

Query: 275 EEWCAHAISGDQVEPVDEIKSEDFDEEEDLEPT-----KYHYLAHIVSKSNITPTTIFMD 329
           E+WC   +                 EEE  +P       YH LA ++   +I   TI+ D
Sbjct: 117 EQWCYGKLHS--------------REEETTQPQLALALPYHDLAEMICCFDIQSNTIYKD 162

Query: 330 IKNDNKSSFKKYNIKDFLTSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIEE 389
           I+  NK   ++ + K    SK +QE F +KLL   K       + +F Q+L++NG     
Sbjct: 163 IRKANKKMVRQIDEK---ISKNEQEKFGTKLLGILKYHDDASCQGLFEQVLEENG----- 214

Query: 390 NLSNDMDKVRHCLAQEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYIL 443
                +D+V        D N  +     L  +E+ MG+    S +  + +Y+ L
Sbjct: 215 -----VDRV--------DVNTSFETLADLVDLERRMGITTENS-VSRDARYFCL 254

>TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa] {ON}
           Anc_2.649 YKL012W
          Length = 658

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 54/109 (49%), Gaps = 8/109 (7%)

Query: 1   MARIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKR---FKKIESKPHVALE 57
           M   W++   P GR YYYN  TK+S W  P+S    +++   ++    KK E K  + LE
Sbjct: 1   MENDWKQAKDPKGRVYYYNLKTKESRWDLPKSSTGTNKSISTEKQVSVKKNELKNKIDLE 60

Query: 58  L--YHGWHLVICDTGKKFYYNVETNESAW---NLPDEGSRNLIDALDKN 101
               HGW       G+ +YYNV+T ES W   NLP   S    D + KN
Sbjct: 61  FLKLHGWRTAQTKEGRIYYYNVDTKESRWDPPNLPKNTSLKNADDIIKN 109

>Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar to
          Ashbya gossypii ADR159C
          Length = 575

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 17/83 (20%)

Query: 5  WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWHL 64
          W+E + P+GR YYYN+   ++TWHKP+ ++ + +                A+ L  GW +
Sbjct: 4  WKETIDPEGRVYYYNS-KGETTWHKPKEMEVVLD----------------AILLKQGWKV 46

Query: 65 VICDTGKKFYYNVETNESAWNLP 87
             + GK +YYN  TNES W LP
Sbjct: 47 ASTEDGKVYYYNKNTNESTWELP 69

>KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649
          YKL012W
          Length = 556

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 40/85 (47%), Gaps = 18/85 (21%)

Query: 5  WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWHL 64
          W+    P GR YYYN VTK+STW KP++  E D+                     + W  
Sbjct: 4  WKAAKDPKGRIYYYNTVTKKSTWEKPKNFAEPDQPSA------------------NDWKT 45

Query: 65 VICDTGKKFYYNVETNESAWNLPDE 89
               GK +YYNV+T ES W LP E
Sbjct: 46 GKTKDGKTYYYNVKTRESRWTLPPE 70

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 2  ARIWREYVAPDGRKYYYNAVTKQSTWHKPESL--DEMDENRGVKRFKKI 48
          A  W+     DG+ YYYN  T++S W  P  +  +E +E R  K  +KI
Sbjct: 40 ANDWKTGKTKDGKTYYYNVKTRESRWTLPPEMKQEEKEEARPNKDSEKI 88

>Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012W
          (REAL)
          Length = 579

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 42/84 (50%), Gaps = 16/84 (19%)

Query: 4  IWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWH 63
          IW+E    +GR YYYN++TK+STW KP+ L   +E                 L   +GW 
Sbjct: 3  IWKEAKDANGRVYYYNSLTKKSTWEKPKELVSEEEQ----------------LLRENGWR 46

Query: 64 LVICDTGKKFYYNVETNESAWNLP 87
                GK +YYN  T E++W +P
Sbjct: 47 AAKTKEGKVYYYNPATRETSWTIP 70

>KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON}
          similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 571

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 42/83 (50%), Gaps = 17/83 (20%)

Query: 5  WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWHL 64
          W+E   P GR YYYN  T Q+TW KPE L           F + E K      L +GW  
Sbjct: 3  WQETKDPQGRVYYYND-TGQTTWEKPEEL-----------FTEFERKL-----LKYGWKT 45

Query: 65 VICDTGKKFYYNVETNESAWNLP 87
           + + G+ +YY  +T E+ WN+P
Sbjct: 46 ALAEDGRVYYYKSDTGETTWNVP 68

>YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1
          snRNP protein involved in splicing, interacts with the
          branchpoint-binding protein during the formation of the
          second commitment complex
          Length = 583

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 40/84 (47%), Gaps = 16/84 (19%)

Query: 4  IWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWH 63
          IW+E     GR YYYN +TK+STW KP+ L   +E                 L   +GW 
Sbjct: 3  IWKEAKDASGRIYYYNTLTKKSTWEKPKELISQEE----------------LLLRENGWK 46

Query: 64 LVICDTGKKFYYNVETNESAWNLP 87
                GK +YYN  T E++W +P
Sbjct: 47 AAKTADGKVYYYNPTTRETSWTIP 70

>KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 564

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 43/83 (51%), Gaps = 16/83 (19%)

Query: 5  WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWHL 64
          W+E    +GR YYYNA + ++TW KP  L           F ++E K    LE  HGW  
Sbjct: 4  WKEANDAEGRVYYYNADSGETTWDKPREL-----------FTQLELK----LE-KHGWKT 47

Query: 65 VICDTGKKFYYNVETNESAWNLP 87
             D G+ +YYN ET +S W +P
Sbjct: 48 GKTDEGQVYYYNQETGKSCWEIP 70

>Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON}
          (4004..5596) [1593 nt, 531 aa]
          Length = 530

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 43/96 (44%), Gaps = 16/96 (16%)

Query: 1  MARIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYH 60
          M+ IW+E    +GR YYYN+ T +S W KP       E    K                +
Sbjct: 1  MSDIWKEAKDNNGRVYYYNSKTGESRWEKPVEAPSKQEQLLKK----------------N 44

Query: 61 GWHLVICDTGKKFYYNVETNESAWNLPDEGSRNLID 96
          GW +     GK +YYN +T ES+W LP      +ID
Sbjct: 45 GWSIGKSKAGKIYYYNTKTGESSWELPKFDEVKIID 80

>Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012W
          (REAL)
          Length = 583

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 38/83 (45%), Gaps = 16/83 (19%)

Query: 5  WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWHL 64
          W+E    +GR YYYN +TK+STW KP  L    E                 L   +GW  
Sbjct: 4  WKEAKDANGRVYYYNTLTKKSTWEKPTQLVSKQEQ----------------LLQENGWRA 47

Query: 65 VICDTGKKFYYNVETNESAWNLP 87
               GK +YYN  T +++W +P
Sbjct: 48 AKTAEGKVYYYNTTTRKTSWAIP 70

>ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 570

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 36/85 (42%), Gaps = 16/85 (18%)

Query: 4  IWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWH 63
          +W+E     GR YYYNA T +S W KP  L    E    K                HGW 
Sbjct: 6  LWKEAKDTSGRIYYYNAKTGESKWEKPRELLSEQELILAK----------------HGWK 49

Query: 64 LVICDTGKKFYYNVETNESAWNLPD 88
                GK +YYN +T  S W LPD
Sbjct: 50 SSKTSDGKLYYYNAQTKTSRWELPD 74

>Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012W
          (REAL)
          Length = 585

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 38/83 (45%), Gaps = 16/83 (19%)

Query: 5  WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWHL 64
          W+E    +GR YYYN +TK+S W KPE L    E                 L   +GW  
Sbjct: 4  WKEAKDANGRVYYYNTLTKKSIWEKPEELVSQQEQ----------------LLQENGWKA 47

Query: 65 VICDTGKKFYYNVETNESAWNLP 87
               GK +YYN  T +++W +P
Sbjct: 48 AKTAEGKIYYYNPSTRQTSWTIP 70

>NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON}
          Anc_2.649
          Length = 604

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 43/84 (51%), Gaps = 10/84 (11%)

Query: 5  WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWHL 64
          WR     +GR YYYN  TK+S W +P S++    N         +    + LE   GW  
Sbjct: 11 WRSAKDANGRTYYYNINTKESRWDRPASMEGSTNN---------DDSDKMLLEQI-GWKS 60

Query: 65 VICDTGKKFYYNVETNESAWNLPD 88
           + + GK +YYN++T ES W++ D
Sbjct: 61 NVTNEGKVYYYNLKTGESRWDVND 84

>CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012w PRP40 splicing factor
          Length = 590

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 43/88 (48%), Gaps = 18/88 (20%)

Query: 1  MARIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELY- 59
          MA  W++    +G+ YYYN VTK+S W KP                 +E    +  +L  
Sbjct: 1  MAGQWKKATDSNGKVYYYNTVTKESRWDKP-----------------VEDTTDLKQKLRD 43

Query: 60 HGWHLVICDTGKKFYYNVETNESAWNLP 87
           GW++     GK +YYNV+T ES W+ P
Sbjct: 44 AGWNVAKTKEGKVYYYNVKTKESRWDNP 71

>Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W
           (PRP40) - U1 snRNP protein [contig 244] FULL
          Length = 562

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 50/101 (49%), Gaps = 16/101 (15%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWHL 64
           W E   P+GR YYYN+ + ++TW KP               +++ S+  + LE  HGW  
Sbjct: 4   WNEAHDPEGRVYYYNSESGETTWDKP---------------RELYSELELQLE-KHGWKT 47

Query: 65  VICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKNKLVA 105
              + GK +YYN  + ES W +P   S    +A++  + VA
Sbjct: 48  GETEGGKLYYYNESSGESRWEVPTFESDEKEEAVESTQEVA 88

>SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 568

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 36/83 (43%), Gaps = 16/83 (19%)

Query: 5  WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWHL 64
          W+E     GR YYYN  T ++TW KP+ L    E R                 L HGW +
Sbjct: 6  WKEAKDLQGRIYYYNTATSETTWTKPQELYSELERRL----------------LAHGWKV 49

Query: 65 VICDTGKKFYYNVETNESAWNLP 87
                + +YYN  + ES W LP
Sbjct: 50 GSTAGKQTYYYNEASGESRWELP 72

>NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa]
           {ON} Anc_2.649 YKL012W
          Length = 647

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 41/94 (43%), Gaps = 13/94 (13%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESL------------DEMDENRGVKRFKKIESKP 52
           WR      GR YYYN +TK+S W KP+ L                     K   KIE   
Sbjct: 14  WRSAKDAKGRIYYYNLITKESKWEKPKELLPITAATSTTVRTSTISTNNAKTNIKIEKDD 73

Query: 53  HVALELYHGWHLVICDTGKKFYYNVETNESAWNL 86
              +E   GW   +   GK +YYN++T ES W++
Sbjct: 74  ASIMENI-GWKSNVTADGKTYYYNLKTGESRWDI 106

>TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa]
          {ON} Anc_2.649 YKL012W
          Length = 570

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 36/83 (43%), Gaps = 16/83 (19%)

Query: 5  WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWHL 64
          W+E +   GR YYYNA   +S W KP+ L   +E                 + L HGW  
Sbjct: 7  WKEALDDKGRTYYYNAKNGESRWEKPQELFTEEE----------------LVLLKHGWKS 50

Query: 65 VICDTGKKFYYNVETNESAWNLP 87
               GK +YYN  T ES W  P
Sbjct: 51 SRTAEGKIYYYNSITKESRWEKP 73

>KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON}
          Anc_2.649 YKL012W
          Length = 606

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 5/88 (5%)

Query: 5  WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDEN---RGVKRFKKIE--SKPHVALELY 59
          W +   P GR YY+N  T++S W KP   +  D+     G    KK+E  ++      + 
Sbjct: 4  WEQARDPQGRVYYFNRETRKSQWEKPAEWEVTDDGAVAAGGAPTKKVEKATQGSSGEPVK 63

Query: 60 HGWHLVICDTGKKFYYNVETNESAWNLP 87
            W       GK ++YN  T +S+W LP
Sbjct: 64 GTWKSAKTKDGKVYFYNSATGKSSWTLP 91

>TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa]
          {ON} Anc_2.649 YKL012W
          Length = 583

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 35/84 (41%), Gaps = 18/84 (21%)

Query: 4  IWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWH 63
          +WR     +G+ YYYN  T  S W KP          GV     IE+         HGW 
Sbjct: 6  LWRTAKDSNGKVYYYNTKTGVSQWEKP----------GVS--ADIETLKQ------HGWG 47

Query: 64 LVICDTGKKFYYNVETNESAWNLP 87
          +     GK +YYN  T ES W  P
Sbjct: 48 VARTKDGKLYYYNSSTGESRWEAP 71

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 4/51 (7%)

Query: 5  WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKK-IESKPHV 54
          W      DG+ YYYN+ T +S W  P+  D   E   V R KK + S+P V
Sbjct: 46 WGVARTKDGKLYYYNSSTGESRWEAPKFEDATTE---VSRGKKEVRSEPEV 93

>ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YKL012W
          (PRP40)
          Length = 569

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 17/84 (20%)

Query: 5  WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWHL 64
          W+E     GR YYYN+   +++W+KP                 +E +P +      GW +
Sbjct: 4  WKEAQDSTGRVYYYNS-KGETSWNKPND-------------TPVELEPRLE---ECGWKV 46

Query: 65 VICDTGKKFYYNVETNESAWNLPD 88
             + G  +YYN ET ES W  P+
Sbjct: 47 ATTEDGNVYYYNRETGESRWEKPE 70

>Kpol_1031.39 s1031 (93761..96208) [2448 bp, 815 aa] {ON}
           (93761..96208) [2448 nt, 816 aa]
          Length = 815

 Score = 38.1 bits (87), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVAL-ELYHGWH 63
           W +   P+GR Y+ +  T+ +TW  P     +           I+ +P   L  L  GW 
Sbjct: 343 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTN--TTIQQQPVSQLGPLPSGWE 400

Query: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKN 101
           + + +T + ++ +  T  + W+ P      L  +LD+N
Sbjct: 401 MRLTNTARVYFVDHNTKTTTWDDP-----RLPSSLDQN 433

>SAKL0H24552g Chr8 (2129859..2132231) [2373 bp, 790 aa] {ON} highly
           similar to uniprot|P39940 Saccharomyces cerevisiae
           YER125W RSP5 Ubiquitin-protein ligase involved in
           ubiquitin-mediated protein degradation plays a role in
           heat shock element (HSE)-mediated gene expression and
           multivesicular body sorting contains a hect (homologous
           to E6-AP carboxyl terminus) domain
          Length = 790

 Score = 37.7 bits (86), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVAL-ELYHGWH 63
           W +   P+GR Y+ +  T+ +TW  P     +           I+ +P   L  L  GW 
Sbjct: 318 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTN--TTIQQQPVSQLGPLPSGWE 375

Query: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKN 101
           + + +T + ++ +  T  + W+ P      L  +LD+N
Sbjct: 376 MRLTNTARVYFVDHNTKTTTWDDP-----RLPSSLDQN 408

>TDEL0F00990 Chr6 complement(173710..176079) [2370 bp, 789 aa] {ON}
           Anc_8.134 YER125W
          Length = 789

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVAL-ELYHGWH 63
           W +   P+GR Y+ +  T+ +TW  P     +           I+ +P   L  L  GW 
Sbjct: 317 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPAS--TTIQQQPVSQLGPLPSGWE 374

Query: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKN 101
           + + +T + ++ +  T  + W+ P      L  +LD+N
Sbjct: 375 MRLTNTARVYFVDHNTKTTTWDDP-----RLPSSLDQN 407

>KLLA0E13575g Chr5 (1198133..1200592) [2460 bp, 819 aa] {ON} highly
           similar to uniprot|P39940 Saccharomyces cerevisiae
           YER125W RSP5 Ubiquitin-protein ligase involved in
           ubiquitin-mediated protein degradation plays a role in
           heat shock element (HSE)-mediated gene expression and
           multivesicular body sorting contains a hect (homologous
           to E6-AP carboxyl terminus) domain
          Length = 819

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 44/98 (44%), Gaps = 8/98 (8%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVAL-ELYHGWH 63
           W +   P+GR Y+ +  T+ +TW  P    +     G      I+ +P   L  L  GW 
Sbjct: 347 WEQRFTPEGRAYFVDHNTRTTTWVDPRR-QQYIRTYGPST-NTIQQQPVSQLGPLPSGWE 404

Query: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKN 101
           + + +T + ++ +  T  + W+ P      L  +LD+N
Sbjct: 405 MRLTNTARVYFVDHNTKTTTWDDP-----RLPSSLDQN 437

>Kwal_47.17302 s47 complement(342098..344461) [2364 bp, 787 aa] {ON}
           YER125W (RSP5) - Rsp5p encodes a hect (homologous to
           E6-AP C terminus) and encodes a ubiquitin-protein ligase
           (E3 enzyme) [contig 210] FULL
          Length = 787

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVAL-ELYHGWH 63
           W +   P+GR Y+ +  T+ +TW  P     +           I+ +P   L  L  GW 
Sbjct: 315 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPAN--TTIQQQPVSQLGPLPSGWE 372

Query: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKN 101
           + + +T + ++ +  T  + W+ P      L  +LD+N
Sbjct: 373 MRLTNTARVYFVDHNTKTTTWDDP-----RLPSSLDQN 405

>KLTH0E06908g Chr5 complement(634745..637120) [2376 bp, 791 aa] {ON}
           highly similar to uniprot|P39940 Saccharomyces
           cerevisiae YER125W RSP5 Ubiquitin-protein ligase
           involved in ubiquitin-mediated protein degradation plays
           a role in heat shock element (HSE)-mediated gene
           expression and multivesicular body sorting contains a
           hect (homologous to E6-AP carboxyl terminus) domain
          Length = 791

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVAL-ELYHGWH 63
           W +   P+GR Y+ +  T+ +TW  P     +           I+ +P   L  L  GW 
Sbjct: 319 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPAN--TTIQQQPVSQLGPLPSGWE 376

Query: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKN 101
           + + +T + ++ +  T  + W+ P      L  +LD+N
Sbjct: 377 MRLTNTARVYFVDHNTKTTTWDDP-----RLPSSLDQN 409

>KAFR0B02100 Chr2 (412007..414409) [2403 bp, 800 aa] {ON} Anc_8.134
           YER125W
          Length = 800

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVAL-ELYHGWH 63
           W +   P+GR Y+ +  T+ +TW  P     +           I+ +P   L  L  GW 
Sbjct: 328 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTN--TTIQQQPVSQLGPLPSGWE 385

Query: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKN 101
           + + +T + ++ +  T  + W+ P      L  +LD+N
Sbjct: 386 MRLTNTARVYFVDHNTKTTTWDDP-----RLPSSLDQN 418

>Smik_5.271 Chr5 (419111..421537) [2427 bp, 808 aa] {ON} YER125W
           (REAL)
          Length = 808

 Score = 37.7 bits (86), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVAL-ELYHGWH 63
           W +   P+GR Y+ +  T+ +TW  P     +           I+ +P   L  L  GW 
Sbjct: 336 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTN--TTIQQQPVSQLGPLPSGWE 393

Query: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKN 101
           + + +T + ++ +  T  + W+ P      L  +LD+N
Sbjct: 394 MRLTNTARVYFVDHNTKTTTWDDP-----RLPSSLDQN 426

>KNAG0D02180 Chr4 complement(369157..371592) [2436 bp, 811 aa] {ON}
           Anc_8.134 YER125W
          Length = 811

 Score = 37.7 bits (86), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVAL-ELYHGWH 63
           W +   P+GR Y+ +  T+ +TW  P     +           I+ +P   L  L  GW 
Sbjct: 339 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTN--TTIQQQPVSQLGPLPSGWE 396

Query: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKN 101
           + + +T + ++ +  T  + W+ P      L  +LD+N
Sbjct: 397 MRLTNTARVYFVDHNTKTTTWDDP-----RLPSSLDQN 429

>CAGL0K02255g Chr11 complement(200548..203016) [2469 bp, 822 aa]
           {ON} highly similar to uniprot|P39940 Saccharomyces
           cerevisiae YER125w Ubiquitin--protein ligase
          Length = 822

 Score = 37.7 bits (86), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVAL-ELYHGWH 63
           W +   P+GR Y+ +  T+ +TW  P     +           I+ +P   L  L  GW 
Sbjct: 350 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTN--TTIQQQPVSQLGPLPSGWE 407

Query: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKN 101
           + + +T + ++ +  T  + W+ P      L  +LD+N
Sbjct: 408 MRLTNTARVYFVDHNTKTTTWDDP-----RLPSSLDQN 440

>NCAS0B04540 Chr2 (825546..828053) [2508 bp, 835 aa] {ON} Anc_8.134
          Length = 835

 Score = 37.7 bits (86), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVAL-ELYHGWH 63
           W +   P+GR Y+ +  T+ +TW  P     +           I+ +P   L  L  GW 
Sbjct: 363 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTN--TTIQQQPVSQLGPLPSGWE 420

Query: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKN 101
           + + +T + ++ +  T  + W+ P      L  +LD+N
Sbjct: 421 MRLTNTARVYFVDHNTKTTTWDDP-----RLPSSLDQN 453

>NDAI0B02460 Chr2 (618295..620805) [2511 bp, 836 aa] {ON} Anc_8.134
          Length = 836

 Score = 37.7 bits (86), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVAL-ELYHGWH 63
           W +   P+GR Y+ +  T+ +TW  P     +           I+ +P   L  L  GW 
Sbjct: 364 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTN--TTIQQQPVSQLGPLPSGWE 421

Query: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKN 101
           + + +T + ++ +  T  + W+ P      L  +LD+N
Sbjct: 422 MRLTNTARVYFVDHNTKTTTWDDP-----RLPSSLDQN 454

>YER125W Chr5 (410189..412618) [2430 bp, 809 aa] {ON}  RSP5E3
           ubiquitin ligase of the NEDD4 family; involved in
           regulating many cellular processes including MVB
           sorting, heat shock response, transcription,
           endocytosis, and ribosome stability; human homolog is
           involved in Liddle syndrome; mutant tolerates
           aneuploidy; ubiquitylates Sec23p
          Length = 809

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVAL-ELYHGWH 63
           W +   P+GR Y+ +  T+ +TW  P     +           I+ +P   L  L  GW 
Sbjct: 337 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTN--TTIQQQPVSQLGPLPSGWE 394

Query: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKN 101
           + + +T + ++ +  T  + W+ P      L  +LD+N
Sbjct: 395 MRLTNTARVYFVDHNTKTTTWDDP-----RLPSSLDQN 427

>Skud_5.253 Chr5 complement(408930..411359) [2430 bp, 809 aa] {ON}
           YER125W (REAL)
          Length = 809

 Score = 37.7 bits (86), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVAL-ELYHGWH 63
           W +   P+GR Y+ +  T+ +TW  P     +           I+ +P   L  L  GW 
Sbjct: 337 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTN--TTIQQQPVSQLGPLPSGWE 394

Query: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKN 101
           + + +T + ++ +  T  + W+ P      L  +LD+N
Sbjct: 395 MRLTNTARVYFVDHNTKTTTWDDP-----RLPSSLDQN 427

>ZYRO0G18920g Chr7 (1563386..1565845) [2460 bp, 819 aa] {ON} highly
           similar to uniprot|P39940 Saccharomyces cerevisiae
           YER125W RSP5 Ubiquitin-protein ligase involved in
           ubiquitin-mediated protein degradation plays a role in
           heat shock element (HSE)-mediated gene expression and
           multivesicular body sorting contains a hect (homologous
           to E6-AP carboxyl terminus) domain
          Length = 819

 Score = 37.7 bits (86), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVAL-ELYHGWH 63
           W +   P+GR Y+ +  T+ +TW  P     +           I+ +P   L  L  GW 
Sbjct: 347 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTN--TTIQQQPVSQLGPLPSGWE 404

Query: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKN 101
           + + +T + ++ +  T  + W+ P      L  +LD+N
Sbjct: 405 MRLTNTARVYFVDHNTKTTTWDDP-----RLPSSLDQN 437

>TBLA0G02790 Chr7 (733955..736489) [2535 bp, 844 aa] {ON} Anc_8.134
           YER125W
          Length = 844

 Score = 37.7 bits (86), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVAL-ELYHGWH 63
           W +   P+GR Y+ +  T+ +TW  P     +           I+ +P   L  L  GW 
Sbjct: 372 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTN--TTIQQQPVSQLGPLPSGWE 429

Query: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKN 101
           + + +T + ++ +  T  + W+ P      L  +LD+N
Sbjct: 430 MRLTNTARVYFVDHNTKTTTWDDP-----RLPSSLDQN 462

>TPHA0D01030 Chr4 (207354..209822) [2469 bp, 822 aa] {ON} Anc_8.134
           YER125W
          Length = 822

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVAL-ELYHGWH 63
           W +   P+GR Y+ +  T+ +TW  P     +           I+ +P   L  L  GW 
Sbjct: 350 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTN--TTIQQQPVSQLGPLPSGWE 407

Query: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKN 101
           + + +T + ++ +  T  + W+ P      L  +LD+N
Sbjct: 408 MRLTNTARVYFVDHNTKTTTWDDP-----RLPSSLDQN 440

>Ecym_8394 Chr8 (808813..811338) [2526 bp, 841 aa] {ON} similar to
           Ashbya gossypii ADL055C
          Length = 841

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVAL-ELYHGWH 63
           W +   P+GR Y+ +  T+ +TW  P     +           I+ +P   L  L  GW 
Sbjct: 369 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPAN--NTIQQQPVSQLGPLPSGWE 426

Query: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKN 101
           + + +T + ++ +  T  + W+ P      L  +LD+N
Sbjct: 427 MRLTNTARVYFVDHNTKTTTWDDP-----RLPSSLDQN 459

>Suva_5.246 Chr5 (385807..388236) [2430 bp, 809 aa] {ON} YER125W
           (REAL)
          Length = 809

 Score = 37.4 bits (85), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVAL-ELYHGWH 63
           W +   P+GR Y+ +  T+ +TW  P     +           I+ +P   L  L  GW 
Sbjct: 337 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTN--TTIQQQPVSQLGPLPSGWE 394

Query: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKN 101
           + + +T + ++ +  T  + W+ P      L  +LD+N
Sbjct: 395 MRLTNTARVYFVDHNTKTTTWDDP-----RLPSSLDQN 427

>ADL055C Chr4 complement(584032..586485) [2454 bp, 817 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER125W
           (RSP5)
          Length = 817

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 44/98 (44%), Gaps = 8/98 (8%)

Query: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVAL-ELYHGWH 63
           W +   P+GR Y+ +  T+ +TW  P    +     G      I+ +P   L  L  GW 
Sbjct: 345 WEQRYTPEGRAYFVDHNTRTTTWVDPRR-QQYIRTYGPSN-NTIQQQPVSQLGPLPSGWE 402

Query: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKN 101
           + + +T + ++ +  T  + W+ P      L  +LD+N
Sbjct: 403 MRLTNTARVYFVDHNTKTTTWDDP-----RLPSSLDQN 435

>NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON} 
          Length = 1398

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 5/47 (10%)

Query: 27  WHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWHLVICDTGKKF 73
           WH  E LD+MD+N  +K FKK  ++P +A+ LY  W   IC +  K+
Sbjct: 283 WHDYEDLDKMDKNLILKFFKKFPTEP-LAMILY-AW---ICSSFSKY 324

>ZYRO0E04224g Chr5 (317895..321641) [3747 bp, 1248 aa] {ON}
           conserved hypothetical protein
          Length = 1248

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 47/108 (43%), Gaps = 7/108 (6%)

Query: 243 NPYSAWPFEMKKIRDDPDFLRVLDDSV----REDVFEEWCAHAISGDQVEPVDEIKSEDF 298
           +P+  W   +K +R DP  L+ ++ ++    +   F  W  + +          I     
Sbjct: 141 SPFQLWNHSLKNLRSDPAPLQTINSNLLSLPQYSFFGTWKINGLVSSAAGITISILVNST 200

Query: 299 DEEEDLEPTKYHYLAHIVSKSNITPTTIF--MDIKNDNKSSFKKYNIK 344
           D ++ L+   Y+ + H+   SNIT   IF  +++ +    S + Y IK
Sbjct: 201 DSQKLLDSLNYN-VVHLNGMSNITNFHIFPPLNVNSAENESLRLYMIK 247

>NCAS0I01820 Chr9 complement(334312..335733) [1422 bp, 473 aa] {ON}
           Anc_3.173 YDL020C
          Length = 473

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 7/60 (11%)

Query: 212 LNIPITESVEEPVDISGDKKALWDLFTRYDLN---PYSAWPFEMKKIRDDPDFLRVLDDS 268
           +N P+T SVEEP+ +S +   ++D   + D+N   P S   F M +   D DFL  +D++
Sbjct: 166 INGPVTSSVEEPIKMSTE---VFDNIYK-DINVTTPDSDNTFSMNETNQDLDFLDTIDET 221

>Kpol_1010.41 s1010 complement(95811..96305) [495 bp, 164 aa] {ON}
          complement(95811..96305) [495 nt, 165 aa]
          Length = 164

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 8  YVAPDGRKYYYNAVTKQSTWHKPESLDE 35
          Y     R+Y++N  TK S W  PE +DE
Sbjct: 15 YSRSKKREYFFNPETKASQWEAPEGVDE 42

>NDAI0K01010 Chr11 complement(230318..235336) [5019 bp, 1672 aa] {ON}
            Anc_8.736 YMR219W
          Length = 1672

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 213  NIPITESVEEPVDISGDKKALWD--LFTRYDLNPYSAWPFEMKKIRD 257
            NI   ESVEEP+D+S D  +  D  L +   +N  + WP   KK  D
Sbjct: 1403 NILKGESVEEPIDLSSDPPSEEDIELLSDEGINIDNEWPAAHKKTED 1449

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,121,455
Number of extensions: 2455958
Number of successful extensions: 8332
Number of sequences better than 10.0: 114
Number of HSP's gapped: 8441
Number of HSP's successfully gapped: 138
Length of query: 460
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 347
Effective length of database: 40,524,141
Effective search space: 14061876927
Effective search space used: 14061876927
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)