Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D09746g3.499ON25325313190.0
TDEL0D056703.499ON25525312051e-169
Kpol_480.103.499ON25924511931e-167
Skud_7.4463.499ON25825411831e-166
YGR135W (PRE9)3.499ON25824611791e-165
SAKL0F02530g3.499ON25225211761e-165
Smik_6.2313.499ON25824611741e-164
Suva_7.4233.499ON25824611711e-164
TPHA0A057003.499ON25624911691e-163
NDAI0G008903.499ON25425411641e-163
KAFR0C020203.499ON25825511601e-162
Ecym_12303.499ON25125111331e-158
KNAG0B007603.499ON25925311281e-157
NCAS0E007603.499ON25924611251e-157
CAGL0I10406g3.499ON25725511141e-155
KLLA0E03917g3.499ON24924911111e-155
Kwal_47.188983.499ON25125211091e-154
KLTH0G02376g3.499ON25125211071e-154
AFR318W3.499ON25125110951e-152
TBLA0D029203.499ON25825610231e-141
KLTH0E16324g8.871ON2502133926e-46
ADL354W8.871ON2501993882e-45
Ecym_81518.871ON2502473873e-45
KLLA0B11836g7.120ON2542043873e-45
KNAG0J001808.871ON2502213873e-45
CAGL0H07007g8.871ON2502133849e-45
NCAS0F010307.120ON2532043822e-44
AAR012C7.120ON2512043812e-44
NDAI0C034005.64ON2632033813e-44
NDAI0E001608.871ON2502133804e-44
KLLA0D10373g8.871ON2502133794e-44
TPHA0H011905.64ON2602263796e-44
SAKL0H02068g5.64ON2612383796e-44
NDAI0H015207.120ON2522043787e-44
KLTH0F13574g7.120ON2541793788e-44
TBLA0J019807.120ON2542043789e-44
TPHA0I020707.120ON2562043781e-43
KAFR0G030307.120ON2542043771e-43
KAFR0L020808.871ON2502133771e-43
NCAS0D013405.64ON2612033771e-43
TBLA0C066205.64ON2622263771e-43
SAKL0F04224g7.120ON2522043762e-43
Kwal_YGOB_Anc_7.1207.120ON2541793752e-43
Kpol_1062.25.64ON2602033743e-43
Smik_13.438.871ON2502133735e-43
CAGL0F01199g7.120ON2542053735e-43
Kwal_56.247805.64ON2622263735e-43
Ecym_51005.64ON2612033735e-43
KLTH0H00528g5.64ON2612033726e-43
Kpol_455.58.871ON2492143717e-43
Suva_13.568.871ON2502133717e-43
Kpol_1023.1087.120ON2542043717e-43
Skud_15.1197.120ON2542203718e-43
Suva_15.1317.120ON2542043718e-43
ZYRO0G04136g7.120ON2542183719e-43
Smik_15.1297.120ON2542043719e-43
YOL038W (PRE6)7.120ON2542043711e-42
TPHA0C049308.871ON2502483701e-42
Ecym_12727.120ON2512043701e-42
Skud_13.518.871ON2502133701e-42
YML092C (PRE8)8.871ON2502133692e-42
KLLA0A05093g5.64ON2622033692e-42
AER296W5.64ON2602033692e-42
CAGL0I02442g5.64ON2602033692e-42
KAFR0B044405.64ON2602263674e-42
TDEL0G008805.64ON2602543665e-42
NCAS0B001508.871ON2502133656e-42
SAKL0D00440g8.871ON2502133657e-42
TDEL0H033007.120ON2562403631e-41
KNAG0K004505.64ON2672173632e-41
TDEL0B004008.871ON2502203612e-41
ZYRO0C11770g5.64ON2602383597e-41
ZYRO0A00616g8.871ON2502133552e-40
TBLA0C063408.871ON2562193534e-40
YGR253C (PUP2)5.64ON2602383526e-40
Suva_7.5495.64ON2602383527e-40
KNAG0L010207.120ON2661763511e-39
Smik_16.545.64ON2602383502e-39
Skud_7.5865.64ON2602263492e-39
ZYRO0C00792g7.20ON2901723172e-34
TBLA0E006907.20ON2781953153e-34
KLTH0D00902g7.20ON2772273102e-33
Smik_15.5467.20ON2881723102e-33
KLLA0A03487g7.20ON2752273092e-33
Kpol_538.407.20ON2741723092e-33
Suva_8.4197.20ON2921723103e-33
CAGL0H06105g7.20ON2901723093e-33
NCAS0I002507.20ON2921723076e-33
KNAG0E002307.20ON2791883067e-33
Skud_15.5307.20ON2882263067e-33
KAFR0C050007.20ON2811723041e-32
ADR401C7.20ON2791723041e-32
YOR362C (PRE10)7.20ON2881723041e-32
Ecym_50197.20ON2852323042e-32
TDEL0H043107.20ON2742263004e-32
Ecym_72334.110ON2462482968e-32
AGL089W4.110ON2461822951e-31
TPHA0N002407.20ON2771722919e-31
SAKL0D14476g7.20ON2811722911e-30
NDAI0A087707.20ON2921722902e-30
KLLA0A05027g4.110ON2462052863e-30
TBLA0C040804.110ON2532012863e-30
Kpol_1061.454.110ON2561772812e-29
KLTH0E07788g4.110ON2461822768e-29
Kwal_47.174934.110ON2461822751e-28
Kwal_27.97208.871ON1731392673e-28
YGL011C (SCL1)4.110ON2521772723e-28
Smik_13.5315.1ON2342252714e-28
ZYRO0G10164g4.110ON2532022724e-28
TPHA0F006704.110ON2571772724e-28
Suva_7.2704.110ON2521832707e-28
YMR314W (PRE5)5.1ON2342202698e-28
Skud_13.4885.1ON2342202681e-27
NCAS0A016404.110ON2531772681e-27
SAKL0H21956g4.110ON2481842681e-27
Smik_7.2794.110ON2521772682e-27
KNAG0E011805.1ON2332422662e-27
KNAG0D035404.110ON2522002653e-27
Skud_7.2764.110ON2521772654e-27
TDEL0F023604.110ON2531792645e-27
Suva_13.5075.1ON2342202635e-27
KLTH0B09504g5.1ON2332192628e-27
CAGL0A00407g4.110ON2541772621e-26
Ecym_56505.1ON2331922592e-26
CAGL0M14003g5.1ON2332192565e-26
Kwal_26.94835.1ON2332192513e-25
TPHA0A056705.1ON2332192513e-25
NCAS0D023105.1ON2332192488e-25
Kpol_1060.15.1ON2332222479e-25
KAFR0F034304.110ON2522002481e-24
AGL336W5.1ON3062192501e-24
ZYRO0C01144g5.1ON2332222462e-24
NDAI0I026405.1ON2332192452e-24
KLLA0A10153g5.1ON2331922434e-24
KAFR0I027205.1ON2351782426e-24
TBLA0C071905.1ON2331922417e-24
SAKL0H00946g5.1ON2332242349e-23
TDEL0G002405.1ON2381822102e-19
Kwal_26.68197.20ON1961501697e-14
NDAI0D035604.110ON172801538e-12
SAKL0G04290g5.507ON2612211331e-08
Smik_15.3375.507ON2611991322e-08
KAFR0C053005.507ON2612241313e-08
Suva_8.2085.507ON2611991294e-08
NDAI0J006007.480ON2411921285e-08
Skud_15.3215.507ON2611991287e-08
NCAS0A148807.480ON2411921277e-08
AGL324W7.480ON2431711278e-08
NDAI0C011705.507ON2631991261e-07
YOR157C (PUP1)5.507ON2611991252e-07
KLLA0A02233g5.507ON2621991223e-07
KNAG0B038005.507ON2611991223e-07
ZYRO0D12034g5.507ON2612131224e-07
Ecym_54585.507ON2582091224e-07
KAFR0B006507.480ON2411911215e-07
CAGL0F04477g7.480ON2421731181e-06
TPHA0E020505.507ON2612101191e-06
Kpol_1028.927.480ON2421861181e-06
TDEL0A037105.507ON2612211162e-06
TBLA0D017505.507ON2592281162e-06
NCAS0H024805.507ON2642221163e-06
KLTH0E01826g7.480ON2421791143e-06
KLLA0E05633g7.480ON2401591144e-06
Suva_2.777.480ON2411731144e-06
KNAG0F035907.480ON2481781136e-06
Kwal_47.187485.507ON2632131136e-06
CAGL0L04312g5.507ON2612071127e-06
Kpol_218.15.507ON2611991128e-06
Kwal_55.198827.480ON2421831101e-05
KLTH0G03168g5.507ON2631711101e-05
SAKL0F15092g7.480ON2611831101e-05
TBLA0F026807.480ON2411731092e-05
TDEL0C034407.480ON2411771082e-05
Skud_2.617.480ON2411731082e-05
TPHA0E004207.480ON2411831073e-05
AAR119W5.507ON2592241074e-05
TPHA0M017503.417ON2862021074e-05
Kpol_2002.1095.216ON2152121054e-05
Kpol_534.575.216ON2152121054e-05
Ecym_71717.480ON2421591055e-05
ZYRO0G17842g7.480ON2441731056e-05
Smik_2.737.480ON2411731047e-05
YBL041W (PRE7)7.480ON2411731047e-05
AEL326C3.417ON2852021031e-04
KLLA0F12936g5.216ON2151911012e-04
KLTH0D03058g3.417ON2872141003e-04
TDEL0C055403.417ON2872021003e-04
TBLA0F017603.417ON2872021003e-04
Ecym_82765.216ON215208975e-04
Skud_16.3883.417ON287202985e-04
Smik_10.2785.216ON216211976e-04
TDEL0E041305.216ON219167966e-04
ZYRO0B10142g5.216ON215212967e-04
Suva_16.4293.417ON287202960.001
Suva_12.805.216ON215212950.001
Kwal_33.151935.216ON193207940.001
Kpol_1018.1443.417ON288202950.001
NCAS0A114403.417ON287173950.001
NDAI0A048603.417ON287173940.002
TBLA0C062005.216ON216210930.002
Skud_10.2225.216ON215212930.002
KNAG0A075203.417ON287177940.002
TPHA0N007405.216ON216213930.002
ZYRO0C17688g3.417ON287202940.002
YPR103W (PRE2)3.417ON287202930.002
Smik_16.3433.417ON287202930.002
YJL001W (PRE3)5.216ON215211920.002
Kwal_26.72733.417ON287173920.003
CAGL0G01804g3.417ON286173920.003
AAL172C5.216ON215209900.003
KNAG0H024505.216ON216210900.004
KAFR0D042103.417ON287202900.005
KLLA0F08228g3.417ON285202900.005
Ecym_26143.417ON285202900.005
SAKL0G12584g5.216ON21573880.006
TPHA0E029905.216ON216212880.007
SAKL0B09262g3.417ON287173860.017
KLTH0B03102g5.216ON215211840.021
KAFR0C063505.216ON21671840.022
KLTH0G00550g3.574ON265191830.038
NCAS0A014805.216ON216211820.044
NDAI0C024205.216ON216213800.073
CAGL0D03058g5.216ON215211790.092
Smik_7.1736.159ON34942740.55
KLTH0C07348g3.269ON316127711.4
KNAG0F033105.285ON86067702.5
Kwal_23.29492.191ON161769692.7
TBLA0E001503.574ON265161682.9
TDEL0B071102.618ON88856684.1
TDEL0D023501.364ON678165674.4
ZYRO0G06600g5.702ON182054659.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D09746g
         (253 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {O...   512   0.0  
TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3....   468   e-169
Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON} ...   464   e-167
Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W (...   460   e-166
YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3...   458   e-165
SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {O...   457   e-165
Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W (...   456   e-164
Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W (...   455   e-164
TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3....   454   e-163
NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON...   452   e-163
KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.49...   451   e-162
Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON} ...   441   e-158
KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON...   439   e-157
NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499     437   e-157
CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa] ...   433   e-155
KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {O...   432   e-155
Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR13...   431   e-154
KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {O...   431   e-154
AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic h...   426   e-152
TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON...   398   e-141
KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 2...   155   6e-46
ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON} S...   154   2e-45
Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa] ...   153   3e-45
KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highl...   153   3e-45
KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871...   153   3e-45
CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {O...   152   9e-45
NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120     151   2e-44
AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, ...   151   2e-44
NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON...   151   3e-44
NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON} ...   150   4e-44
KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {O...   150   4e-44
TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON...   150   6e-44
SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly ...   150   6e-44
NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120     150   7e-44
KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893) ...   150   8e-44
TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.1...   150   9e-44
TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.12...   150   1e-43
KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON...   149   1e-43
KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.8...   149   1e-43
NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64      149   1e-43
TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {...   149   1e-43
SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 a...   149   2e-43
Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131...   149   2e-43
Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906...   148   3e-43
Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON} ...   148   5e-43
CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {O...   148   5e-43
Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa] ...   148   5e-43
Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON} ...   148   5e-43
KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly si...   147   6e-43
Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432) ...   147   7e-43
Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON} ...   147   7e-43
Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON} (2523...   147   7e-43
Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W...   147   8e-43
Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W...   147   8e-43
ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {O...   147   9e-43
Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W...   147   9e-43
YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha ...   147   1e-42
TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8....   147   1e-42
Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa] ...   147   1e-42
Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON} ...   147   1e-42
YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}  PR...   146   2e-42
KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly ...   146   2e-42
AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic h...   146   2e-42
CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {O...   146   2e-42
KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64...   145   4e-42
TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64...   145   5e-42
NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON} ...   145   6e-42
SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,...   145   7e-42
TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON...   144   1e-41
KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}...   144   2e-41
TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871 ...   143   2e-41
ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {O...   142   7e-41
ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}...   141   2e-40
TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {...   140   4e-40
YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}  P...   140   6e-40
Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}...   140   7e-40
KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {O...   139   1e-39
Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C (R...   139   2e-39
Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}...   139   2e-39
ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly si...   126   2e-34
TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON...   125   3e-34
KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {...   124   2e-33
Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {O...   124   2e-33
KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 a...   123   2e-33
Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON} ...   123   2e-33
Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}...   124   3e-33
CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly ...   123   3e-33
NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON} ...   122   6e-33
KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20 Y...   122   7e-33
Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {O...   122   7e-33
KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20...   121   1e-32
ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 ...   121   1e-32
YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}...   121   1e-32
Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}...   121   2e-32
TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON...   120   4e-32
Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to...   118   8e-32
AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic hom...   118   1e-31
TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20 ...   116   9e-31
SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369) ...   116   1e-30
NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {...   116   2e-30
KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly ...   114   3e-30
TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON...   114   3e-30
Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {...   112   2e-29
KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly ...   110   8e-29
Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C...   110   1e-28
Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON} ...   107   3e-28
YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}  S...   109   3e-28
Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W...   108   4e-28
ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly ...   109   4e-28
TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.11...   109   4e-28
Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}...   108   7e-28
YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha ...   108   8e-28
Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W...   107   1e-27
NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON...   107   1e-27
SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highl...   107   1e-27
Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}...   107   2e-27
KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON...   107   2e-27
KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON...   106   3e-27
Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}...   106   4e-27
TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON...   106   5e-27
Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W...   105   5e-27
KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {O...   105   8e-27
CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly si...   105   1e-26
Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON...   104   2e-26
CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} high...   103   5e-26
Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {...   101   3e-25
TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON}             101   3e-25
NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON...   100   8e-25
Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON} c...   100   9e-25
KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON...   100   1e-24
AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homol...   100   1e-24
ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}...    99   2e-24
NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1        99   2e-24
KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {O...    98   4e-24
KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1 ...    98   6e-24
TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5....    97   7e-24
SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly ...    95   9e-23
TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON} ...    86   2e-19
Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C (P...    70   7e-14
NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON...    64   8e-12
SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly ...    56   1e-08
Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {O...    55   2e-08
KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5....    55   3e-08
Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}...    54   4e-08
NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.4...    54   5e-08
Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {O...    54   7e-08
NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {...    54   7e-08
AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic hom...    54   8e-08
NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON...    53   1e-07
YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}  ...    53   2e-07
KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {O...    52   3e-07
KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON...    52   3e-07
ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highl...    52   4e-07
Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to...    52   4e-07
KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.48...    51   5e-07
CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {O...    50   1e-06
TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON...    50   1e-06
Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON} (21109...    50   1e-06
TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.50...    49   2e-06
TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON...    49   2e-06
NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507      49   3e-06
KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly ...    49   3e-06
KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {O...    49   4e-06
Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W (R...    49   4e-06
KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON...    48   6e-06
Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {O...    48   6e-06
CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {...    48   7e-06
Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON} comp...    48   8e-06
Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W...    47   1e-05
KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly ...    47   1e-05
SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highl...    47   1e-05
TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON...    47   2e-05
TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON...    46   2e-05
Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W (R...    46   2e-05
TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480 ...    46   3e-05
AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic hom...    46   4e-05
TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.4...    46   4e-05
Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON} (2589...    45   4e-05
Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON} (145742....    45   4e-05
Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON} ...    45   5e-05
ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa] ...    45   6e-05
Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W (R...    45   7e-05
YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6 ...    45   7e-05
AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON} Synt...    44   1e-04
KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590) ...    44   2e-04
KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {O...    43   3e-04
TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.41...    43   3e-04
TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON...    43   3e-04
Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp...    42   5e-04
Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W...    42   5e-04
Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 a...    42   6e-04
TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 ...    42   6e-04
ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648...    42   7e-04
Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W...    42   0.001
Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa...    41   0.001
Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL00...    41   0.001
Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa] ...    41   0.001
NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3....    41   0.001
NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {...    41   0.002
TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5....    40   0.002
Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 a...    40   0.002
KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3....    41   0.002
TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.2...    40   0.002
ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highl...    41   0.002
YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5...    40   0.002
Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W...    40   0.002
YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {...    40   0.002
Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON...    40   0.003
CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {O...    40   0.003
AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 ...    39   0.003
KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 ...    39   0.004
KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.41...    39   0.005
KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {O...    39   0.005
Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar ...    39   0.005
SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137) ...    39   0.006
TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON...    39   0.007
SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly ...    38   0.017
KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648...    37   0.021
KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [...    37   0.022
KLTH0G00550g Chr7 (38715..39512) [798 bp, 265 aa] {ON} highly si...    37   0.038
NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON...    36   0.044
NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON...    35   0.073
CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {O...    35   0.092
Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W ...    33   0.55 
KLTH0C07348g Chr3 (636295..637245) [951 bp, 316 aa] {ON} weakly ...    32   1.4  
KNAG0F03310 Chr6 (625561..628143) [2583 bp, 860 aa] {ON}               32   2.5  
Kwal_23.2949 s23 (85646..90499) [4854 bp, 1617 aa] {ON} YOR093C ...    31   2.7  
TBLA0E00150 Chr5 (19516..20313) [798 bp, 265 aa] {ON} Anc_3.574 ...    31   2.9  
TDEL0B07110 Chr2 complement(1254814..1257480) [2667 bp, 888 aa] ...    31   4.1  
TDEL0D02350 Chr4 (456952..458988) [2037 bp, 678 aa] {ON} Anc_1.3...    30   4.4  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...    30   9.1  

>ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 253

 Score =  512 bits (1319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/253 (100%), Positives = 253/253 (100%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTLLVK 240
           KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTLLVK
Sbjct: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTLLVK 240

Query: 241 NGITKAGEDEDEE 253
           NGITKAGEDEDEE
Sbjct: 241 NGITKAGEDEDEE 253

>TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3.499
           YGR135W
          Length = 255

 Score =  468 bits (1205), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 227/253 (89%), Positives = 244/253 (96%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           TSTEKLYRLNDKI VAVAGLT+DAEILINTAR++AQNYL+TYNEDIPVEILVKRLSDIKQ
Sbjct: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTLLVK 240
           KDD+K++GAIELALKTLSKTTDSSALT DR+EFATI+   +GKLYQK+FKPEEIQ+LLVK
Sbjct: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSLLVK 240

Query: 241 NGITKAGEDEDEE 253
           +GITK   D++++
Sbjct: 241 HGITKKHHDDEQD 253

>Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON}
           complement(20212..20991) [780 nt, 260 aa]
          Length = 259

 Score =  464 bits (1193), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 226/245 (92%), Positives = 236/245 (96%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           TSTEK+YRLNDKI VAVAGLT+DAEILINTAR+HAQ YLKTYNE+IPVEILV+RLSDIKQ
Sbjct: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTLLVK 240
           KDDIKVD AIELALKTLSKTTDSSALTYDRVEFATIK GEN K+YQK+FKPEEI+ LL+K
Sbjct: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQLLLK 240

Query: 241 NGITK 245
            GITK
Sbjct: 241 TGITK 245

>Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  460 bits (1183), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 223/254 (87%), Positives = 243/254 (95%), Gaps = 1/254 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           TSTEKLY+LNDKI VAVAGLT+DAEILINTAR+HAQNYLKTYNEDIPVEILV+RLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAG+DDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGEN-GKLYQKVFKPEEIQTLLV 239
           K+D+KVDGAI+LALKTLSKTTDSSALTYDR+EFATI+ G N G++YQK+FKP+EI+ LLV
Sbjct: 181 KEDMKVDGAIDLALKTLSKTTDSSALTYDRLEFATIRKGPNDGEVYQKIFKPQEIKDLLV 240

Query: 240 KNGITKAGEDEDEE 253
           K GI+K  ED++ +
Sbjct: 241 KTGISKKDEDDEAD 254

>YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3
           subunit of the 20S proteasome, the only nonessential 20S
           subunit; may be replaced by the alpha 4 subunit (Pre6p)
           under stress conditions to create a more active
           proteasomal isoform
          Length = 258

 Score =  458 bits (1179), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 224/246 (91%), Positives = 237/246 (96%), Gaps = 1/246 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           TSTEKLY+LNDKI VAVAGLT+DAEILINTARIHAQNYLKTYNEDIPVEILV+RLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGEN-GKLYQKVFKPEEIQTLLV 239
           KDD+KVD AIELALKTLSKTTDSSALTYDR+EFATI+ G N G++YQK+FKP+EI+ +LV
Sbjct: 181 KDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILV 240

Query: 240 KNGITK 245
           K GITK
Sbjct: 241 KTGITK 246

>SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 252

 Score =  457 bits (1176), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 222/252 (88%), Positives = 241/252 (95%), Gaps = 1/252 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           TS+EKLY+LND I VAVAGLT+DAEILINTAR++AQNYL+TYNE+IPVEILV+RLSDIKQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVYAQNYLQTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYD+RYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTLLVK 240
           KD I +DGAIELALKTLSKTTDSSALT+DR+EFATIK G NG+LYQK++KP+EIQTLL K
Sbjct: 181 KDGINLDGAIELALKTLSKTTDSSALTHDRIEFATIKKGSNGQLYQKIYKPQEIQTLLSK 240

Query: 241 NGITKAGEDEDE 252
            GITK  +DEDE
Sbjct: 241 TGITKK-DDEDE 251

>Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  456 bits (1174), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 224/246 (91%), Positives = 237/246 (96%), Gaps = 1/246 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           TSTEKLY+LNDKI VAVAGLT+DAEILINTARIHAQNYLKTYNEDIPVEILV+RLSDIKQ
Sbjct: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGEN-GKLYQKVFKPEEIQTLLV 239
           KDD+KVD AI+LALKTLSKTTDSSALTYDR+EFATI+ G N G++YQK+FKP+EI+ LLV
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240

Query: 240 KNGITK 245
           K GITK
Sbjct: 241 KTGITK 246

>Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  455 bits (1171), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 221/246 (89%), Positives = 237/246 (96%), Gaps = 1/246 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           TSTEKLY+LNDKI VAVAGLT+DAEILINTAR+HAQNYLK+YNEDIPVEILV+RLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKSYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAG+DDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGEN-GKLYQKVFKPEEIQTLLV 239
           KDD+KVD AI+LALKTLSKTTDSSALTYDR+EFATI+ G N G++YQK+FKP+EI+ LLV
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDLLV 240

Query: 240 KNGITK 245
           K GITK
Sbjct: 241 KTGITK 246

>TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3.499
           YGR135W
          Length = 256

 Score =  454 bits (1169), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 219/249 (87%), Positives = 237/249 (95%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           TSTEKLY+LND I VAVAGLT+DAEILINTAR+ AQNYL+TYNEDIPVE+LV++LSDIKQ
Sbjct: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYD+R GYQL+TSNPSGNYTGWKAISVGANTSAAQTLLQ+++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180

Query: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTLLVK 240
           KDDIK++GAIELALKTLSKTTDSSALTYDRVEFATIK GEN K+YQK++KPEEI+ LL K
Sbjct: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLSK 240

Query: 241 NGITKAGED 249
            GITK  ED
Sbjct: 241 AGITKKSED 249

>NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON}
           Anc_3.499
          Length = 254

 Score =  452 bits (1164), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 220/254 (86%), Positives = 240/254 (94%), Gaps = 1/254 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           TS EKLY+LNDKI VAVAGLT+DAEILINTARIHAQNYLKTYNEDIPVEILV+RLSDIKQ
Sbjct: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGEN-GKLYQKVFKPEEIQTLLV 239
           KDD+++D AIELALKTLSKTTDSS+LTYD++EFATIK G+N G++YQK++KP+EI+ LL+
Sbjct: 181 KDDMRLDEAIELALKTLSKTTDSSSLTYDKLEFATIKKGKNDGEVYQKIYKPDEIKELLI 240

Query: 240 KNGITKAGEDEDEE 253
           K G+TK  +DE EE
Sbjct: 241 KTGVTKKKDDETEE 254

>KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.499
           YGR135W
          Length = 258

 Score =  451 bits (1160), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 222/255 (87%), Positives = 239/255 (93%), Gaps = 2/255 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           TS EKLY+LNDKI VAVAGLT+DAEILINTARIHAQNYLKTYNEDIPVEILV+RLSDIKQ
Sbjct: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYD+RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGE-NGKLYQKVFKPEEIQTLLV 239
           KD+I +D A+ELALKTLSK TDSS LTYDR+EFATIK G+ N K+YQK+F P+EI++LLV
Sbjct: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240

Query: 240 KNGITKA-GEDEDEE 253
           K GI+K   EDED E
Sbjct: 241 KTGISKKENEDEDTE 255

>Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON}
           similar to Ashbya gossypii AFR318W
          Length = 251

 Score =  441 bits (1133), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 214/251 (85%), Positives = 232/251 (92%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DGIVLAAERKVTSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           TS+EKLYRLND I VAVAGLT+DAEILINTAR+HAQNYLK YNE+IPVEILV+RLSDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILINTARLHAQNYLKMYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANT AAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTLLVK 240
           KD+I  + AIELALKTLSKTTD+S+LT DR+EFATIK   NGKL QK++KP EI+ LL K
Sbjct: 181 KDEITFENAIELALKTLSKTTDNSSLTDDRLEFATIKQDSNGKLVQKIYKPSEIKELLQK 240

Query: 241 NGITKAGEDED 251
           +GI K  E+ D
Sbjct: 241 SGIMKQEENAD 251

>KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON}
           Anc_3.499 YGR135W
          Length = 259

 Score =  439 bits (1128), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 215/253 (84%), Positives = 235/253 (92%), Gaps = 2/253 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++A+DGIV+AAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           TSTEKLYRLNDKIVVAVAGLT+DAEILINTAR+H QNYLKTY EDIPVE+LVKR+SDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
            YTQHGGLRPFGVSFIYAG DDRYG+QLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLG-ENGKLYQKVFKPEEIQTLLV 239
           KD+I ++ A ELALKTLSKTTDSSALTYDRVEF+TIK G E G++ QK++KP EI+ LLV
Sbjct: 181 KDEITLEEATELALKTLSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240

Query: 240 KNGITKA-GEDED 251
           K+GITK   ED D
Sbjct: 241 KSGITKKDAEDGD 253

>NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499
          Length = 259

 Score =  437 bits (1125), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 212/246 (86%), Positives = 235/246 (95%), Gaps = 1/246 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DG+VLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           TSTEKLY+LNDKI VAVAGLT+DAEILINTAR++AQ+YLKTYNE+IPVEILV+RLSDIKQ
Sbjct: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLG-ENGKLYQKVFKPEEIQTLLV 239
           KD++K+D AIELALKTLSKTTDSS+LTYD++E ATIK G    ++YQK++KPEE++ LL+
Sbjct: 181 KDNMKLDDAIELALKTLSKTTDSSSLTYDKLELATIKKGTTTDEVYQKIYKPEELKELLL 240

Query: 240 KNGITK 245
           K GITK
Sbjct: 241 KTGITK 246

>CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa]
           {ON} highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135w proteasome subunit Y13
          Length = 257

 Score =  433 bits (1114), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 212/255 (83%), Positives = 236/255 (92%), Gaps = 2/255 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIM  +GIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTSEGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           TSTEKLY+LND+  VAVAGLT+DAEILINTARIHAQNYLKTYNE+IPVE+LV++LSDIKQ
Sbjct: 61  TSTEKLYKLNDRTTVAVAGLTADAEILINTARIHAQNYLKTYNEEIPVEMLVRKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQ+GGLRP+GVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQYGGLRPYGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATI-KLGENGKLYQKVFKPEEIQTLLV 239
           KD++ +D A+ELALKTLSKTTDSS+LTYDR+EFAT+ K GE  +  QK+FKP EI+ LL+
Sbjct: 181 KDEMTLDDAVELALKTLSKTTDSSSLTYDRLEFATLKKKGETEEFEQKIFKPAEIKQLLI 240

Query: 240 KNGIT-KAGEDEDEE 253
           K GI+ K+ EDED E
Sbjct: 241 KTGISKKSDEDEDVE 255

>KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 249

 Score =  432 bits (1111), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 209/249 (83%), Positives = 228/249 (91%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIM E GIVLAAERKVTSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTEQGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           TS+EKLY+LND I VAVAGLT+DAEILINTAR+ AQ+YLKTYNE+IPVE+LV+RLSD+KQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVQAQSYLKTYNEEIPVEMLVRRLSDLKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANT AAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTLLVK 240
           KDDI +DGAIELALKTLSKTTDSS LT++R+EFATI     GK+YQK++KP EI TLL K
Sbjct: 181 KDDITLDGAIELALKTLSKTTDSSVLTHERLEFATISKDAEGKIYQKIYKPTEIATLLEK 240

Query: 241 NGITKAGED 249
             I K  +D
Sbjct: 241 TEIVKKDDD 249

>Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR135W
           (PRE9) - proteasome component Y13 [contig 189] FULL
          Length = 251

 Score =  431 bits (1109), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 211/252 (83%), Positives = 231/252 (91%), Gaps = 1/252 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA+DGIVLAAERKVTSKLLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           +S+EKLY+LND I VAVAGLT+DAEILINTAR+ AQNYLKTYNE+IPVEILV+RLSD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKTYNEEIPVEILVRRLSDVKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFG SFIYAGYDDR+GYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRFGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTLLVK 240
           KDDI V  A ELALKTLSKTTDSS LT +RVEFATI   ENGK+ QK+FKP EI+TLL +
Sbjct: 181 KDDITVKEATELALKTLSKTTDSSTLTSERVEFATITKLENGKIAQKIFKPREIETLLNE 240

Query: 241 NGITKAGEDEDE 252
            GI K  E+E+E
Sbjct: 241 TGINKK-ENEEE 251

>KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 251

 Score =  431 bits (1107), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 209/252 (82%), Positives = 234/252 (92%), Gaps = 1/252 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA+DGIVLAAERKVTSKLLEQ 
Sbjct: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           +S+EKLY+LND I VAVAGLT+DAEILINTAR+ AQNYLK+YNE+IPVEILV+RLSD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFG SFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTLLVK 240
           KDDI V+ A ELALKTLSKTTDSS LT +RVEF+TI   +NGK+ QK+FKP+EI+TLL K
Sbjct: 181 KDDITVEEATELALKTLSKTTDSSTLTPERVEFSTITKLDNGKIAQKIFKPQEIETLLNK 240

Query: 241 NGITKAGEDEDE 252
            G+TK  E++DE
Sbjct: 241 TGVTKK-ENDDE 251

>AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR135W (PRE9)
          Length = 251

 Score =  426 bits (1095), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 206/251 (82%), Positives = 229/251 (91%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DGIVLAAERKVTSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           TS+EKLYRLND I VAVAGLT+DAEIL+NTAR+HAQNYLK YNE+IPVE+LV+RLSDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYD RYGYQLYTSNPSGNY+GWKAISVGANT A QTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180

Query: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTLLVK 240
           KDD+  D AI+LALKTLSKTTDSS+L+++R+EFATI+   +GK+ QK++K  EI+ LL K
Sbjct: 181 KDDLTFDDAIKLALKTLSKTTDSSSLSHERLEFATIQRNADGKVVQKIYKLGEIKDLLEK 240

Query: 241 NGITKAGEDED 251
            GI K  E ED
Sbjct: 241 TGINKQEEKED 251

>TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON}
           Anc_3.499 YGR135W
          Length = 258

 Score =  398 bits (1023), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 198/256 (77%), Positives = 223/256 (87%), Gaps = 3/256 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM++DGIVL AERK+TSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
              EKLY+L+DKI +AVAGLT+DAEILIN AR  AQNYL TYNE+IPVEILVK+LSDIKQ
Sbjct: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
            YTQHGGLRPFGVSFIYAGYDD  G QLYTSNPSGNYTGWKAIS+GANTSAAQTLLQ+DY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGE--NGKLYQKVFKPEEIQTLL 238
           KDD+ ++ A+EL LKTLSKTTDSS LTYDRVE + IK+ +  + K+ QK++ P EI+ LL
Sbjct: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSIIKIDKENDNKIIQKIYNPAEIKQLL 240

Query: 239 VKNGITKAG-EDEDEE 253
           +K GI K   EDED E
Sbjct: 241 IKFGINKKNDEDEDVE 256

>KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 250
           aa] {ON} similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  155 bits (392), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 83/213 (38%), Positives = 130/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+++A E+K TS L   + S  
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIRATNGVIIATEKKSTSSLALTE-SLS 62

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQ-NYLKTYNEDIPVEILVKRLSDIKQGYT 123
           K+  +   I  A +G+  D  +LI+ +R  A  +Y + YNE  P +ILV  ++ I Q  T
Sbjct: 63  KVAHITPDIGAAYSGMGPDFRVLIDKSRKVAHTHYKRIYNEYPPTKILVAEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AGYD+  GY LY  +PSG+Y  WKA ++G   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 IKVDGAIELALKTLSKTTDSSALTYDRVEFATI 216
           ++++ AI +AL TL ++ +      D +E A +
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAVV 214

>ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML092C
           (PRE8); 1-intron
          Length = 250

 Score =  154 bits (388), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 79/199 (39%), Positives = 126/199 (63%), Gaps = 2/199 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K  + L  +DT  +
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANTTLTIKDT-LD 62

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHA-QNYLKTYNEDIPVEILVKRLSDIKQGYT 123
           K+ ++   I    +G+  D  +LIN +R  A  +Y K Y E  P +ILV +++ I Q  T
Sbjct: 63  KVSQITPDIGAVYSGMGPDFRVLINKSRKTAYGSYRKAYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AGYD+  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 IKVDGAIELALKTLSKTTD 202
           ++++ AI +AL TL ++ +
Sbjct: 183 LELEDAIHIALLTLKESVE 201

>Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa]
           {ON} similar to Ashbya gossypii ADL354W 1-intron
          Length = 250

 Score =  153 bits (387), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 91/247 (36%), Positives = 143/247 (57%), Gaps = 16/247 (6%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K  S L   DT  +
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANSTLTLTDT-LD 62

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHA-QNYLKTYNEDIPVEILVKRLSDIKQGYT 123
           K+ ++   I    +G+  D  +LIN +R  A  +Y+KTY E  P +ILV +++ I Q  T
Sbjct: 63  KISKITPDIGAVYSGMGPDFRVLINKSRKTAYGSYMKTYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AGYD+   + LY  +PSG+Y  WKA ++G   +AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDNHNEFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNNE 182

Query: 184 IKVDGAIELALKTLSKTTDSSALTYDRVEFATIK------LG------ENGKLYQKVFKP 231
           ++++ AI +AL TL ++ +      + +E A I       LG        G  ++K F P
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGETIEVAVIGEENDDLLGYKGDATARGPRFRK-FTP 240

Query: 232 EEIQTLL 238
           +EI   L
Sbjct: 241 QEINDRL 247

>KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P40303 Saccharomyces cerevisiae
           YOL038W PRE6 20S proteasome alpha-type subunit
          Length = 254

 Score =  153 bits (387), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 128/204 (62%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGADCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           + ++++ +V++ AGL +D+ ILI  AR+ AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDNHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY-KDD 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A S+G N++  +  L+ +Y K++
Sbjct: 124 GGVRPFGVSVLIAGFDPRDNKPRLYQTEPSGIYSAWCAQSIGRNSNTVREFLEKNYNKNE 183

Query: 184 IKVD--GAIELALKTLSKTTDSSA 205
              D    ++L +K+L +   + A
Sbjct: 184 PPADEKECVKLTIKSLLEVVQTGA 207

>KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  153 bits (387), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 133/221 (60%), Gaps = 3/221 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   DT + 
Sbjct: 4   RYAFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKSSSPLALTDTLS- 62

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQ-NYLKTYNEDIPVEILVKRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A  +Y + YNE  P ++LV  ++++ Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEVMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AGYDD  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDDHRGFSLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 IKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKL 224
           ++++ AI +AL TL ++ +      D +E   I    N +L
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIGIIGEPNNDQL 222

>CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092c PRE8
          Length = 250

 Score =  152 bits (384), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 130/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQ-NYLKTYNEDIPVEILVKRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  NY + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGIGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AGYD+  GY LY  +PSG+Y  WKA S+G  ++AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNNE 182

Query: 184 IKVDGAIELALKTLSKTTDSSALTYDRVEFATI 216
           ++++ AI +AL TL ++ +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAVI 214

>NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120
          Length = 253

 Score =  151 bits (382), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 124/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  +V++ +GL +D+ ILI  AR+ AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD- 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDNKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 --IKVDGAIELALKTLSKTTDSSA 205
               V+  + L +K+L +   + A
Sbjct: 184 PPKNVEECVRLTVKSLLEVVQTGA 207

>AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, 251
           aa] {ON} syntenic homolog of Saccharomyces cerevisiae
           YOL038W (PRE6); 1-intron
          Length = 251

 Score =  151 bits (381), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 122/204 (59%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP G ++QVEYALE++      +GI  ED +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGIKGEDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           + R+++ ++++ AGL +D+ ILI  AR+ AQ++  T  + + VE + + ++ ++Q YTQ 
Sbjct: 64  ISRIDNHLILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDI 184
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y    
Sbjct: 124 GGVRPFGVSTLVAGFDPRDARPRLYQTEPSGIYSAWAAQAIGRNSKTVREFLEKNYSKHT 183

Query: 185 KV---DGAIELALKTLSKTTDSSA 205
                   ++L +K+L +   + A
Sbjct: 184 PPASEQDCVKLTVKSLLEVVQTGA 207

>NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON}
           Anc_5.64
          Length = 263

 Score =  151 bits (381), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 83/203 (40%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK----QG 121
           +  +   +  A++GLT+DA  +I  AR+ A N+   Y+ED+ VE L + + D+     +G
Sbjct: 67  IVEIEHHVGCAMSGLTADARSMIEHARVAAVNHNLYYDEDMKVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYDD  GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDDDEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDGAIELALKTLSKTTD 202
           +   + +  A  L LK L +  +
Sbjct: 187 WHSSLTLREAEVLVLKILKQVME 209

>NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  150 bits (380), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 130/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL +++   T+IGI A +GIV+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSIGIKATNGIVIATEKKSSSPLALTETLS- 62

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTAR-IHAQNYLKTYNEDIPVEILVKRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R +   NY + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHSNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHRGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 IKVDGAIELALKTLSKTTDSSALTYDRVEFATI 216
           ++++ AI +AL TL ++ +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAVI 214

>KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type
           subunit,
          Length = 250

 Score =  150 bits (379), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 128/213 (60%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI + +GIV+A E+K +S L   DT   
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKSTNGIVIATEKKSSSSLALPDT-VS 62

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQ-NYLKTYNEDIPVEILVKRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ AR  A  NY + Y E  P +ILV  ++ I Q  T
Sbjct: 63  KVSLITPDIGAVYSGMGPDFRVLVDKARKVAHTNYKRIYGEYPPTKILVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG Y  WKA ++G  +SAA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSVLVAGHDEHNGFGLYQVDPSGAYFPWKATAIGKGSSAAKTFLEKRWNEE 182

Query: 184 IKVDGAIELALKTLSKTTDSSALTYDRVEFATI 216
           ++++ AI +AL TL ++ +      D +E A +
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAIV 214

>TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON}
           Anc_5.64 YGR253C
          Length = 260

 Score =  150 bits (379), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 132/226 (58%), Gaps = 8/226 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  I  A++GLT+DA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  ILEIDRHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++GA +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYNAKAIGAGSEGAQSELQNE 186

Query: 180 YKDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLY 225
           +   + +  A  L LK L +  +   L  +  + ++I   E  K+Y
Sbjct: 187 WHSSLTLKEAELLVLKVLKQVMEEK-LDENNTQLSSITKDEGFKIY 231

>SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  150 bits (379), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 89/238 (37%), Positives = 135/238 (56%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I  A++GLT+DA  +I  AR+ A  +   Y+EDI VE L + + D+   + + 
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARVSAVTHNLYYDEDIGVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
                    RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYDAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTL 237
           +   + +  A  L LK L +  +   L  +  + +++   E  K+Y      E I+ L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSVTRDEGFKIYSDEKTAEIIKEL 243

>NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120
          Length = 252

 Score =  150 bits (378), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 125/204 (61%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI  ++ +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  +V++ +GL +D+ ILI  ARI AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARIEAQSHRLTLEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD- 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  + 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNREE 183

Query: 184 --IKVDGAIELALKTLSKTTDSSA 205
               VD  + L +++L +   + A
Sbjct: 184 PPENVDECVRLTVRSLLEVVQTGA 207

>KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893)
           [765 bp, 254 aa] {ON} highly similar to uniprot|P40303
           Saccharomyces cerevisiae YOL038W PRE6 20S proteasome
           alpha-type subunit
          Length = 254

 Score =  150 bits (378), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 114/179 (63%), Gaps = 1/179 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI  +D +V+  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVIGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  +V++ AGL +D+ ILI  AR+ AQ++  T  + + V+ L + ++ ++Q YTQ 
Sbjct: 64  IAKIDSHVVLSFAGLNADSRILIEKARVEAQSHKLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGVYSAWSAQAIGRNSKTVREFLEKNYARD 182

>TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.120
           YOL038W
          Length = 254

 Score =  150 bits (378), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 124/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++      +GI   D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCTVGIKGTDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           + ++++ IV++ +GL +D+ ILI  AR+ AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHKLTVEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD- 183
           GG+RPFG+S + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGISTLIAGFDPRDNTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYDRDE 183

Query: 184 --IKVDGAIELALKTLSKTTDSSA 205
                +  I+L +K+L +   + A
Sbjct: 184 PPSTAEECIKLTIKSLLEVVQTGA 207

>TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.120
           YOL038W
          Length = 256

 Score =  150 bits (378), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 126/204 (61%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI  ED +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGEDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           + ++++ I+++ +GL +D+ ILI  ARI AQ++  T  + + +E L + ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIILSFSGLNADSRILIEKARIEAQSHKLTLEDPVSIEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYD-DRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDI 184
           GG+RPFGVS + AG+D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPNDNKPRLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNYNKDE 183

Query: 185 KV---DGAIELALKTLSKTTDSSA 205
                +  I+L +K+L +   + A
Sbjct: 184 PPKNKEECIKLTVKSLLEVVQTGA 207

>KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON}
           Anc_7.120 YOL038W
          Length = 254

 Score =  149 bits (377), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 125/204 (61%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   + +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGTNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           + ++++ IV++ +GL +D+ ILI  AR+ AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLARYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD- 183
           GG+RPFGVS + AG D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGLDPRDNTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNKDE 183

Query: 184 --IKVDGAIELALKTLSKTTDSSA 205
               V+  ++L +K+L +   + A
Sbjct: 184 PPSTVEECVKLTIKSLLEVVQTGA 207

>KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  149 bits (377), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 131/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQ-NYLKTYNEDIPVEILVKRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A  +Y + YNE  P ++LV  +++I Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHQGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 IKVDGAIELALKTLSKTTDSSALTYDRVEFATI 216
           ++++ AI +AL TL ++ +      D +E   I
Sbjct: 183 LELEDAIHIALLTLKESIEGE-FNGDTIEIGVI 214

>NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64
          Length = 261

 Score =  149 bits (377), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 83/203 (40%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK----QG 121
           +  +   I  A++GLT+DA  +I  AR+ A N+   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIEHHIGCAMSGLTADARSMIEHARVAAVNHNLYYDEDIKVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD+  GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDNDEGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDGAIELALKTLSKTTD 202
           +   + +  A  L LK L +  +
Sbjct: 187 WHSSLTLKEAELLVLKILKQVME 209

>TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {ON}
           Anc_5.64 YGR253C
          Length = 262

 Score =  149 bits (377), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/226 (37%), Positives = 129/226 (57%), Gaps = 8/226 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS+LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSRLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  +   I  A++GLT+DA  +I  AR  A  +   Y+EDI VE L + + D+   + + 
Sbjct: 67  IVEIEKHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
                    RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLY 225
           +   + +  A  L LK L +  +   L  + V+ + +   E  K+Y
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LNENNVQLSCVTKEEGFKIY 231

>SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 aa]
           {ON} highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 252

 Score =  149 bits (376), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 124/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  +V++ AGL +D+ ILI  AR+ AQ++  T  + + ++ L + ++ I+Q YTQ 
Sbjct: 64  ISQIDTHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSIDYLTRYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD- 183
           GG+RPFGVS + AG+D   G  +LY + PSG Y+ W A ++G N+   +  L+ +Y  + 
Sbjct: 124 GGVRPFGVSTLIAGFDPNDGVPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYSKEE 183

Query: 184 --IKVDGAIELALKTLSKTTDSSA 205
                  A++L +K+L +   + A
Sbjct: 184 PPATEQEAVKLTVKSLLEVVQTGA 207

>Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131)
           [765 bp, 254 aa] {ON} ANNOTATED BY YGOB -
          Length = 254

 Score =  149 bits (375), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 114/179 (63%), Gaps = 1/179 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI  +D +V+  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVVGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  +V++ AGL +D+ ILI  AR+ AQ++  T  + + V+ L + ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYVRD 182

>Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906)
           [783 nt, 261 aa]
          Length = 260

 Score =  148 bits (374), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 83/203 (40%), Positives = 122/203 (60%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTREGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK----QG 121
           +  +++ I  A++GLT+DA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIDNHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVETLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDRDQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDGAIELALKTLSKTTD 202
           +   + +  A  L LK L +  +
Sbjct: 187 WHSSLTLKEAELLVLKILKQVME 209

>Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  148 bits (373), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 129/213 (60%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAISETLS- 62

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQ-NYLKTYNEDIPVEILVKRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  NY + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 IKVDGAIELALKTLSKTTDSSALTYDRVEFATI 216
           ++++ AI +AL TL ++ +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII 214

>CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038w PRE6
          Length = 254

 Score =  148 bits (373), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 121/205 (59%), Gaps = 5/205 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  +D +VL  ER+ T KL +      K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGKDCVVLGCERRSTLKLQDTRVIASK 63

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  +V++ AGL +D+ IL+N AR+ AQ++  T  + + VE + + ++ ++Q YTQ 
Sbjct: 64  VLPIDSHLVLSFAGLNADSRILVNMARVEAQSHRLTLEDPVTVEYMARYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR--YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           GG+RPFGVS + AG+D R     +LY + PSG Y+ W A ++G N+   +  L+ +Y  +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTENPRLYQTEPSGIYSSWCAQAIGRNSKTVREFLEKNYNRE 183

Query: 184 IKVDG---AIELALKTLSKTTDSSA 205
                    I L +K L +   + A
Sbjct: 184 EPPSNKEECIRLTVKALLEVVQTGA 208

>Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa]
           {ON} YGR253C (PUP2) - 1:1 [contig 160] FULL
          Length = 262

 Score =  148 bits (373), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 132/226 (58%), Gaps = 8/226 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+   +G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK----QG 121
           +  +   +  A++GLT+DA  +I  AR+ A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSAVTHNLYYDEEISVESLTQSICDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDQEQGYQLYHAEPSGTFYRFNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLY 225
           +   + +  A  L L+ L +  +   L  D  + +++   +  K+Y
Sbjct: 187 WHSSLTLKEAELLVLRILKQVMEEK-LDEDNAQLSSVTKEDGFKVY 231

>Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON}
           similar to Ashbya gossypii AER296W
          Length = 261

 Score =  148 bits (373), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 83/203 (40%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  I  A++GLT+DA  +I  ARI +  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEVDKHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDGAIELALKTLSKTTD 202
           +   + +  A  L LK L +  +
Sbjct: 187 WYSSLTLKEAELLVLKILKQVME 209

>KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  147 bits (372), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 122/203 (60%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+   +G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK----QG 121
           +  +   +  A++GLT+DA  +I  AR+ +  +   Y+EDI +E L + + D+     +G
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSSVTHNLYYDEDISIESLTQSICDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDSEQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDGAIELALKTLSKTTD 202
           +   + +  A  L LK L +  +
Sbjct: 187 WHSSLTLKEAELLVLKILKQVME 209

>Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432)
           [750 nt, 250 aa]
          Length = 249

 Score =  147 bits (371), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 130/214 (60%), Gaps = 5/214 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKL-LEQDTST 63
           RY    T FSP G+L Q++YAL ++    T++GI A +G+++A E+K +S L L +D S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTEDVS- 62

Query: 64  EKLYRLNDKIVVAVAGLTSDAEILINTARIHAQ-NYLKTYNEDIPVEILVKRLSDIKQGY 122
            K+  L   I    +G+  D  +L++ +R  A  NY + Y E  P ++LV  ++ I Q  
Sbjct: 63  -KISLLTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKD 182
           TQ GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATAIGKGSIAAKTFLEKRWNN 181

Query: 183 DIKVDGAIELALKTLSKTTDSSALTYDRVEFATI 216
           +++++ AI +AL TL ++ +      D +E A +
Sbjct: 182 ELELEDAIHIALLTLKESVEGE-FNGDTIEIAIV 214

>Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  147 bits (371), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 129/213 (60%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKTSSPLAMSETLS- 62

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQ-NYLKTYNEDIPVEILVKRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 IKVDGAIELALKTLSKTTDSSALTYDRVEFATI 216
           ++++ AI +AL TL ++ +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII 214

>Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON}
           (252377..253141) [765 nt, 255 aa]
          Length = 254

 Score =  147 bits (371), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 127/204 (62%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI  E+ +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGENCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           + ++++ ++++ +GL +D+ ILI  ARI AQ++  T  + I VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDNHVILSFSGLNADSRILIEKARIEAQSHKLTLEDPISVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYD-DRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY---K 181
           GG+RPFG+S + AG+D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGISTLIAGFDPNDKTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNYDRNE 183

Query: 182 DDIKVDGAIELALKTLSKTTDSSA 205
               V+  ++L +K+L +   + A
Sbjct: 184 PPKTVEECVKLTVKSLLEVVQTGA 207

>Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  147 bits (371), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 74/220 (33%), Positives = 131/220 (59%), Gaps = 7/220 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  ++ +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  +V++ +GL +D+ ILI  AR+ AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYG-YQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDARDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGEN 221
               V+  ++L +++L +   + A     +E   +K   N
Sbjct: 184 PPATVEECVKLTVRSLLEVVQTGA---KNIEITVVKPDSN 220

>Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  147 bits (371), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 126/204 (61%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  ++ +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  +V++ +GL +D+ ILI  AR+ AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYG-YQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDSRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDIKVDGAIELALKTLSKTTDSSA 205
               V+  ++L +++L +   + A
Sbjct: 184 PPATVEECVKLTVRSLLEVVQTGA 207

>ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 254

 Score =  147 bits (371), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 74/218 (33%), Positives = 127/218 (58%), Gaps = 7/218 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYA E++     A+GI  +D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYASEAVKRGTCAVGIKGKDCVVLGCERRSTLKLQDSRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  +V++ +GL +D+ ILI  AR+ AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVSVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYD-DRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD- 183
           GG+RPFGV+ + AG+D D    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVATLIAGFDKDDDTPKLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 --IKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLG 219
                D  + L  ++L +   + A     +E   ++ G
Sbjct: 184 PPATADECVRLTTRSLLEVVQTGA---KNIEITVVRPG 218

>Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  147 bits (371), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 126/204 (61%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  ++ +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  +V++ +GL +D+ ILI  AR+ AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  VSKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYG-YQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDIKVDGAIELALKTLSKTTDSSA 205
               V+  ++L +++L +   + A
Sbjct: 184 PPATVEDCVKLTVRSLLEVVQTGA 207

>YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha 4
           subunit of the 20S proteasome; may replace alpha 3
           subunit (Pre9p) under stress conditions to create a more
           active proteasomal isoform; GFP-fusion protein relocates
           from cytosol to the mitochondrial surface upon oxidative
           stress
          Length = 254

 Score =  147 bits (371), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 126/204 (61%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  ++ +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  +V++ +GL +D+ ILI  AR+ AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYG-YQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDIKVDGAIELALKTLSKTTDSSA 205
               V+  ++L +++L +   + A
Sbjct: 184 PPATVEECVKLTVRSLLEVVQTGA 207

>TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  147 bits (370), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 86/248 (34%), Positives = 142/248 (57%), Gaps = 18/248 (7%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKL-LEQDTST 63
           RY    T FSP G+L Q++YAL ++    T++GI A +G+++A E+K +S L L +D S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKTSSSLALTEDIS- 62

Query: 64  EKLYRLNDKIVVAVAGLTSDAEILINTARIHAQ-NYLKTYNEDIPVEILVKRLSDIKQGY 122
            K+  L   I    +G+  D  +L++ +R  A  NY + Y E    ++LV  ++ + Q  
Sbjct: 63  -KISALTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPSTKLLVSEIAKVMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKD 182
           TQ GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA S+G  ++AA+T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNN 181

Query: 183 DIKVDGAIELALKTLSKTTDSSALTYDRVEFATIK------------LGENGKLYQKVFK 230
           +++++ AI +AL TL ++ +      D +E A +              GE G  ++K+  
Sbjct: 182 ELELEDAIHIALLTLKESVEGE-FNGDTIEIAVVGDENNDLLGYKGVEGEVGPRFRKL-S 239

Query: 231 PEEIQTLL 238
           P+EI   L
Sbjct: 240 PQEINDRL 247

>Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa]
           {ON} similar to Ashbya gossypii AAR012C  1-intron
          Length = 251

 Score =  147 bits (370), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 121/204 (59%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP G ++QVEYALE++      +G+   D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGVKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  ++++ AGL +D+ ILI  AR+ AQ++  T  + + VE + + ++ ++Q YTQ 
Sbjct: 64  ISKIDRHVILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y    
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTRPRLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYSKHN 183

Query: 182 DDIKVDGAIELALKTLSKTTDSSA 205
                +  ++L +K+L +   + A
Sbjct: 184 PPTSEEACVKLTVKSLLEVVQTGA 207

>Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  147 bits (370), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 129/213 (60%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLS- 62

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQ-NYLKTYNEDIPVEILVKRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 IKVDGAIELALKTLSKTTDSSALTYDRVEFATI 216
           ++++ AI +AL TL ++ +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII 214

>YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}
           PRE8Alpha 2 subunit of the 20S proteasome
          Length = 250

 Score =  146 bits (369), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 129/213 (60%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLS- 62

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQ-NYLKTYNEDIPVEILVKRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 IKVDGAIELALKTLSKTTDSSALTYDRVEFATI 216
           ++++ AI +AL TL ++ +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII 214

>KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 262

 Score =  146 bits (369), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG++  +GIVL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTNEGIVLGVEKRVTSALLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  I  A++GLT+DA  ++  AR++A  +   Y+E I VE L + + D+     +G
Sbjct: 67  IVEVDTHIGCAMSGLTADARSMLEHARVNAVTHDLYYDEKITVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ +  GYD   G+QLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIGGYDQEQGFQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDGAIELALKTLSKTTD 202
           +   + +  A  L LK L +  +
Sbjct: 187 WHSSLTLKEAESLVLKILKQVME 209

>AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR253C (PUP2)
          Length = 260

 Score =  146 bits (369), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 83/203 (40%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  I  A++GLT+DA  +I  ARI +  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEIGVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDGAIELALKTLSKTTD 202
           +   + +  A  L LK L +  +
Sbjct: 187 WYSSLTLKEAELLVLKILKQVME 209

>CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253c PUP2
          Length = 260

 Score =  146 bits (369), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 124/203 (61%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG++  +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  +  A++GLT+DA  ++  AR+ A  +   Y+EDI +E L + + D+     +G
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMLEHARVSAVTHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDGAIELALKTLSKTTD 202
           +   + +  A +L LK L +  +
Sbjct: 187 WHSSLTLKEAEQLVLKILKQVME 209

>KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  145 bits (367), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 132/226 (58%), Gaps = 8/226 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TA+GI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAVGICTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  +  A++GLT+DA  +I  AR+ A ++   Y+EDI +E L + + D+     +G
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMIEHARVAAVSHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLY 225
           +   + +  A  L LK L +  +   L  +  + + +   +  K+Y
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSCVTKSDGFKIY 231

>TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  145 bits (366), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 91/254 (35%), Positives = 139/254 (54%), Gaps = 9/254 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I  A++GLT+DA  +I  AR  A  +   Y+ED+ VE L + + D+   + + 
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDMSVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
                    RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDKESGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTLLV 239
           +   + +  A  L LK L +  +   L  +  + ++    +  K+Y      E I+ L  
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSTTKEDGFKIYDDSKTAEIIKELKE 245

Query: 240 KNGITKAGEDEDEE 253
           K    +A ED D E
Sbjct: 246 KEA-QEAPEDRDVE 258

>NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  145 bits (365), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 129/213 (60%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL +++   T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQ-NYLKTYNEDIPVEILVKRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A  NY + Y    P ++LV  ++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGVYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHKGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 IKVDGAIELALKTLSKTTDSSALTYDRVEFATI 216
           ++++ AI +AL TL ++ +      D +E   I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIGVI 214

>SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,
           250 aa] {ON} highly similar to uniprot|P23639
           Saccharomyces cerevisiae YML092C PRE8 20S proteasome
           beta-type subunit
          Length = 250

 Score =  145 bits (365), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 128/213 (60%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+++A E+K +S L   + S  
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTE-SLS 62

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQ-NYLKTYNEDIPVEILVKRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A  +Y + Y E  P +ILV  ++   Q  T
Sbjct: 63  KVALITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKILVSEIAKTMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AGYD+  GY LY  +PSG+Y  WKA ++G + +AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKSATAAKTFLEKRWNEE 182

Query: 184 IKVDGAIELALKTLSKTTDSSALTYDRVEFATI 216
           ++++ AI +AL TL ++ +      D +E A +
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAIV 214

>TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON}
           Anc_7.120 YOL038W
          Length = 256

 Score =  144 bits (363), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 76/240 (31%), Positives = 136/240 (56%), Gaps = 10/240 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYA E++     A+GI   D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYAAEAVKRGTCAVGIKGRDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  +V++ +GL +D+ ILI  AR+ AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISTIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD- 183
           GG+RPFGV+ + AG+D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVATLIAGFDPQDDTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 --IKVDGAIELALKTLSKTTDSSA------LTYDRVEFATIKLGENGKLYQKVFKPEEIQ 235
                +  ++L +++L +   + A      L     +  T+   E GK  + + + +++Q
Sbjct: 184 PPATAEECVKLTVRSLLEVVQTGAKNIEITLVKPGAQIVTLTAEEIGKYVEDIEREKQLQ 243

>KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}
           Anc_5.64 YGR253C
          Length = 267

 Score =  144 bits (363), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 124/217 (57%), Gaps = 8/217 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I  A++GLT+DA  +I  AR  A  +   Y+E+I VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTSAITHDLYYDENIKVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
                    RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDADDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATI 216
           +   + +  A  L LK L +  +   L  + V+   I
Sbjct: 187 WHSSLNMRDAEVLTLKILKQVMEEK-LDQNNVQLCCI 222

>TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  143 bits (361), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 131/220 (59%), Gaps = 5/220 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YA  ++    T+IGI A +G+V+A+E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGIKATNGVVIASEKKSSSPLALTETLS- 62

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQ-NYLKTYNEDIPVEILVKRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSVITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AGYD+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  +  +
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHSGFGLYQVDPSGSYFPWKATAIGRGSTAAKTFLEKRWNAE 182

Query: 184 IKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGK 223
           ++++ AI + L TL ++ +      D +E A +  GE  K
Sbjct: 183 LELEDAIHIVLLTLKESVEGE-FNGDTIEIAVV--GEENK 219

>ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253C PUP2 Alpha subunit of the 20S
           proteasome involved in ubiquitin-dependent catabolism
           human homolog is subunit zeta
          Length = 260

 Score =  142 bits (359), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 87/238 (36%), Positives = 134/238 (56%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G++L  E++  S LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVILGVEKRANSPLLEAD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  I  A++GLT+DA  +I  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  ILEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDENISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTL 237
           +   + +  A  L LK L +  +   L  +  + ++I   E  K+Y      E I+ L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSITKEEGFKIYDDKKTAEIIKAL 243

>ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  141 bits (355), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 126/213 (59%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YA  ++    T+IG+ A +G+V+A E+K +S L   +T   
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGVKATNGVVIATEKKSSSPLALTET-LN 62

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQ-NYLKTYNEDIPVEILVKRLSDIKQGYT 123
           K+ ++   I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KISQITPNIGTVYSGMGPDYRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RP+G S + AGYD+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + ++
Sbjct: 123 QSGGVRPYGASLLVAGYDEHTGFGLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNEE 182

Query: 184 IKVDGAIELALKTLSKTTDSSALTYDRVEFATI 216
           ++++ AI   L TL ++ +      D +E A I
Sbjct: 183 LELEDAIHTVLLTLKESVEGE-FNGDTIEIAVI 214

>TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {ON}
           Anc_8.871 YML092C
          Length = 256

 Score =  140 bits (353), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 122/219 (55%), Gaps = 9/219 (4%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    TA+GI A +G+VLA E+K  S L   + S +
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYALTAVKQGVTALGIKATNGVVLATEKKSGSSLALAE-SLD 62

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQ-NYLKTYNEDIPVEILVKRLSDIKQGYT 123
           K+  L   I    AG+  D  +L++ AR  A  NY + Y E  P   LV  ++ I Q  T
Sbjct: 63  KISLLTPNIGTVYAGMGPDCRVLVDKARKAAHTNYKRVYGEYPPTRQLVADVAAIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDD------RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
           Q GG+RPFGVS + AG+D+        G+ LY  +PSG Y  WKA +VG    AA+T L+
Sbjct: 123 QSGGVRPFGVSLLVAGHDNANENDSNSGFALYQVDPSGAYFPWKATAVGRGAVAAKTFLE 182

Query: 178 VDYKDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATI 216
             + D+++++ A+ +AL  L +  +      D +E A +
Sbjct: 183 KRWHDELELEDAVHIALLALREAVEGE-FNGDTLEIAVV 220

>YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}
           PUP2Alpha 5 subunit of the 20S proteasome involved in
           ubiquitin-dependent catabolism; human homolog is subunit
           zeta
          Length = 260

 Score =  140 bits (352), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 87/238 (36%), Positives = 133/238 (55%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  I  A++GLT+DA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTL 237
           +   + +  A  L LK L +  +   L  +  + + I   +  K+Y      E I+ L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSCITKQDGFKIYDNEKTAELIKEL 243

>Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  140 bits (352), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 87/238 (36%), Positives = 133/238 (55%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  I  A++GLT+DA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTL 237
           +   + +  A  L LK L +  +   L  +  + + I   +  K+Y      E I+ L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSCITKEDGFKIYDDSKTAELIKEL 243

>KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {ON}
           Anc_7.120 YOL038W
          Length = 266

 Score =  139 bits (351), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 108/176 (61%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+     +VL  ER+ T KL +  T+  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVRRGTCAVGVKGPRCVVLGCERRSTLKLQDPRTTPSK 63

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  + ++ AGL++DA +LI  AR  AQ++  T  + + VE + + ++ I+Q YTQ 
Sbjct: 64  VALVDTHVALSFAGLSADARVLIERARTEAQSHRLTLEDPVSVEYMARYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDD-RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GG+RPFGVS + AG+D      +LY + PSG Y+ W A ++G N    +  L+ +Y
Sbjct: 124 GGVRPFGVSTLVAGFDSGDDTPRLYHTEPSGIYSAWTAQTIGRNAKTVREFLEKNY 179

>Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C
           (REAL)
          Length = 260

 Score =  139 bits (350), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 87/238 (36%), Positives = 133/238 (55%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  I  A++GLT+DA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTL 237
           +   + +  A  L LK L +  +   L  +  + + I   +  K+Y      E I+ L
Sbjct: 187 WHSSLTLKEAELLILKILKQVMEEK-LDENNAQLSCITKQDGFKIYDDKKTAELIKEL 243

>Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  139 bits (349), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 129/226 (57%), Gaps = 8/226 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  I  A++GLT+DA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLY 225
           +   + +  A  L LK L +  +   L  +  + + I   +  K+Y
Sbjct: 187 WHSSLSLKEAELLILKILKQVMEEK-LDENNAQLSCITKEDGFKIY 231

>ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 290

 Score =  126 bits (317), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 101/172 (58%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ V+SKLL    +  K
Sbjct: 8   YDLANSVFSPDGRNFQVEYAVKAVENGTTSIGIRCNDGVVFAVEKLVSSKLLVPKRNV-K 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  +    +GL  D   L+N  R  AQ++ KT+ E IP++ L  RL    Q +T +
Sbjct: 67  IQTIDRHVGCVYSGLIPDGRHLVNRGREEAQSHKKTFGESIPLQALADRLGYYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G DD+ G  LY   PSG + G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGVDDK-GPHLYMLEPSGTFWGYKGAATGKGRQTAKAELE 177

>TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON}
           Anc_7.20 YOR362C
          Length = 278

 Score =  125 bits (315), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 70/195 (35%), Positives = 108/195 (55%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI  +DG+V A E+ ++SKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCDDGVVFAVEKIISSKLLVPKRNV-K 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A N+ K Y + IPV  L  R+S   Q YT +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRYLVNRGREEASNFKKLYTKPIPVSALADRISQYVQAYTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYK---D 182
             +RPFG+S I  G D+  G  LY   PSG   G+K  + G    AA+  L+  +    D
Sbjct: 127 NSVRPFGISAIIGGIDED-GSHLYMVEPSGTCWGYKGAATGKGRQAAKAELEKLFDRSTD 185

Query: 183 DIKVDGAIELALKTL 197
            + V  AI+ A + +
Sbjct: 186 GLSVKDAIKEAARVI 200

>KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {ON}
           highly similar to uniprot|P21242 Saccharomyces
           cerevisiae YOR362C PRE10 20S proteasome alpha-type
           subunit
          Length = 277

 Score =  124 bits (310), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/227 (32%), Positives = 121/227 (53%), Gaps = 4/227 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA+++  +  T++G+  +DGIVLA E+ VTSKLL      +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAAENGATSVGMKFKDGIVLAVEKLVTSKLL-VPGKNKK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  +  A +GL  D   L+N  R  A ++ KTY   IP+  L  RL    Q +T +
Sbjct: 67  IQTIDRHVGCAYSGLMPDGRHLVNRGREEASSFKKTYATPIPLPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--VDYKDD 183
             +RPFG++ I  G DD  G  LY   PSG Y G+K  + G    +A+  L+  +  K +
Sbjct: 127 NSVRPFGITAIVGGVDDD-GAHLYMLEPSGTYWGYKGAATGKGRQSAKAELEKVISNKPE 185

Query: 184 IKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFK 230
           +    A++ A + +    + +      +E +   + E   L++ V K
Sbjct: 186 LDAREAVKEAARIIYLAHEDNKEKDFELEMSWCSISETNGLHKAVPK 232

>Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  124 bits (310), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TSKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K YN  IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYNTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 aa]
           {ON} similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 275

 Score =  123 bits (309), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 121/227 (53%), Gaps = 4/227 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI  EDG+VLA E+ +TSKLL      +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSLGIKCEDGVVLAVEKLITSKLL-VPGKNKK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y+  IP+     R+    Q +T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKMYSTPIPIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--VDYKDD 183
             +RPFGV+ I+ G D   G  LY   PSG Y G+K+ + G    +A+  L+   +   +
Sbjct: 127 NSVRPFGVTAIFGGVDSD-GAHLYMLEPSGTYWGYKSAATGKGRQSAKAELEKLSNKNPN 185

Query: 184 IKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFK 230
           +    A++ A + +    + +      +E +   L E   L+++V K
Sbjct: 186 LTAREAVKEAARIIYAAHEDNKEKEFELELSWCSLSETNGLHKEVPK 232

>Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON}
           complement(86524..87348) [825 nt, 275 aa]
          Length = 274

 Score =  123 bits (309), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 101/172 (58%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI   DG+V A E+ ++SKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCNDGVVFAVEKLISSKLLVPKKNV-K 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  ++++ + Y++ IP+     R+    Q +T +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESKSFSQMYSKRIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G DD  G  LY   PSG+Y G+K  + G+    A+T L+
Sbjct: 127 NSVRPFGVSAIFGGIDDE-GSHLYMIEPSGSYWGYKGAAAGSGRQIAKTELE 177

>Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}
           YOR362C (REAL)
          Length = 292

 Score =  124 bits (310), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 99/172 (57%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ +TSKLL    +T K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCDDGVVFAVEKLITSKLLVPQKNT-K 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y   IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKDGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362c PRE10
          Length = 290

 Score =  123 bits (309), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA +++ +  T+IGI   DG+V A E+ +TSKLL  + +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYANKAVENGATSIGIKFNDGVVFAVEKIITSKLLVPNKNL-K 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I V  +GL  D   L+N AR  +QN+ K Y   IPV+   +R+    Q +T  
Sbjct: 67  IQTVDKHIGVVYSGLIPDGRHLVNRAREESQNFRKMYGSAIPVDAFAERVGQYVQAHTLF 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G  D+ G  LY   PSG Y G+   + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGC-DKNGPHLYMLEPSGTYWGYNGAATGKGRQTAKAELE 177

>NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  122 bits (307), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 96/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ VTSKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCDDGVVFAVEKIVTSKLLVPKRNV-K 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D    +N  R  A N+ K Y+  IP+     R+    Q +T +
Sbjct: 67  IQGIDRHIGCVYSGLIPDGRHFVNRGREEASNFKKLYSNAIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D+  G  LY   PSG Y G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGIDEN-GPHLYMLEPSGTYWGYKGAATGKGRQTAKAELE 177

>KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20
           YOR362C
          Length = 279

 Score =  122 bits (306), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 67/188 (35%), Positives = 102/188 (54%), Gaps = 10/188 (5%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA +++ +  T++G++ EDG+VLA E+ V SKLL + +   K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAAKAVENGATSVGLLCEDGVVLAVEKLVASKLLVKASPQNK 67

Query: 66  LYRLNDKIV-------VAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDI 118
               N KI         A +GL  D   L+N AR  +Q + + Y  DIP   L  R+   
Sbjct: 68  GSGANTKIQTVGRHIGCACSGLVPDGRHLVNRAREESQQFKQLYKRDIPPVALADRMGQY 127

Query: 119 KQGYTQHGGLRPFGVSFIYAGYDDRYG-YQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
            Q +T +  +RPFGV+ I+ G D       LY   PSG Y G++  + G    +A+  L+
Sbjct: 128 VQAHTLYNSVRPFGVAAIFGGVDPETAEPHLYMLEPSGVYWGYRGAATGKGRQSAKAELE 187

Query: 178 --VDYKDD 183
             +  +DD
Sbjct: 188 KLISSRDD 195

>Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  122 bits (306), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 119/226 (52%), Gaps = 5/226 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TSKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y   IPV     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYKTPIPVPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--VD-YKD 182
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+  VD + D
Sbjct: 127 NSVRPFGVSTIFGGV-DKDGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDQHTD 185

Query: 183 DIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKV 228
            +    A++ A + +    + +      +E +   L E   L++ V
Sbjct: 186 GLTAKEAVKQAARIIYLAHEDNKEKDFELEMSWCSLSETNGLHKFV 231

>KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20
           YOR362C
          Length = 281

 Score =  121 bits (304), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 99/172 (57%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TSKL+  + +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCNDGVVFAVEKLITSKLMVPNKNI-K 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  + ++ K Y + IP+  L  RL    Q +T +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRHLVNRGREESSSFKKLYGKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG++ I+ G D+  G  LY   PSG+Y G+K  + G     A+  L+
Sbjct: 127 NSVRPFGITAIFGGVDED-GSHLYMLEPSGSYWGYKGAATGKGRQTAKAELE 177

>ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 bp,
           279 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YOR362C (PRE10); 1-intron
          Length = 279

 Score =  121 bits (304), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 99/172 (57%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ +TSKLL    + +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIRCKDGVVFAVEKLITSKLLVPHKN-KK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y + IP+     R+    Q +T +
Sbjct: 67  IQTVDKHIGCVYSGLMPDGRHLVNIGRQEAADFRKYYRQPIPLPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG+  I+ G D++ G  LY   PSG Y G++  + G    AA+  L+
Sbjct: 127 NSVRPFGIIAIFGGVDEK-GPHLYMLEPSGAYWGYRGAAAGKGRQAAKAELE 177

>YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}
           PRE10Alpha 7 subunit of the 20S proteasome
          Length = 288

 Score =  121 bits (304), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TSKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y   IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}
           similar to Ashbya gossypii ADR401C
          Length = 285

 Score =  121 bits (304), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 121/232 (52%), Gaps = 7/232 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ + SKLL   +  EK
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSIGIKCKDGVVFAVEKLINSKLL-VPSKNEK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y + I +     R+    Q +T +
Sbjct: 67  IQTIDKHIGCVYSGLMPDGRHLVNIGRQEANSFRKLYRKPITIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ---VDYKD 182
             +RPFG+  I+ G DD  G  LY   PSG Y G+K  + G    +A+  L+      K 
Sbjct: 127 NSVRPFGIIAIFGGVDDE-GAHLYMLEPSGAYWGYKGAATGKGRQSAKAELEKLVAGDKP 185

Query: 183 DIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEI 234
           ++    A++ A + +    + +      +E +   + E   L+++V  P+E+
Sbjct: 186 ELSAREAVKEAARIIYVAHEDNKEKEFEIELSWCSISETNGLHERV--PKEL 235

>TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON}
           Anc_7.20 YOR362C
          Length = 274

 Score =  120 bits (300), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 73/226 (32%), Positives = 121/226 (53%), Gaps = 5/226 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QV+YA++++ +  T+IGI  +DG+V A E+ VTSKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVQYAVKAVENGTTSIGIKFKDGVVFAVEKLVTSKLLVPKKNV-K 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  + ++ K Y + IP+  L  RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLMPDGRQLVNRGREESSSFKKLYQKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--VD-YKD 182
             +RPFGV+ I+ G D+  G  LY   PSG + G+K  + G     A+  L+  VD + +
Sbjct: 127 NSVRPFGVTAIFGGIDEE-GPHLYMLEPSGAHWGYKGAATGKGRQTAKAELEKLVDKHPE 185

Query: 183 DIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKV 228
            +    A++ A K +    + +      +E +   L E G L++ V
Sbjct: 186 GLTGREAVKQAAKIIHMAHEDNKEKDFELEISWCSLSETGGLHKFV 231

>Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to
           Ashbya gossypii AGL089W
          Length = 246

 Score =  118 bits (296), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 123/248 (49%), Gaps = 17/248 (6%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I  ++ +VL  ++KV  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIKGKNCVVLVNQKKVPDKLLDP 60

Query: 60  DTSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK 119
            T +  ++ ++  I +   G   DA  +    +  A  +   Y  DIPV +L KRL+++ 
Sbjct: 61  ATVS-YMFPISKHIGMCATGPIGDARNVAVRCKSMAAEFRYEYGYDIPVHVLAKRLANLA 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
           Q YTQ   +RP GV   +   D+  G  ++  +P+G YTG+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEKGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 YKDDIKVDG--------AIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKP 231
           +K  + VD          +E A+  +S +  +   + D      + + E  K Y  V   
Sbjct: 180 FK-KLNVDCLQEETSEKVVEFAITQMSASLGTDFSSKD----LEVGIAEADKFY--VLGQ 232

Query: 232 EEIQTLLV 239
           EEI+  LV
Sbjct: 233 EEIEQRLV 240

>AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL011C (SCL1)
          Length = 246

 Score =  118 bits (295), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 95/182 (52%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I  +   VL  ++KV  KLLE 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIRGKSCTVLVNQKKVPDKLLEP 60

Query: 60  DTSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK 119
            T T  L+ +   I +   G  +DA  +    R  A  +   Y  D+PV +L KR +++ 
Sbjct: 61  STVT-YLFPIAKHIGMCATGPIADARNVAVRCRAMAAEFRYEYGYDMPVHVLAKRFANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
           Q YTQ   +RP GV   +   D+  G  ++  +P+G YTG+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEEGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20
           YOR362C
          Length = 277

 Score =  116 bits (291), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 95/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR++QVEYA +++ +  T+IGI   DG+V A E+ ++SKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRIFQVEYANKAVENGATSIGIKCTDGVVFAVEKIISSKLLVPKKNV-K 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  + N+ K Y + I +     R+    Q YT +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESANFKKVYGQPIGIPAFADRIGQYIQAYTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G D   G  LY   P+G + G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSAIFGGIDSE-GPHLYMVEPNGAFWGYKGAATGKGRQSAKAELE 177

>SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369)
           [846 bp, 281 aa] {ON} similar to uniprot|P21242
           Saccharomyces cerevisiae YOR362C PRE10 20S proteasome
           alpha-type subunit
          Length = 281

 Score =  116 bits (291), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +++SP+GR +QVEYA++++ +  T++GI   DG+V A E+ VTSKLL    + +K
Sbjct: 8   YDLSNSVYSPDGRNFQVEYAVKAVENGATSVGIKFRDGVVFAVEKLVTSKLLVPGKN-KK 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y++ IPV     R+    Q +T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKLYSQPIPVPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G  D+ G  LY   PSG Y G+   + G    +A+  L+
Sbjct: 127 NSVRPFGVTAIFGGV-DKDGAHLYMLEPSGTYWGYTGAATGKGRQSAKAELE 177

>NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  116 bits (290), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 96/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA +++ +  T+IGI  +DG+V A E+ +TSKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAGKAVENGATSIGIKCKDGVVFAVEKIITSKLLVPKKNV-K 66

Query: 66  LYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y+  IP+    +RL    Q +T +
Sbjct: 67  IQGVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYDLPIPISAFAERLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D++ G  LY   PSG   G+   + G     A+  L+
Sbjct: 127 NSVRPFGVTSIFGGIDEK-GPHLYMLEPSGTCWGYNGAATGKGRQTAKAELE 177

>KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  114 bits (286), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 105/205 (51%), Gaps = 9/205 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     +I I ++   V+ +++KV  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKAANQPNLNSIAIRSKTASVVISQKKVPDKLLDP 60

Query: 60  DTSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK 119
            T +  ++ +   I     G   DA  +    +  A  +   Y  DIP  +L KR++++ 
Sbjct: 61  KTVS-YIFPVARHIGFCATGPVPDARNIALRCKAEASEFRYKYGYDIPCSVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
           Q YTQ   +RP G+   +  YD+  G  ++  +P+G YTG+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGIILTFISYDEETGPAIFKCDPAGYYTGYKATATGPKQQELNSALEKH 179

Query: 180 YK--DDIKVD-----GAIELALKTL 197
           +K   D K+D       +E  + TL
Sbjct: 180 FKKLKDDKIDEESWEKTVEFGITTL 204

>TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  114 bits (286), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 102/201 (50%), Gaps = 10/201 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     +I I      V+  ++KV  KLL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNKCAVIVNQKKVPDKLLDPSTVS- 70

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQ 124
            ++ ++  I +   G   DA+     A+     Y   Y  D+P ++L KR+++I Q YTQ
Sbjct: 71  YIFPISKTIGLVANGPIPDAKNAATKAKTETAEYRYKYGYDMPCDVLAKRMANIAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGA-----NTSAAQTLLQVD 179
              +RP GV   +  YD+  G  +Y ++P+G Y G+KA + G      NT       + D
Sbjct: 131 RAYMRPLGVILTFISYDEELGPSIYKTDPAGYYVGYKATATGPKQQEINTGLENWFKKND 190

Query: 180 YKDDIKVDG---AIELALKTL 197
            K+ I  D     +E A+  L
Sbjct: 191 VKEKINEDAWEKVVEFAITQL 211

>Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {ON}
           complement(125355..126125) [771 nt, 257 aa]
          Length = 256

 Score =  112 bits (281), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 96/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     +I I   +  V+  ++KV  KLL+ +T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNNCSVIINQKKVPDKLLDAETVS- 71

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQ 124
            +++++  I +   G   DA       +  A  +   Y  D+PV++L KR++++ Q YTQ
Sbjct: 72  YIFQISRTIGMVANGPIPDARNAAIRCKAEAAEFRYKYGYDMPVDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYK 181
              +RP GV   +   D+  G  +Y S+PSG Y G+KA + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFVSLDEEKGPSIYKSDPSGYYVGYKATATGPKQQEISTSLENFFK 188

>KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  110 bits (276), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 94/182 (51%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I   D  V+  ++KV  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSMAIRGNDCCVVINQKKVPDKLLDP 60

Query: 60  DTSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK 119
            T +  L+ ++  I +   G   DA      A+     Y   Y  D+P ++L KR++++ 
Sbjct: 61  STMS-YLFPISKHIGMVANGPIPDARNAALRAKAEVAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
           Q YTQ   +RP GV   +   D+  G  +Y  +P+G Y G+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C
           (SCL1) - Proteasome subunit YC7alpha/Y8 (protease yscE
           subunit 7) [contig 207] FULL
          Length = 246

 Score =  110 bits (275), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 61/182 (33%), Positives = 97/182 (53%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     +I I   D  V+ +++KV  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSIAIRGTDCCVIISQKKVPDKLLDP 60

Query: 60  DTSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK 119
            T +  L++++  + +   G   DA      A+  A  Y   Y  D+P ++L KR++++ 
Sbjct: 61  STMS-YLFQISRHVGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
           Q YTQ   +RP GV   +   D+  G  +Y  +P+G Y G+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON}
           YML092C (PRE8) - proteasome component Y7 [contig 336]
           FULL
          Length = 173

 Score =  107 bits (267), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 55/139 (39%), Positives = 86/139 (61%), Gaps = 4/139 (2%)

Query: 80  LTSDAEILINTAR--IHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIY 137
           +  D  +LI+ +R   H Q Y + YNE  P +ILV  ++ I Q  TQ GG+RPFGVS + 
Sbjct: 1   MGPDFRVLIDKSRKVAHTQ-YKRIYNEYPPTKILVAEVAKIMQEATQSGGVRPFGVSLLV 59

Query: 138 AGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTL 197
           AGYD+  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D+++++ AI +AL TL
Sbjct: 60  AGYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDELELEDAIHIALLTL 119

Query: 198 SKTTDSSALTYDRVEFATI 216
            ++ +      D +E A +
Sbjct: 120 KESVEGE-FNGDTIEIAVV 137

>YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}
           SCL1Alpha 1 subunit of the 20S proteasome involved in
           the degradation of ubiquitinated substrates; 20S
           proteasome is the core complex of the 26S proteasome;
           essential for growth; detected in the mitochondria
          Length = 252

 Score =  109 bits (272), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 97/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +  +D  V+ +++KV  KLL+  T+  
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDP-TTVS 70

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P ++L KR++++ Q YTQ
Sbjct: 71  YIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYK 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  108 bits (271), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 111/225 (49%), Gaps = 10/225 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + +D + +++AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDDHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVEKAGYLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDDIKVDG----AIELALKTLSKTTDSSALTYDRVEFATIKLGEN 221
              IK+DG     I+  ++ +S++    +LT D +  A +  GEN
Sbjct: 177 DTFIKIDGNPDELIKAGIEAISQSLRDESLTVDNLSIAIV--GEN 219

>ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 253

 Score =  109 bits (272), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 105/202 (51%), Gaps = 10/202 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ I  ++  V+ +++KV  KLL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTSINSLAIRGKNCSVIISQKKVPDKLLDPSTVS- 70

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQ 124
            +++++  I + + G   DA      A+     +   +  D+P ++L KR++++ Q YTQ
Sbjct: 71  YIFKISKTIGMVINGPIPDARNAALRAKAETAEFRYKFGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ------- 177
              +RP GV   Y   D+  G  +Y S+P+G + G+KA + G       T L+       
Sbjct: 131 RAYMRPLGVIQTYVSVDEEQGPSIYKSDPAGYFVGYKATATGPKQQEITTRLENYIKKTP 190

Query: 178 -VDYKDDIKVDGAIELALKTLS 198
             DY  +   +  +E  + TL+
Sbjct: 191 SQDYMQEESWEKVVEFGITTLT 212

>TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.110
           YGL011C
          Length = 257

 Score =  109 bits (272), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 93/177 (52%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +   D  V+  ++KV  KLL+ DT + 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKACNQTNINSVAVRGNDCTVIINQKKVPDKLLDADTVS- 71

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQ 124
            ++ ++  I +   G   DA       +  A  +   Y  D+P ++L KR++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGPIPDARNAALRCKAEAAEFRYKYGYDMPADVLAKRMANLAQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYK 181
              +RP GV   +   D+  G  +Y S+PSG Y G+K  + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFISVDEEKGPSIYKSDPSGYYIGYKVTATGPKQQEIATSLENFFK 188

>Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  108 bits (270), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 101/183 (55%), Gaps = 3/183 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ I  ++  V+ +++KV  KLL+ +T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGKNCTVVISQKKVPDKLLDPNTVS- 70

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P ++L KR++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDI 184
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K   
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKS- 189

Query: 185 KVD 187
           K+D
Sbjct: 190 KID 192

>YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha 6
           subunit of the 20S proteasome
          Length = 234

 Score =  108 bits (269), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 70/220 (31%), Positives = 109/220 (49%), Gaps = 8/220 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN T     ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDDIKVDG----AIELALKTLSKTTDSSALTYDRVEFATI 216
              IK+DG     I+  ++ +S++    +LT D +  A +
Sbjct: 177 DTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIV 216

>Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  107 bits (268), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 70/220 (31%), Positives = 108/220 (49%), Gaps = 8/220 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       S+GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTSIGARSQGAKTYLERTL 176

Query: 181 KDDIKVDG----AIELALKTLSKTTDSSALTYDRVEFATI 216
              IK+DG     I+  ++ +S++    +LT D +  A +
Sbjct: 177 DTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAVV 216

>NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON}
           Anc_4.110
          Length = 253

 Score =  107 bits (268), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 95/177 (53%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGT-AIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +   +  V+  ++KV  KLL+  T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNVNSVAVRGTNCTVVINQKKVPDKLLDPSTVS- 71

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQ 124
            ++ ++  + +   G   DA      A++ A  +   Y  D+P ++L KR++++ Q YTQ
Sbjct: 72  YIFPISRHVGMVANGPIPDARNAAMRAKMEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYK 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPRQQEITTSLENYFK 188

>SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 248

 Score =  107 bits (268), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 57/184 (30%), Positives = 100/184 (54%), Gaps = 2/184 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I   + +V+ +++KV  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGTNCVVVVSQKKVPDKLLDS 60

Query: 60  DTSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIK 119
           +T +  +++++  + +   G   DA      A+  A  +   Y  D+P ++L KR++++ 
Sbjct: 61  NTVS-YIFKVSPHVGMVANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRIANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
           Q YTQ   +RP GV   +   D+  G  +Y  +P+G + G+KA + G       T L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEENGPSVYKCDPAGYFVGYKATATGPKQQELDTSLEKF 179

Query: 180 YKDD 183
           +K +
Sbjct: 180 FKKN 183

>Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  107 bits (268), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 97/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +  ++  V+ +++KV  KLL+  T+  
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDP-TTVS 70

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P ++L KR++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYK 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON}
           Anc_5.1 YMR314W
          Length = 233

 Score =  107 bits (266), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 121/242 (50%), Gaps = 13/242 (5%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +     L A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYACLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLK-TYNEDIPVEILVKRLSDIK 119
           +  +K+ + +D + +++AGL  DA +L N  R H  NY K  YN ++ +E +   LSD  
Sbjct: 58  SYQKKIIKCDDHVGLSLAGLAPDARVLSNFVRQHC-NYSKLVYNRELSMEKIGYLLSDKA 116

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
           Q  TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  ++T L+  
Sbjct: 117 QKNTQSYGGRPYGVGLLLVGY-DKSGPHLIEFQPSGNILELYGAAIGARSQGSRTYLERV 175

Query: 180 YKDDIKVDGAIEL---ALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQT 236
             D + V+ A EL    ++ L ++     L+   +  A +  GE+  L   V+  E +Q 
Sbjct: 176 MDDFLPVEDATELIKQGVEALRQSLKDETLSVKNLSIAIV--GED--LPFTVYDGEAVQP 231

Query: 237 LL 238
            L
Sbjct: 232 YL 233

>KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score =  106 bits (265), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 103/200 (51%), Gaps = 9/200 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGT-AIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ I  E   V+  ++KV  KLL+  T + 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNVNSMAIRGETCSVIVNQKKVPDKLLDPSTVS- 70

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQ 124
            ++ ++  I +   G   DA      A+  A  Y   Y  D+P ++L KR++++ Q YTQ
Sbjct: 71  YIFPISKTIGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYK--- 181
              +RP GV   +   D+  G  +Y S+P+G Y G+KA + G       T L+  +K   
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYKATATGPKQQEITTNLENYFKKSK 190

Query: 182 -DDIKVDG---AIELALKTL 197
            D +K D     +E A+  L
Sbjct: 191 TDTLKEDAWEKVVEFAITHL 210

>Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  106 bits (265), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 97/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +  ++  V+ +++KV  KLL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDPATVS- 70

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P ++L KR++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYK 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  106 bits (264), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 57/179 (31%), Positives = 96/179 (53%), Gaps = 2/179 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +   +  V+  ++KV  KLLE  T + 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGRNSTVVINQKKVPDKLLEASTVS- 71

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQ 124
            ++ ++  I +   G   DA      A+  A  Y   Y  D+P ++L KR++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGAIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
              +RP GV   +   D+  G  +Y ++P+G + G+KA + G       T L+  +K++
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYFVGYKATATGPKQQEISTRLENSFKNN 190

>Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  105 bits (263), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 68/220 (30%), Positives = 108/220 (49%), Gaps = 8/220 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R         +N  + +E     L D  Q
Sbjct: 58  SFQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAIERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDDIKVDG----AIELALKTLSKTTDSSALTYDRVEFATI 216
              IK+DG     I+  ++ +S++    +LT D +  A +
Sbjct: 177 DTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIV 216

>KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  105 bits (262), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 109/219 (49%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKFAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +++AGL  D  +L N  R         YN  + +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERTL 176

Query: 181 KDDIKVDGA---IELALKTLSKTTDSSALTYDRVEFATI 216
           +D +++D A   I +A++ L +      L+   +  A +
Sbjct: 177 QDYLELDDADDLIRVAVEALRQCLKDEVLSTKNLSIAVV 215

>CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011c SCL1
          Length = 254

 Score =  105 bits (262), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 95/177 (53%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +  ++  V+  ++KV  KLL+  T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNLNSLAVRGKNCSVIINQKKVPDKLLDPSTVS- 71

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQ 124
            +++++  I +   G   DA      A+  A  +   Y  D+P ++L KR++++ Q YTQ
Sbjct: 72  YIFKISKTIGMVANGPIPDARNAAARAKGEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYK 181
              +RP GV   +   D+  G  +Y  +P+G Y G+KA + G       T L+  YK
Sbjct: 132 RAYMRPLGVILTFISVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTTSLENYYK 188

>Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON}
           similar to Ashbya gossypii AGL336W
          Length = 233

 Score =  104 bits (259), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 65/192 (33%), Positives = 101/192 (52%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +E  +VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSEKYVVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R         YN ++ +      LSD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRNLSLVKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 176

Query: 181 KDDIKVDGAIEL 192
           ++ +K++ A EL
Sbjct: 177 EEYLKIETADEL 188

>CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314w PRE5
          Length = 233

 Score =  103 bits (256), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 69/219 (31%), Positives = 106/219 (48%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++D  VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKDYAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R         YN  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRKLSVEKAGHMLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYDNS-GPHLLEFQPSGNTLEVYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDIKVDGAIEL---ALKTLSKTTDSSALTYDRVEFATI 216
            D + +  A EL    ++ L ++     L  D +  A +
Sbjct: 177 DDYLAITDATELIKSGVEALRQSLKDETLNTDNLSIAVV 215

>Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {ON}
           YMR314W (PRE5) - alpha-type of subunit of 20S proteasome
           [contig 73] FULL
          Length = 233

 Score =  101 bits (251), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 107/219 (48%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +++AGL  D  +L N  R         YN  + +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERTL 176

Query: 181 KDDIKV---DGAIELALKTLSKTTDSSALTYDRVEFATI 216
            + +++   D  I +A++ L +      L+   +  A +
Sbjct: 177 NEYLEIEDEDELIGVAVEALKQCLKDETLSTKNLSIAIV 215

>TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON} 
          Length = 233

 Score =  101 bits (251), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 108/219 (49%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +++  V+ A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKNYAVITALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ R ++ + +++AGL  DA +L N  R         +N  + VE     LSD  Q
Sbjct: 58  SYQKKIIRCDEHLGLSLAGLAPDARVLSNYLRQQCNYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLIIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLERVM 176

Query: 181 KDDIKVDGAIEL---ALKTLSKTTDSSALTYDRVEFATI 216
              I+++   EL    ++ L ++     LT D +  A +
Sbjct: 177 DKYIEIEDPEELIKTCVEALRQSLKDETLTTDNLSIAIV 215

>NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON}
           Anc_5.1
          Length = 233

 Score =  100 bits (248), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 106/219 (48%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +A+AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SFQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSDMVFNRKLSVEKAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIVGY-DKSGPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDIKVDGAIEL---ALKTLSKTTDSSALTYDRVEFATI 216
              ++++ A EL    ++ L ++     L+ D +  A +
Sbjct: 177 DKFVEIEDAEELIKTGVEALKQSLKDETLSTDNLSIAIV 215

>Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON}
           complement(1850..2551) [702 nt, 234 aa]
          Length = 233

 Score = 99.8 bits (247), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 69/222 (31%), Positives = 109/222 (49%), Gaps = 13/222 (5%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VLAA ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNKYAVLAALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R         +N  + VE     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCHYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--- 177
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLLIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLEKVM 176

Query: 178 ---VDYKDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATI 216
              VD +D  ++   I+  ++ L ++     LT + +  A +
Sbjct: 177 DNFVDLEDPEEL---IKTCVEALRQSLKDETLTTENLSIAIV 215

>KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score =  100 bits (248), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 104/200 (52%), Gaps = 9/200 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +  ++  V+  ++KV  KLL+  T + 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGKNCAVVINQKKVPDKLLDPATLS- 70

Query: 65  KLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQ 124
            ++ ++  + +   G   DA      A+  A  +   Y  D+P + L KR++++ Q YTQ
Sbjct: 71  YIFPISRHVGMLANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDALAKRMANLAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ------- 177
              +RP GV   +  +D+  G  +Y ++P+G + G+KA + G       T L+       
Sbjct: 131 RAYMRPLGVILTFISFDEELGPSIYKTDPAGYFVGYKATATGPKQQEITTSLENYFKKNN 190

Query: 178 VDYKDDIKVDGAIELALKTL 197
           VD+ ++   +  +E A+  L
Sbjct: 191 VDHLEEESWEKVVEFAITHL 210

>AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR314W (PRE5)
          Length = 306

 Score =  100 bits (250), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 108/219 (49%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +   +VL A ++   +L    
Sbjct: 74  MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSNKYVVLVALKRNADEL---S 130

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + +D + +++AGL  DA +L N  R         Y  D+ V    + LSD  Q
Sbjct: 131 SYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQCNYSQLVYARDLSVVKAGQLLSDKAQ 190

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 191 KNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 249

Query: 181 KDDIKV---DGAIELALKTLSKTTDSSALTYDRVEFATI 216
           ++ +++   D  I+  ++ L  +     L+   +  A +
Sbjct: 250 EEYLEIEDADALIKHGVEALKHSLKDETLSTKNLSIAIV 288

>ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score = 99.4 bits (246), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/222 (29%), Positives = 107/222 (48%), Gaps = 7/222 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKLGSVTVGLRSNKHAVVVALKRNADDL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R         YN  + VE +   L D  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDARVLSNFLRQQCNYSQLVYNRKLSVERVGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLVVGYDNS-GPHLLEFQPSGNVLELYGTAIGARSQGAKTYLEKTL 176

Query: 181 KDDIKVDGA---IELALKTLSKTTDSSALTYDRVEFATIKLG 219
           +  ++V+     I+L ++ L ++     L+   +  A +  G
Sbjct: 177 EQFLEVEDPNELIKLGVEALRQSLKDETLSTKNLSIAVVGEG 218

>NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1
          Length = 233

 Score = 99.0 bits (245), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 107/219 (48%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKKHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +A+AGL  DA +L N  R         YN  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSSLIYNRKLSVEKAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  G+D+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIVGHDNS-GPHLLEFQPSGNTVELYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDIKVDGAIEL---ALKTLSKTTDSSALTYDRVEFATI 216
              I+++   EL    +++L ++     L+ + +  A +
Sbjct: 177 DQFIEIEDPEELIKTGVESLKQSLKDETLSTENLSIAIV 215

>KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score = 98.2 bits (243), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 65/192 (33%), Positives = 96/192 (50%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    V+ A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSTKYAVVVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + +D + V++AGL  DA +L N  R         YN  + +E     LSD  Q
Sbjct: 58  SYQKKIIKCDDHLGVSLAGLAPDARVLSNYLRQQCNYSSLVYNRKLALERAGYLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLIGYDNT-GAHLLEFQPSGNTLELYGTAIGARSQGAKTYLERVL 176

Query: 181 KDDIKVDGAIEL 192
            D  +++ A EL
Sbjct: 177 DDFREIEDADEL 188

>KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1
           YMR314W
          Length = 235

 Score = 97.8 bits (242), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 60/178 (33%), Positives = 94/178 (52%), Gaps = 6/178 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+Q+EYA+E+I      +G+ +++   + A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQLEYAIEAIKQGSVTVGLRSKNYACVVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLK-TYNEDIPVEILVKRLSDIK 119
           +  +K+ + +D + +++AGL  DA +L N  R    NY K  +N D+ VE     LSD  
Sbjct: 58  SYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQC-NYSKLVFNRDLSVEKAGFLLSDKA 116

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
           Q  TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  ++T L+
Sbjct: 117 QKNTQSYGGRPYGVGLLVVGY-DKTGPHLLEFQPSGNVMELYGTAIGARSQGSKTYLE 173

>TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5.1
           YMR314W
          Length = 233

 Score = 97.4 bits (241), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 63/192 (32%), Positives = 95/192 (49%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           M    YD  +  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDSVTFSPTGRLFQVEYALEAIKQGSVTVGLRSHKYAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + +  + +++AGL  DA +L N  R         ++  + VE     LSD  Q
Sbjct: 58  SYQKKIIKCDTHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFDRKLSVEKAGSLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       S+GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLVIGYDNS-GSHLLEFQPSGNVLELYGSSIGARSQGAKTYLERVL 176

Query: 181 KDDIKVDGAIEL 192
            D +++D   EL
Sbjct: 177 DDFLEIDNVEEL 188

>SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314W PRE5 20S proteasome alpha-type subunit
          Length = 233

 Score = 94.7 bits (234), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 110/224 (49%), Gaps = 9/224 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   V+ A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSKKHAVVVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120
           +   K+ + ++ + +++AGL  DA +L N  R         +N  + +E     L D  Q
Sbjct: 58  SYQNKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLSLEKAGYLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  G+D+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLIGHDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 176

Query: 181 KDDIKVDGAIEL---ALKTLSKTTDSSALTYDRVEFATIKLGEN 221
           ++ ++++ A EL    ++ L ++     L+   +  A +  GEN
Sbjct: 177 EEYLEIEDADELIKKGVEALKQSLKDETLSTKNLSIAIV--GEN 218

>TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON}
           Anc_5.1 YMR314W
          Length = 238

 Score = 85.5 bits (210), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 88/182 (48%), Gaps = 9/182 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEY-----ALESISHAGTAIGIMAEDGIVLAAERKVTSK 55
           M    YD  T  FSP GRL+QV+Y     ALE+I      +G+ ++   VL A ++   +
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVDYTKLYDALEAIKQGSVTVGLHSKKYAVLVALKRNADE 60

Query: 56  LLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRL 115
           L    +   K+ + ++ + +++AGL  DA +L N  R         +N  + VE     L
Sbjct: 61  L---SSYQRKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCNYSNLVFNRKLSVEKAGHLL 117

Query: 116 SDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTL 175
            D  Q  TQ  G RP+GV  +  G+ D+ G  L    PSGN       ++GA +  A+T 
Sbjct: 118 CDKAQKNTQSYGGRPYGVGLLIIGH-DKSGAHLLEFQPSGNTLELYGSAIGARSQGAKTY 176

Query: 176 LQ 177
           L+
Sbjct: 177 LE 178

>Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C
           (PRE10) - proteasome component YC1 (protease yscE
           subunit 1) [contig 44] FULL
          Length = 196

 Score = 69.7 bits (169), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 72/150 (48%), Gaps = 3/150 (2%)

Query: 83  DAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDD 142
           D   L+N AR  A ++ KTY   I +  L  RL    Q +T +  +RPFG++ I  G D+
Sbjct: 3   DGRHLVNRAREEAASFKKTYGTPITLPALADRLGQYVQAHTLYNSVRPFGITAIVGGVDE 62

Query: 143 RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--VDYKDDIKVDGAIELALKTLSKT 200
             G  LY   PSG+Y G+K  + G    +A+  L+  +  K DI    A++ A + +   
Sbjct: 63  N-GAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKILSSKPDISAKEAVKEAARVVYLA 121

Query: 201 TDSSALTYDRVEFATIKLGENGKLYQKVFK 230
            D +      +E +   + E   L++ V K
Sbjct: 122 HDDNKEKEFELEMSWCSVSETNGLHKAVPK 151

>NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON}
           Anc_4.110
          Length = 172

 Score = 63.5 bits (153), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%)

Query: 102 YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWK 161
           Y  D+P ++L KR++++ Q YTQ   +RP GV   +   D+  G  +Y S+P+G Y G+K
Sbjct: 28  YGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYK 87

Query: 162 AISVGANTSAAQTLLQVDYK 181
           A + G       T L+  +K
Sbjct: 88  ATATGPKQQEITTNLENYFK 107

>SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/221 (26%), Positives = 104/221 (47%), Gaps = 16/221 (7%)

Query: 20  YQVEYALESISHA-------GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLND 71
           YQ    L + SHA       GT I G+    G+V+AA+ + T   +  D + EKL+R++ 
Sbjct: 9   YQRNQFLAAKSHAQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCEKLHRISP 68

Query: 72  KIVVAVAGLTSDAEILINTARIHAQNYLKT-YNEDIPVEILVKRLSDIKQGYTQHGGLRP 130
           +I  A AG  +D E +  T  I +   L + Y    P   +V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAV--TQLIGSNIELHSLYTNREPR--VVSALQMLKQHLFKYQG--H 122

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAI 190
            G   I AG D   G  L++ +  G+       S+G+ + AA  +L+ ++K ++  + AI
Sbjct: 123 VGAYLIVAGVDPT-GAHLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWKQNLSREEAI 181

Query: 191 ELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKP 231
           ELA   +     +   +   V+   +++G++ +L +    P
Sbjct: 182 ELASNAIEAGIWNDLGSGSNVDICVMEVGKDAELLRNYLTP 222

>Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 95/199 (47%), Gaps = 8/199 (4%)

Query: 34  TAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTARI 93
           T +G+   DG+V+AA+ + T   +  D +  KL+R++ KI  A AG  +D E +  T  I
Sbjct: 31  TIVGVKYNDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  HAQNYLKT-YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTYDRVE 212
             G+      +S+G+ + AA  +L+  +K D+  D A++LA   +     +   +   V+
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAVKLASDAIQAGIWNDLGSGSNVD 203

Query: 213 FATIKLGENGKLYQKVFKP 231
              +++G++ +  +    P
Sbjct: 204 VCVMEIGKDAEYLRNYLTP 222

>KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 102/224 (45%), Gaps = 22/224 (9%)

Query: 20  YQVEYALESISH--------AGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLND 71
           YQ    L S SH          T +G+    G+V+AA+ + T   +  D +  KL+R++ 
Sbjct: 9   YQRNSFLSSKSHKQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  KIVVAVAGLTSDAE----ILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGG 127
           +I  A AG  +D E    ++ +   +H+   L T  E      +V  L  +KQ   ++ G
Sbjct: 69  RIWCAGAGTAADTEAVTQLISSNIELHS---LSTRRE----PRVVTTLQMLKQHLFRYQG 121

Query: 128 LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVD 187
               G   I AG D   G  L++ +  G+      +S+G+ + AA  +L+  ++ DI  D
Sbjct: 122 --HIGAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESKWRADISKD 178

Query: 188 GAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKP 231
            AIELA + +     +   +   V+   +++G++ +  +    P
Sbjct: 179 EAIELASEAIEAGIWNDLGSGSNVDVCVMQIGQDAQYLRNHRTP 222

>Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 96/199 (48%), Gaps = 8/199 (4%)

Query: 34  TAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTARI 93
           T +G+  ++G+V+AA+ + T   +  D +  KL+R++ KI  A AG  +D E +  T  I
Sbjct: 31  TIVGVKYKNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  HAQNYLKT-YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTYDRVE 212
             G+      +S+G+ + AA  +L+  +K D+  D AI+LA   +     +   +   V+
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAIKLASDAIQAGIWNDLGSGSNVD 203

Query: 213 FATIKLGENGKLYQKVFKP 231
              +++G++ +  +    P
Sbjct: 204 VCVMEIGKDAEYLRNYLTP 222

>NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 88/192 (45%), Gaps = 10/192 (5%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLND 71
           +S E     +E+A    + + GT +GI  ED  +LA + + T+          K++   D
Sbjct: 8   YSSEVNSTPIEHAFNPYTDNGGTILGIAGEDFAILAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGG-LRP 130
            IV++  G  +D E L+   +    N LK Y+ D   + L  + +     +  +G    P
Sbjct: 68  NIVISANGFAADGEALVKRFK----NSLKWYHFDHNDKKLSMKSAARNIQHLLYGKRFFP 123

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDIK--V 186
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  QV++K+  +   
Sbjct: 124 YYVHTIIAGLDENGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQFEPGT 183

Query: 187 DGAIELALKTLS 198
           DG ++  LK LS
Sbjct: 184 DGKVKKPLKYLS 195

>Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 53.9 bits (128), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 95/199 (47%), Gaps = 8/199 (4%)

Query: 34  TAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTARI 93
           T +G+   +G+V+AA+ + T   +  D +  KL+R++ KI  A AG  +D E +  T  I
Sbjct: 31  TIVGVKYNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  HAQNYLKT-YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTYDRVE 212
             G+      +S+G+ + AA  +L+  +K D+  D AI+LA   +     +   +   V+
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAIKLASDAIQAGIWNDLGSGSNVD 203

Query: 213 FATIKLGENGKLYQKVFKP 231
              +++G++ +  +    P
Sbjct: 204 VCVMEVGKDAEYLRNYLTP 222

>NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 87/192 (45%), Gaps = 10/192 (5%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLND 71
           +S E R   +E+     S + GT +GI  ED  VLA + + T+          K++   D
Sbjct: 8   YSSEVRNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGG-LRP 130
            IV++  G  +D E L+   +    N LK Y+ D   + L    +     +  +G    P
Sbjct: 68  NIVISANGFAADGEALVKRFK----NSLKWYHFDHNDKKLAMSSAARNIQHLLYGKRFFP 123

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDIK--V 186
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  QV++K+  +   
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGT 183

Query: 187 DGAIELALKTLS 198
           DG ++  LK L+
Sbjct: 184 DGKVKRPLKYLT 195

>AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL041W (PRE7)
          Length = 243

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 79/171 (46%), Gaps = 8/171 (4%)

Query: 32  AGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
           AGT +GI  ED  VLA + + T+          K++   D I+++  G  +D + L+   
Sbjct: 31  AGTILGIAGEDFAVLAGDTRHTTGYSINSREEPKVFDCGDNILISANGFAADGDALVKRF 90

Query: 92  RIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
           +    N +K Y  D   ++ +K  +   Q       + P+ V  I AG D+     +Y+ 
Sbjct: 91  K----NSMKWYRFDHNKKMTIKSAARSIQHLLYGKRMFPYYVHTIIAGLDEEGKGAVYSY 146

Query: 152 NPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDIKVD--GAIELALKTLS 198
           +P G+Y   +  + GA  S     L  QV++K+  + D  G  + AL+ LS
Sbjct: 147 DPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPDSNGTKKRALRFLS 197

>NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON}
           Anc_5.507 YOR157C
          Length = 263

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 96/199 (48%), Gaps = 8/199 (4%)

Query: 34  TAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTARI 93
           T +G+   DG+V+AA+ + T   +  D +  KL+R++ KI  A AG  +D E +  T  I
Sbjct: 32  TIVGLKYRDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 89

Query: 94  HAQNYLKT-YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 90  GSNIELHSLYTSRSPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 144

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTYDRVE 212
             G+      +S+G+ + AA  +L+  ++ ++  + AIELA + +     +   +   V+
Sbjct: 145 AHGSTDVGYYLSLGSGSLAAMAVLESQWRPELSKEEAIELASQAIQAGIWNDLGSGSNVD 204

Query: 213 FATIKLGENGKLYQKVFKP 231
              +++G++ +  +    P
Sbjct: 205 VCVMEVGKDAEYLRNYVTP 223

>YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}
           PUP1Beta 2 subunit of the 20S proteasome; endopeptidase
           with trypsin-like activity that cleaves after basic
           residues; synthesized as a proprotein before being
           proteolytically processed for assembly into 20S
           particle; human homolog is subunit Z
          Length = 261

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 95/199 (47%), Gaps = 8/199 (4%)

Query: 34  TAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTARI 93
           T +G+   +G+V+AA+ + T   +  D +  KL+R++ KI  A AG  +D E +  T  I
Sbjct: 31  TIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  HAQNYLKT-YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTYDRVE 212
             G+      +S+G+ + AA  +L+  +K D+  + AI+LA   +     +   +   V+
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVD 203

Query: 213 FATIKLGENGKLYQKVFKP 231
              +++G++ +  +    P
Sbjct: 204 VCVMEIGKDAEYLRNYLTP 222

>KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {ON}
           highly similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 262

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 94/199 (47%), Gaps = 8/199 (4%)

Query: 34  TAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTARI 93
           T +G+    G+++AA+ + T   +  D + EKL+R+  +I  A AG  +D E +  T  I
Sbjct: 32  TIVGVKFNGGVIIAADTRSTQGPIVADKNCEKLHRIAPRIWCAGAGTAADTEAV--TQLI 89

Query: 94  HAQNYLKT-YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 90  SSNIELHSLYTGREPR--VVSSLQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 144

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTYDRVE 212
             G+       S+G+ + AA  +L+ ++  D+  + AI+LA   +     +   +   V+
Sbjct: 145 AHGSTDVGYYQSLGSGSLAAMAVLEANWNQDLSKEEAIKLASDAIEAGIWNDLGSGSNVD 204

Query: 213 FATIKLGENGKLYQKVFKP 231
              +++G++ +L +    P
Sbjct: 205 VCVMEVGKDAQLLRNYLCP 223

>KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 96/199 (48%), Gaps = 8/199 (4%)

Query: 34  TAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTARI 93
           T +G+   +G+V+AA+ + T   +  D +  KL+R++ +I  A AG  +D E +  T  I
Sbjct: 32  TIVGVKFHNGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTEAV--TQLI 89

Query: 94  HAQNYLKT-YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y +  P   +V  L  +KQ   ++ G    G   I AG D   G  L++  
Sbjct: 90  GSNVELHSLYAKRQPR--VVTALQMLKQHLFKYQG--HIGAYLIVAGTDPT-GAHLFSVQ 144

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTYDRVE 212
             G+      +S+G+ + AA  +L+ ++K+D+  + AI+LA   +     +   +   V+
Sbjct: 145 AHGSTDVGFYLSLGSGSLAAMAVLESNWKEDLSKEEAIKLASDAIQAGIWNDLGSGSNVD 204

Query: 213 FATIKLGENGKLYQKVFKP 231
              ++ G++ +  +    P
Sbjct: 205 LCVMETGKDAEYLRNYITP 223

>ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 99/213 (46%), Gaps = 15/213 (7%)

Query: 24  YALESISHAGTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTS 82
           +A+   +  GT I G+  + G+V+AA+ + T   +  D +  KL+R+  +I  A AG  +
Sbjct: 20  HAVPKATSTGTTIVGVKYDKGVVIAADTRSTQGPIVADKNCAKLHRMAPRIWCAGAGTAA 79

Query: 83  DAE----ILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYA 138
           D E    ++ +   +H+Q     Y    P   +V  L  +KQ   ++ G    G   I A
Sbjct: 80  DTEAVTQLIGSNLELHSQ-----YANREPR--VVSALQMLKQHLFRYQG--HIGAYLIVA 130

Query: 139 GYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLS 198
           G D   G  L++    G+      +S+G+ + AA   L+ ++K ++  D A++LA   + 
Sbjct: 131 GVDPT-GAHLFSVQAHGSTDVGHYLSLGSGSLAAMATLESNWKQNLTKDEAVKLASDAIQ 189

Query: 199 KTTDSSALTYDRVEFATIKLGENGKLYQKVFKP 231
               +   +   V+   +++G++ +  +    P
Sbjct: 190 AGIWNDLGSGSNVDVCVMEVGKDAEYLRNYITP 222

>Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to
           Ashbya gossypii AAR119W
          Length = 258

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 102/209 (48%), Gaps = 14/209 (6%)

Query: 27  ESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAE- 85
           ++ S   T +G+  E+G+V+AA+ + T   +  + + EKL++++ +I  A AG  +D + 
Sbjct: 24  QATSTGTTIVGVKFENGVVIAADTRSTQGPIVANKNCEKLHKISSRIWCAGAGTAADTDA 83

Query: 86  ---ILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDD 142
              ++ +   +H+   L T  E   V  L K    +KQ   ++ G    G   I AG D 
Sbjct: 84  VTGLIGSNLELHS---LFTGREPRVVSALQK----LKQHLFKYQG--HIGAYLIVAGVDP 134

Query: 143 RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTD 202
             G  L++ +  G+       S+G+ + AA  +L+ ++K+ +  + AI+LA   +     
Sbjct: 135 T-GAHLFSVHAHGSTDVGYYQSLGSGSLAAMAVLEANWKEHLTKEEAIKLAADAIEAGIW 193

Query: 203 SSALTYDRVEFATIKLGENGKLYQKVFKP 231
           +   +   V+   +++G++ +L +    P
Sbjct: 194 NDLGSGSNVDVCVMEVGKDAELLRNYITP 222

>KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 83/191 (43%), Gaps = 15/191 (7%)

Query: 20  YQVEYALESISH--------AGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLND 71
           Y  E A + I H         GT +GI  ED  VLA + + T+          K++   D
Sbjct: 8   YSNEVAQQPIEHRFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPF 131
            IV++  G  +D E L+   +   + Y   +N+    ++ +K  +   Q         P+
Sbjct: 68  NIVISANGFAADGEALVKRFKNSIKWYHFDHNDK---KLSIKSAARNIQHLLYGKRFFPY 124

Query: 132 GVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDIKV--D 187
            V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  QV++K+  +   D
Sbjct: 125 YVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGSD 184

Query: 188 GAIELALKTLS 198
           G ++  LK L+
Sbjct: 185 GKVKRPLKYLN 195

>CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041w PRE7
          Length = 242

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 77/173 (44%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINT 90
           + GT +GI  ED  VLA + + T+          K++   D I+++  G  +D E L+  
Sbjct: 28  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIIMSANGFAADGEALVKR 87

Query: 91  ARIHAQNYLKTYNE-DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    + +  +  G        P+ V  I AG DD     +Y
Sbjct: 88  FKNSIKWYHFDHNDKKLSISSAARNIQHLLYGKR----FFPYYVHTIIAGLDDEGKGAVY 143

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDI--KVDGAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  QV++K+      DG ++  LK LS
Sbjct: 144 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYVPGTDGKVKRELKYLS 196

>TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 99/210 (47%), Gaps = 9/210 (4%)

Query: 24  YALESISHAGTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTS 82
           YA    +  GT I G+  + G+V+AA+ + T   +  D +  KL+R+  +I  A AG  +
Sbjct: 20  YAQPKATSTGTTIVGVKFKGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAA 79

Query: 83  DAEILINTARIHAQNYLKT-YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYD 141
           D E +  T  I +   L + Y E  P   +V  L  +KQ   ++ G    G   I AG D
Sbjct: 80  DTEAV--TQLIGSNIELHSLYTERAPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVD 133

Query: 142 DRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTT 201
              G  L++ +  G+       ++G+ + AA  +L+  +K D+  + AI+LA + +    
Sbjct: 134 PT-GAHLFSIHAHGSTDVGYYHTLGSGSLAAMAVLESQWKQDLSKEDAIKLASEAILAGI 192

Query: 202 DSSALTYDRVEFATIKLGENGKLYQKVFKP 231
            +   +   V+   +++G++ +  +    P
Sbjct: 193 WNDLGSGSNVDLCVMEVGKDAEYLRNYITP 222

>Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON}
           (211095..211823) [729 nt, 243 aa]
          Length = 242

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 86/186 (46%), Gaps = 16/186 (8%)

Query: 22  VEYALESIS-HAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGL 80
           +E+     S + GT +GI  ED  VLA + + T+          K++   D IV++  G 
Sbjct: 18  IEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIVISANGF 77

Query: 81  TSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQH--GGLR--PFGVSFI 136
            +D E L+   +    N +K Y+ D   + L   LS   +   QH   G R  P+ V  I
Sbjct: 78  AADGEALVKRFK----NSIKWYHFDNNDKTL--SLSSAARN-IQHLLYGKRFFPYYVHTI 130

Query: 137 YAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDIKV--DGAIEL 192
            AG D+     +Y+ +P G+Y   +  + GA  S     L  QV++K+  +   DG ++ 
Sbjct: 131 IAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPDSDGTVKR 190

Query: 193 ALKTLS 198
            LK LS
Sbjct: 191 PLKFLS 196

>TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 100/221 (45%), Gaps = 16/221 (7%)

Query: 20  YQVEYALESISHA--------GTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLND 71
           YQ    L S SHA         T +G+   +G+V+AA+ + T   +  D +  KL+R++ 
Sbjct: 9   YQRNNFLASKSHAQPKATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  KIVVAVAGLTSDAEILINTARIHAQNYLKT-YNEDIPVEILVKRLSDIKQGYTQHGGLRP 130
           +I  A AG  +D E +  T  I +   L + Y    P   +V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAV--TQLISSNLELHSLYASREPR--VVSALQMLKQHLFKYQG--H 122

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAI 190
            G   I AG D   G  L++ +  G+       S+G+ + AA  +L+  +K D+  + AI
Sbjct: 123 IGAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKQDLTKEEAI 181

Query: 191 ELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKP 231
            LA   +     +   +   V+   +++G++ +  +    P
Sbjct: 182 NLASDAIEAGIWNDLGSGSNVDVCVMEIGKDAEYLRNYRTP 222

>TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON}
           Anc_5.507 YOR157C
          Length = 259

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 101/228 (44%), Gaps = 30/228 (13%)

Query: 20  YQVEYALESISH--------AGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLND 71
           YQ    L S SH          T +G+   +G+++AA+ + T   +  D +  KL+R+  
Sbjct: 9   YQRNAFLASQSHNTPKATSTGTTIVGVKFNNGVIIAADTRSTQGPIVADKNCAKLHRMAP 68

Query: 72  KIVVAVAGLTSDAE----ILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGG 127
           +I  A AG  +D E    ++ +   +H+   L T+ E      +V  L  +KQ   ++ G
Sbjct: 69  RIWCAGAGTAADTEAVTQLVGSNLELHS---LYTHRE----PRVVSALQMLKQHLFKYQG 121

Query: 128 LRPFGVSFIYAGYDDR----YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
               G   I AG D      +  Q + S   G Y      S+G+ + AA  +L+ ++K D
Sbjct: 122 --HIGAYLIVAGVDPTGPHLFAVQAHGSTDVGFYH-----SLGSGSLAAMAVLETNWKQD 174

Query: 184 IKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKP 231
           +  + A++LA   +     +   +   V+   +++G++ +  +    P
Sbjct: 175 LTKEEAMKLASDAIQAGIWNDLGSGSNVDLCVMEVGKDAEYLRNYITP 222

>NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507
          Length = 264

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 105/222 (47%), Gaps = 17/222 (7%)

Query: 20  YQVEYALESISHA--------GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLN 70
           YQ   AL + SH+        GT I G+   +G+++AA+ + T   +  + +  KL+R++
Sbjct: 9   YQRNAALAAKSHSQQPKATSTGTTIVGVKYANGVIIAADTRSTQGPIVANKNCAKLHRIS 68

Query: 71  DKIVVAVAGLTSDAEILINTARIHAQNYLKT-YNEDIPVEILVKRLSDIKQGYTQHGGLR 129
            +I  A AG  +D E +  T  I +   L + Y    P   +V  L  +KQ   ++ G  
Sbjct: 69  PRIWCAGAGTAADTEAV--TQLIGSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG-- 122

Query: 130 PFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGA 189
             G   I AG D   G  L++ +  G+      +S+G+ + AA  +L+  ++ ++  + A
Sbjct: 123 HIGAYLIVAGTDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWEPEMSKEAA 181

Query: 190 IELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKP 231
           +ELA + +     +   +   V+   +++G++ +  +    P
Sbjct: 182 VELASQAIQAGIFNDLGSGSNVDVCVMEVGKDAEYLRNYLTP 223

>KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 242

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 80/179 (44%), Gaps = 8/179 (4%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLND 71
           +S E +   +E+     S + GT +GI  ED  VLA + + T+          K++   D
Sbjct: 9   YSNEVKNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 68

Query: 72  KIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGG-LRP 130
            I+++  G  +D   L+       QN LK Y+ D   + L  R +     +  +G    P
Sbjct: 69  NILISANGFAADGNALVKR----FQNSLKWYHFDHNDKKLSMRSAARNIQHLLYGKRFFP 124

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDIKVD 187
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  QV++K+  + D
Sbjct: 125 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPD 183

>KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 240

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 71/159 (44%), Gaps = 6/159 (3%)

Query: 31  HAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINT 90
           + GT +GI  ED  VLA + + T+          K++   D I+++  G  +D E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFECEDNILISANGFAADGEALVKR 86

Query: 91  ARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYT 150
            +     Y   +N+ + ++   + +  +  G      + P+ V  I AG D+     +Y+
Sbjct: 87  FKNSQMWYHFNHNKKLTIKSAARNIQHLLYGKR----MFPYYVHTIIAGLDEEGKGAVYS 142

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDIKVD 187
            +P G+Y   +  + G+  S     L  QV+ K+  + D
Sbjct: 143 FDPVGSYEREQCRAGGSAASLIMPFLDNQVNLKNQYEPD 181

>Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 78/173 (45%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINT 90
           + GT +GI  ED  VLA + +  +          K++   DKIV++  G  +D + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDKIVMSANGFAADGDALVKR 86

Query: 91  ARIHAQNYLKTYNE-DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    + +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDIK--VDGAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  QV++K+  +   DG ++  LK LS
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTDGKVKKPLKYLS 195

>KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON}
           Anc_7.480 YBL041W
          Length = 248

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 80/178 (44%), Gaps = 20/178 (11%)

Query: 15  PEGRLYQVEYALESIS-HAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKI 73
           P      +E+     S + GT +GI  ED  VLA + + T+       S  K++ + D I
Sbjct: 19  PSAMSQPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRSESKVFDVGDGI 78

Query: 74  VVAVAGLTSDAEILINTARIHAQNYLKTY--NEDIPVEILVKRLS-DIKQGYTQH--GGL 128
           V++  G  +D+  L+   R    N LK Y  NE+       KRLS        QH   G 
Sbjct: 79  VISANGFAADSTALVKRFR----NSLKWYHFNEN------EKRLSLSAAARNIQHLLYGK 128

Query: 129 R--PFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKD 182
           R  P+ V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  QV++K+
Sbjct: 129 RFFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 186

>Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {ON}
           YOR157C (PUP1) - putative proteasome subunit [contig
           190] FULL
          Length = 263

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 101/213 (47%), Gaps = 15/213 (7%)

Query: 27  ESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAE- 85
           ++ S   T +G+    G+V+AA+ + T   +  + +  KL+R++ KI  A AG  +D E 
Sbjct: 24  QATSTGTTIVGVKYNGGVVIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTEE 83

Query: 86  ---ILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDD 142
              ++ +   +H+      Y    P   +V  L  +KQ   ++ G    G   I AG D 
Sbjct: 84  VTKLIGSNLELHS-----LYASRAPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDP 134

Query: 143 RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTD 202
             G  L++ +  G+       S+G+ + AA  +L+  +K+DI  + A++LA   +     
Sbjct: 135 T-GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKEDINREEAMQLASDAIEAGIW 193

Query: 203 SSALTYDRVEFATIKLGENGKLYQKVFKPEEIQ 235
           +   +   V+   +++G++ + Y + +K   ++
Sbjct: 194 NDLGSGSNVDLCVMEVGKDAE-YLRNYKTPNVR 225

>CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {ON}
           highly similar to uniprot|P25043 Saccharomyces
           cerevisiae YOR157c PUP1
          Length = 261

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 97/207 (46%), Gaps = 8/207 (3%)

Query: 26  LESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAE 85
           +++ S   T +G+    G+V+AA+ + T   +  D +  KL+R++ +I  A AG  +D E
Sbjct: 23  VKATSTGTTIVGVKFAGGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTE 82

Query: 86  ILINTARIHAQNYLKT-YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
            +  T  I +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   
Sbjct: 83  AV--TQLIGSNIELHSLYTNRSPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT- 135

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSS 204
           G  L++ +  G+       S+G+ + AA  +L+  +K D+  + AI+LA   +     + 
Sbjct: 136 GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKPDMTKEEAIQLAADAIEAGIWND 195

Query: 205 ALTYDRVEFATIKLGENGKLYQKVFKP 231
             +   V+   +++G++ +  +    P
Sbjct: 196 LGSGSNVDVCVMEIGKDAEYLRNYRTP 222

>Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON}
           complement(238..1023) [786 nt, 262 aa]
          Length = 261

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 94/199 (47%), Gaps = 8/199 (4%)

Query: 34  TAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTARI 93
           T +G+  + G+V+AA+ + T   +  D +  KL+R+  +I  A AG  +D E +  T  I
Sbjct: 31  TIVGVKFDGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAADTEAV--TQLI 88

Query: 94  HAQNYLKT-YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y+   P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYSNREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTYDRVE 212
             G+       S+G+ + AA  +L+ ++K D+  + AI+LA   +     +   +   V+
Sbjct: 144 AHGSTDVGYYHSLGSGSLAAMAVLESNWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVD 203

Query: 213 FATIKLGENGKLYQKVFKP 231
              +++G++    +    P
Sbjct: 204 VCVMEVGKDADYLRNHITP 222

>Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W
           (PRE7) - proteasome subunit [contig 159] FULL
          Length = 242

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 81/183 (44%), Gaps = 10/183 (5%)

Query: 22  VEYALESIS-HAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGL 80
           +E+     S + GT +GI  ED  VLA + + T+          K++   D I+++  G 
Sbjct: 18  IEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNILISANGF 77

Query: 81  TSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGG-LRPFGVSFIYAG 139
            +D   L+       QN LK Y+ D   + L  + +     +  +G    P+ V  I AG
Sbjct: 78  AADGTALVK----RFQNSLKWYHFDHNDKKLSMKSAARNIQHLLYGKRFFPYYVHTIIAG 133

Query: 140 YDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDIKVD--GAIELALK 195
            D+     +Y+ +P G+Y   +  + GA  S     L  QV++K+  + D  G     LK
Sbjct: 134 LDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPDSKGTKRKELK 193

Query: 196 TLS 198
            LS
Sbjct: 194 FLS 196

>KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 263

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 85/171 (49%), Gaps = 14/171 (8%)

Query: 27  ESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAE- 85
           ++ S   T +G+  + G+++AA+ + T   +  + +  KL+R++ KI  A AG  +D E 
Sbjct: 24  QATSTGTTIVGVKYDGGVLIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTEE 83

Query: 86  ---ILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDD 142
              ++ +   +H+      Y    P   +V  L  +KQ   ++ G    G   I AG D 
Sbjct: 84  VTKLIGSNLELHSM-----YASREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGADP 134

Query: 143 RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELA 193
             G  L++ +  G+       S+G+ + AA  +L+ +++ D+K + A++LA
Sbjct: 135 T-GTHLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWRPDLKKEEAMQLA 184

>SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 261

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 79/183 (43%), Gaps = 16/183 (8%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLND 71
           +S E +   +E+     S + GT +GI  ED  VLA + + T+          K++   D
Sbjct: 28  YSNETKNVPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 87

Query: 72  KIVVAVAGLTSDAEILINTARIHAQNYLKTYN-----EDIPVEILVKRLSDIKQGYTQHG 126
            I+++  G  +D E L+       QN LK Y+       + +    + +  +  G     
Sbjct: 88  NILISANGFAADGEALVK----RFQNSLKWYHFNHNDRKLSLSSAARNIQHLLYGKR--- 140

Query: 127 GLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDI 184
              P+ V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  QV++K+  
Sbjct: 141 -FFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQY 199

Query: 185 KVD 187
           + D
Sbjct: 200 EPD 202

>TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 79/173 (45%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINT 90
           + GT +GI  ED  VLA + +  +          K++   D IV++  G  +D E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRFEPKVFDCGDNIVISANGFAADGEALVQR 86

Query: 91  ARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGG-LRPFGVSFIYAGYDDRYGYQLY 149
            +    N +K Y+ D   + L  + +     +  +G    P+ V  I AG D+     +Y
Sbjct: 87  FK----NSIKWYHFDHNDKKLTMKSAARNIQHLLYGKRFFPYYVHTIIAGLDEEGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDI--KVDGAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  QV++K+    + +G ++  LK L+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYVPESNGKVKRPLKYLT 195

>TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 74/177 (41%), Gaps = 15/177 (8%)

Query: 20  YQVEYALESISH--------AGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLND 71
           Y  E A   I H         GT +GI  ED  VLA + + T+          K++   D
Sbjct: 8   YSNEVAHTPIQHQFNPYTDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRHESKVFDCGD 67

Query: 72  KIVVAVAGLTSDAEILINTARIHAQNYLKTYNE-DIPVEILVKRLSDIKQGYTQHGGLRP 130
            IV++  G  +D E L+   +   + Y   +N+  + +    + +  +  G        P
Sbjct: 68  NIVMSANGFAADGEALVKRFKNSVKWYHFDHNDKKLSLSSAARNIQHLLYGKR----FFP 123

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDIK 185
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  QV++K+  +
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQFE 180

>Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 77/173 (44%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINT 90
           + GT +GI  ED  VLA + +  +          K++   D +V++  G  +D + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNLVMSANGFAADGDALVKR 86

Query: 91  ARIHAQNYLKTYNE-DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    + +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDIK--VDGAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  QV++K+  +   DG ++  LK LS
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTDGKVKKPLKYLS 195

>TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 80/183 (43%), Gaps = 10/183 (5%)

Query: 22  VEYALESIS-HAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGL 80
           +E+     S + GT +GI  ED  VLA + + T+          K++   D I+++  G 
Sbjct: 17  IEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDDIIISANGF 76

Query: 81  TSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGG-LRPFGVSFIYAG 139
            +D E L+   +    N +K Y+ D   + L    +     +  +G    P+ V  I AG
Sbjct: 77  AADGEALVKRFK----NSIKWYHFDNNDKKLALSSAARNIQHLLYGKRFFPYYVHTIIAG 132

Query: 140 YDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDIKVD--GAIELALK 195
            D+     +Y+ +P G+Y      + GA  S     L  QV++K+    D  G ++   K
Sbjct: 133 LDEEGKGAVYSFDPVGSYEREFCRAGGAAASLIMPFLDNQVNFKNQYTPDSNGKVKRPFK 192

Query: 196 TLS 198
            LS
Sbjct: 193 HLS 195

>AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR157C (PUP1)
          Length = 259

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 102/224 (45%), Gaps = 22/224 (9%)

Query: 20  YQVEYALESISH--------AGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLND 71
           YQ    L S SH          T +G+  E G+V+AA+ + T   +  + + EKL+R+  
Sbjct: 9   YQRNQHLASTSHKQPRATSTGTTIVGVKFEGGVVIAADTRSTQGPIVANKNCEKLHRIAP 68

Query: 72  KIVVAVAGLTSDAE----ILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGG 127
           +I  A AG  +D E    ++ +   +H+   L T  E   V  L K    +KQ   ++ G
Sbjct: 69  RIWCAGAGTAADTEAVTWLIGSNLELHS---LYTGREPRVVSALQK----LKQHLFKYQG 121

Query: 128 LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVD 187
               G   I AG D   G  L++ +  G+    +  S+G+ + AA  +L+  +++ +   
Sbjct: 122 --HIGAYLIVAGVDPT-GAHLFSVHAHGSTDVGQYQSLGSGSLAAMAVLEAQWREGMGRA 178

Query: 188 GAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKP 231
            A+ LA   +     +   +   V+   +++G++ +L++    P
Sbjct: 179 DAMALAAAAIEAGIWNDLGSGSNVDLCVMEVGKDAELFRNYITP 222

>TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.417
           YPR103W
          Length = 286

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 85/202 (42%), Gaps = 14/202 (6%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAE--- 85
           I+H  T +    + GI++A + + T+       +  K+ R+N  ++  +AG  +D +   
Sbjct: 71  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVNKVIRINPFLLGTMAGGAADCQYWE 130

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK   E I V    K LS++   Y   G      +  +  GY  + 
Sbjct: 131 TWLGSQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 182

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ VD A+ L  +++       
Sbjct: 183 GPTVYYVDSDGTRLKGNVFCVGSGQTFAYGVLDSNYKWDLTVDEALYLGKRSILAAAHRD 242

Query: 205 ALTYDRVEFATIKLGENGKLYQ 226
           A +   +    +   ENG +Y 
Sbjct: 243 AYSGGSINLYHVT--ENGWVYH 262

>Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON}
           (258951..259598) [648 nt, 216 aa]
          Length = 215

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 93/212 (43%), Gaps = 22/212 (10%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL R++DKI    +G  +D + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y E   ++   I      + K   T            I AGYD+    Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTY 208
           Y+    G+         G+ ++        ++K+D+  +  IE    +LS+     A+ +
Sbjct: 130 YSIPLGGSVHRQPYAIAGSGSTFIYGYCDKNFKEDMTKEETIEFMKHSLSQ-----AIKW 184

Query: 209 DRVEFATIK---LGENGKLYQKVFKPEEIQTL 237
           D      I+   L ++G   + +F P+E + L
Sbjct: 185 DGSSGGVIRMVVLTKDGA-ERLIFYPDEYEKL 215

>Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON}
           (145742..146389) [648 nt, 216 aa]
          Length = 215

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 93/212 (43%), Gaps = 22/212 (10%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL R++DKI    +G  +D + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y E   ++   I      + K   T            I AGYD+    Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTY 208
           Y+    G+         G+ ++        ++K+D+  +  IE    +LS+     A+ +
Sbjct: 130 YSIPLGGSVHRQPYAIAGSGSAFIYGYCDKNFKEDMTKEETIEFMKHSLSQ-----AIKW 184

Query: 209 DRVEFATIK---LGENGKLYQKVFKPEEIQTL 237
           D      I+   L ++G   + +F P+E + L
Sbjct: 185 DGSSGGVIRMVVLTKDGA-ERLIFYPDEYEKL 215

>Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON}
           similar to Ashbya gossypii AGL324W
          Length = 242

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 74/159 (46%), Gaps = 7/159 (4%)

Query: 32  AGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
            GT +GI  ED  V+A + + T+       +  K++   D I+++  G  +D + L+   
Sbjct: 29  GGTILGIAGEDFAVIAGDTRHTTGYSINSRNEPKVFDCGDNILISANGFAADGDALVKKF 88

Query: 92  RIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGG-LRPFGVSFIYAGYDDRYGYQLYT 150
           +    N LK Y+ D   + +  + +     +  +G  + P+ V  I AG D+     +Y+
Sbjct: 89  K----NNLKWYHFDHNNKKMTLKSAARNIQHLLYGKRMFPYYVHTIIAGLDEDGKGAVYS 144

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDIKVD 187
            +P G+Y   +  + GA  S     L  QV++K+  + D
Sbjct: 145 FDPVGSYEREQCRAGGAAASIIMPFLDNQVNFKNQYEPD 183

>ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa]
           {ON} highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 244

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 76/173 (43%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINT 90
           + GT +GI  ED  VLA + + T+          K++   D IV+   G  +D E L+  
Sbjct: 30  NGGTVLGIAGEDFAVLAGDTRHTTDYSINSRYESKVFDCGDNIVITANGYAADGEALVKR 89

Query: 91  ARIHAQNYLKTYNE-DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    + +  +  G        P+ V  I AG D+     +Y
Sbjct: 90  FKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKR----FFPYYVQTIIAGLDEEGKGAVY 145

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDI--KVDGAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  QV++ +    + +G ++  LK LS
Sbjct: 146 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFHNQYVPESNGRVKRPLKFLS 198

>Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 77/173 (44%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINT 90
           + GT +GI  ED  VLA + +  +          K++   D IV++  G  +D + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARIHAQNYLKTYNE-DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    + +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKR----FFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDIK--VDGAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  QV++K+  +   +G ++  LK LS
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLS 195

>YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6
           subunit of the 20S proteasome
          Length = 241

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 77/173 (44%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINT 90
           + GT +GI  ED  VLA + +  +          K++   D IV++  G  +D + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARIHAQNYLKTYNE-DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    + +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDIK--VDGAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  QV++K+  +   +G ++  LK LS
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLS 195

>AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR103W
           (PRE2)
          Length = 285

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 85/202 (42%), Gaps = 14/202 (6%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAE--- 85
           I+H  T +    + GIV+A + + T+       + +K+  +N  ++  +AG  +D +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 129

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   E I V    K LS++   Y   G      +  +  GY  + 
Sbjct: 130 TWLGAQCRLHE---LKE-KERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKE 181

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +Y+ D+ V+ A+ L  +++       
Sbjct: 182 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYRWDLSVEDALYLGKRSILAAAHRD 241

Query: 205 ALTYDRVEFATIKLGENGKLYQ 226
           A +   V  + +   ENG +Y 
Sbjct: 242 AYSGGSVNLSHVT--ENGWVYH 261

>KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590)
           [648 bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 85/191 (44%), Gaps = 20/191 (10%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL +++DKI    +G  +D + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y E    +   I      + K   T            I AGYD++   ++
Sbjct: 79  QYHLELYTSQYGEPTTKVAASIFKTLCYENKDHLT---------AGIIVAGYDEKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSA-AQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALT 207
           Y S P G     ++ S+  + SA        +YK+D+  +  IE    +LS+     A+ 
Sbjct: 130 Y-SIPLGGSVHKQSYSIAGSGSAFIYGYCDKNYKEDMTKEETIEFVKHSLSQ-----AIK 183

Query: 208 YDRVEFATIKL 218
           +D      I++
Sbjct: 184 WDGSSGGVIRM 194

>KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 89/214 (41%), Gaps = 17/214 (7%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEI-- 86
           I+H  T +    + GIV+A + + T+       + +K+  +N  ++  +AG  +D +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   E I V    K LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGTQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+ A+ L  +++   T   
Sbjct: 184 GPTIYYVDSDGTRLKGDMFCVGSGQTFAYGVLDSNYKWDLSVEEALYLGKRSILAATHRD 243

Query: 205 ALTYDRVEFATIKLGENGKLYQKVFKPEEIQTLL 238
           A +   V    +   E G +Y      + I+TL 
Sbjct: 244 AYSGGSVNLYHVT--EQGWVYH---GNQNIETLF 272

>TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 86/202 (42%), Gaps = 14/202 (6%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAE--- 85
           I+H  T +    + GIV+A + + T+       + +K+  +N  ++  +AG  +D +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   E I V    K LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGAQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK ++ V+ A+EL  +++   T   
Sbjct: 184 GPTVYYVDSDGTRLKGDLFCVGSGQTFAYGVLDANYKWELGVEEALELGKRSILAATHRD 243

Query: 205 ALTYDRVEFATIKLGENGKLYQ 226
           A +   V    +   E+G +Y 
Sbjct: 244 AYSGGSVNLYHVT--EDGWVYH 263

>TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON}
           Anc_3.417 YPR103W
          Length = 287

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 86/202 (42%), Gaps = 14/202 (6%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEI-- 86
           I+H  T +    + GIV+A + + T+       + +K+  +N  ++  +AG  +D +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    L+   E I V    K LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+ A+ L  +++   T   
Sbjct: 184 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLGKRSILAATHRD 243

Query: 205 ALTYDRVEFATIKLGENGKLYQ 226
           A +   +    +   ENG +Y 
Sbjct: 244 AYSGGSINLYHVT--ENGWIYH 263

>Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp,
           215 aa] {ON} similar to Ashbya gossypii AAL172C 1-intron
          Length = 215

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 91/208 (43%), Gaps = 14/208 (6%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL R++DKI    +G  +D + + +  
Sbjct: 19  GTSIMAVTYKDGVILGADSRTTTGTYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
           + H   Y   Y E   V       S I   Y     L       I AGYDD+   ++YT 
Sbjct: 79  QHHLDLYAAQYGEP-SVNTAASLFSTI--CYENKDFLT---AGIIVAGYDDKNKGEVYTI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTYDRV 211
              G+         G+ ++        ++K+++  +  I     +LS+     A+ +D  
Sbjct: 133 PLGGSVHKAPYAIAGSGSTFIYGYCDKNFKENMSKEETIRFMKHSLSQ-----AIKWDGS 187

Query: 212 EFATIKLGENGK--LYQKVFKPEEIQTL 237
               I++    K  + + +F PE+ ++L
Sbjct: 188 SGGVIRMVVLTKEGVERLIFYPEDYESL 215

>Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 85/202 (42%), Gaps = 14/202 (6%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEI-- 86
           I+H  T +    + GIV+A + + T+       + +K+  +N  ++  +AG  +D +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    L+   E I V    K LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+ A+ L  +++       
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRD 243

Query: 205 ALTYDRVEFATIKLGENGKLYQ 226
           A +   V    +   E+G +Y 
Sbjct: 244 AFSGGSVNLYHVT--EDGWIYH 263

>Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 aa]
           {ON} YJL001W (REAL)
          Length = 216

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/211 (20%), Positives = 91/211 (43%), Gaps = 20/211 (9%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL R++DKI    +G  +D + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RIHAQNYLKTY---NEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y   + +    +  +   + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTY 208
           YT    G+         G+ ++        +++D++  +  +     +LS+     A+ +
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRDNMSKEETVNFIKHSLSQ-----AIKW 184

Query: 209 DRVEFATIKLG--ENGKLYQKVFKPEEIQTL 237
           D      I++       + + VF P+E + L
Sbjct: 185 DGSSGGVIRMVVLTAAGVERLVFYPDEYEQL 215

>TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 bp,
           219 aa] {ON} Anc_5.216 YJL001W
          Length = 219

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 72/167 (43%), Gaps = 10/167 (5%)

Query: 35  AIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTARIH 94
           ++ +  +DG++L A+ + T+     +  T+KL R+++KI    +G  +D + + +  + H
Sbjct: 26  SMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHEKIWCCRSGSAADTQAIADIVQYH 85

Query: 95  AQNYLKTYNEDI--PVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
              Y   Y E        + K L      Y     L       I AGYD++   ++Y+  
Sbjct: 86  LDLYTAQYGEPSTKTAAAVFKELC-----YENKDNLTA---GIIVAGYDEKNKGEVYSIP 137

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSK 199
             G+    K    G+ ++        ++KDD+  D  +     +LS+
Sbjct: 138 LGGSMHKQKYAIAGSGSTFIYGYCDKNFKDDMTKDETVNFMKNSLSQ 184

>ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 91/212 (42%), Gaps = 22/212 (10%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
           GT+I  +  +DG++L A+ + T      +  T+KL R++DK+    +G  +D + + +  
Sbjct: 19  GTSIMAVSFKDGVILGADSRTTMGPYVANRVTDKLTRVHDKVWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNED---IPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + +   Y   Y E        I  +   + K   T            I AGYD++   ++
Sbjct: 79  QYYLDLYTAQYGEPSTRTAAAIFQQLCYENKDALT---------AGIIVAGYDEKNQGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTY 208
           Y+    G+    K    G+ ++        +YKD +  D  ++    +LS+     A+ +
Sbjct: 130 YSIPIGGSLHKQKYAIAGSGSTFIYGYCDKNYKDGMTKDETVDFIKHSLSQ-----AIKW 184

Query: 209 DRVEFATIK---LGENGKLYQKVFKPEEIQTL 237
           D      I+   L +NG + + +  PEE + L
Sbjct: 185 DGSSGGVIRMVVLTKNG-VERLIVYPEEFENL 215

>Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 85/202 (42%), Gaps = 14/202 (6%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEI-- 86
           I+H  T +    + GIV+A + + T+       + +K+  +N  ++  +AG  +D +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    L+   E I V    K LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+ A+ L  +++       
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRD 243

Query: 205 ALTYDRVEFATIKLGENGKLYQ 226
           A +   +    +   E+G +Y 
Sbjct: 244 AFSGGSINLYHVT--EDGWIYH 263

>Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 94/212 (44%), Gaps = 22/212 (10%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL R++DKI    +G  +D + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTY---NEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y   + +    I  +   + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAAAIFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTY 208
           YT    G+         G+ ++        ++++++  +  ++    +LS+     A+ +
Sbjct: 130 YTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQ-----AIKW 184

Query: 209 DRVEFATIK---LGENGKLYQKVFKPEEIQTL 237
           D      I+   L E G + + +F P+E + L
Sbjct: 185 DGSSGGVIRMVVLTEAG-VERLIFYPDEYERL 215

>Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL001W
           (PRE3) - Subunit of 20S proteasome [contig 94] FULL
          Length = 193

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 91/207 (43%), Gaps = 19/207 (9%)

Query: 36  IGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHA 95
           + +  +DG++L A+ + T+     +  T+KL R++DK+    +G  +D + + +      
Sbjct: 1   MAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKVWCCRSGSAADTQAVADI----V 56

Query: 96  QNYLKTYNEDIPVEILVKRLSDIKQ--GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNP 153
           Q+YL+ Y      E   K  + I +   Y     L       I AG+DD+   ++Y+   
Sbjct: 57  QHYLELYTAQFG-EPSTKTAASIFKTLCYENKDNLT---AGIIVAGFDDKNKGEVYSIPL 112

Query: 154 SGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTYDRVEF 213
            G+    K    G+ ++        ++K+D+  D  I     +LS+     A+ +D    
Sbjct: 113 GGSVHKQKYAIAGSGSTFIYGYCDKNFKEDMTKDETISFMKNSLSQ-----AIKWDGSSG 167

Query: 214 ATIK---LGENGKLYQKVFKPEEIQTL 237
             I+   L + G   + +F PEE + L
Sbjct: 168 GVIRMVVLTKEGA-ERLIFYPEEYENL 193

>Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa]
           {ON} complement(382038..382904) [867 nt, 289 aa]
          Length = 288

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 85/202 (42%), Gaps = 14/202 (6%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEI-- 86
           I+H  T +    + GI++A + + T+       + +K+  +N  ++  +AG  +D +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK  +  I V    K LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LKEKSR-ISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ VD A+ L  +++       
Sbjct: 184 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVDEALYLGKRSILAAAHRD 243

Query: 205 ALTYDRVEFATIKLGENGKLYQ 226
           A +   +    +   ENG +Y 
Sbjct: 244 AYSGGSINLYHVT--ENGWVYH 263

>NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEI-- 86
           I+H  T +    + GI++A + + T+       + +K+  +N  ++  +AG  +D +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK   E I V    K LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+ A+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDTNYKWDLTVEDALYLGKRSI 236

>NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {ON}
           Anc_3.417
          Length = 287

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEI-- 86
           I+H  T +    + GIV+A + + T+       + +K+  +N  ++  +AG  +D +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK  N  I V    K LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LKEKNR-ISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+ A+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLGKRSI 236

>TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 91/210 (43%), Gaps = 17/210 (8%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
           GT+I  +  +DG++L A+ + T      +  T+KL R++DKI    +G  +D + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTMGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPF-GVSFIYAGYDDRYGYQLYT 150
           + H + Y   Y   IP     +  + + Q        + F     I AG+DD+       
Sbjct: 79  QYHLEVYTSQYG--IPS---TRTAASVFQSLCYEN--KDFLSAGIIVAGFDDKSEKGEVY 131

Query: 151 SNPSGNYTGWKAISVGANTSA-AQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTYD 209
           S P G     +  ++  + SA        +YK D+  D  +E    +LS+     A+ +D
Sbjct: 132 SIPLGGSIHKQPYAIAGSGSAFIYGYCDKNYKPDMTKDETVEFMKHSLSQ-----AIKWD 186

Query: 210 RVEFATIKLGENGK--LYQKVFKPEEIQTL 237
                 I+L    K  + + +F PE+ + L
Sbjct: 187 GSSGGVIRLVVLTKSGVERLIFYPEDYENL 216

>Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/212 (20%), Positives = 94/212 (44%), Gaps = 22/212 (10%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL R++DKI    +G  +D + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RIHAQNYLKTY---NEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y   + +    +  +   + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGPPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTY 208
           YT    G+         G+ ++        ++++++  +  ++    +LS+     A+ +
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQ-----AIKW 184

Query: 209 DRVEFATIK---LGENGKLYQKVFKPEEIQTL 237
           D      I+   L  +G + + +F P+E + L
Sbjct: 185 DGSSGGVIRMVVLTADG-VERLIFYPDEYERL 215

>KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/177 (20%), Positives = 72/177 (40%), Gaps = 4/177 (2%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILI 88
           I+H  T +    + GIV+A + + T+       + +K+  +N  ++  +AG  +D +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + Y     + I V    K L+++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGSQCRLYELKEKQRITVAAASKILANLVYQYKGAG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSA 205
           Y  +  G         VG+  + A  +L  +YK D+ V+ A+ L  + +   T   A
Sbjct: 188 YYVDSDGTRLKGDVFCVGSGQTFAYGVLDTNYKWDLSVEDALYLGKRAILAATHRDA 244

>TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/213 (21%), Positives = 92/213 (43%), Gaps = 23/213 (10%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL R+ DKI    +G  +D + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-Q 147
           +   + Y   + E    +   I      D K   +            I AG+DD+    +
Sbjct: 79  QYQLELYTAQFGEPSTKVAASIFKTMCYDNKDNLS---------AGIIVAGFDDKENKGE 129

Query: 148 LYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALT 207
           +Y+    G+    K    G+ ++        ++KDD+  D  +     +LS+     A+ 
Sbjct: 130 VYSIPLGGSLHKQKYAIAGSGSAFIYGYCDKNFKDDMTKDETVNFMKHSLSQ-----AIK 184

Query: 208 YDRVEFATIK---LGENGKLYQKVFKPEEIQTL 237
           +D      I+   L ++G + + +F P+E + L
Sbjct: 185 WDGSSGGVIRMVVLTKDG-VERLIFYPDEYENL 216

>ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 85/202 (42%), Gaps = 14/202 (6%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAE--- 85
           I+H  T +    + GI++A + + ++       + +K+  +N  ++  +AG  +D +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRASAGSWVASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   E I V    K L ++   Y  +G      +  +  GY  + 
Sbjct: 132 TWLGAQCRLHE---LKE-KERISVAAASKILCNLVYEYKGYG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+ A+ L  +++   T   
Sbjct: 184 GPTVYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEEALYLGKRSIIAATHRD 243

Query: 205 ALTYDRVEFATIKLGENGKLYQ 226
           A +   V    +   ENG ++ 
Sbjct: 244 AYSGGSVNLYHVT--ENGWVFH 263

>YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5
           subunit of the 20S proteasome, responsible for the
           chymotryptic activity of the proteasome
          Length = 287

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 85/202 (42%), Gaps = 14/202 (6%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEI-- 86
           I+H  T +    + GI++A + + T+       + +K+  +N  ++  +AG  +D +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    L+   E I V    K LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+ A+ L  +++       
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRD 243

Query: 205 ALTYDRVEFATIKLGENGKLYQ 226
           A +   V    +   E+G +Y 
Sbjct: 244 AYSGGSVNLYHVT--EDGWIYH 263

>Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 85/202 (42%), Gaps = 14/202 (6%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEI-- 86
           I+H  T +    + GIV+A + + T+       + +K+  +N  ++  +AG  +D +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    L+   E I V    K LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ ++ A+ L  +++       
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSIEDALYLGKRSILAAAHRD 243

Query: 205 ALTYDRVEFATIKLGENGKLYQ 226
           A +   V    +   E+G +Y 
Sbjct: 244 AYSGGSVNLYHVT--EDGWIYH 263

>YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {ON}
            PRE3Beta 1 subunit of the 20S proteasome, responsible
           for cleavage after acidic residues in peptides
          Length = 215

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/211 (19%), Positives = 92/211 (43%), Gaps = 20/211 (9%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL R++DKI    +G  +D + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RIHAQNYLKTY---NEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y   + +    +  +   + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTY 208
           YT    G+         G+ ++        ++++++  +  ++    +LS+     A+ +
Sbjct: 130 YTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQ-----AIKW 184

Query: 209 DRVEFATIKLG--ENGKLYQKVFKPEEIQTL 237
           D      I++       + + +F P+E + L
Sbjct: 185 DGSSGGVIRMVVLTAAGVERLIFYPDEYEQL 215

>Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON}
           YPR103W (PRE2) - proteasome subunit [contig 47] FULL
          Length = 287

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 75/173 (43%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEI-- 86
           ++H  T +    + GIV+A + + T+       + +K+  +N  ++  +AG  +D +   
Sbjct: 72  LAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   E I V    K LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGTQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+ A+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYKWDLTVEEALYLGKRSI 236

>CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103w PRE2
          Length = 286

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 75/173 (43%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEI-- 86
           I+H  T +    + GIV+A + + T+       + +K+  +N  ++  +AG  +D +   
Sbjct: 71  IAHGTTTLAFRFQGGIVVAVDSRATAGQWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 130

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK   E I V    K L ++   Y   G      +  +  GY  + 
Sbjct: 131 TWLGSQCRLHE---LKE-KERISVAAASKILGNLVYQYKGAG----LSMGTMICGYTKKE 182

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+ A+ L  +++
Sbjct: 183 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLSVEEALYLGKRSI 235

>AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 aa]
           {ON} syntenic homolog of Saccharomyces cerevisiae
           YJL001W (PRE3); 1-intron
          Length = 215

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 88/209 (42%), Gaps = 16/209 (7%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL R++D+I    +G  +D + + +  
Sbjct: 19  GTSIMAVKFRDGVILGADSRTTTGTYIANRVTDKLTRVHDRIWCCRSGSAADTQAVADMV 78

Query: 92  RIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
           + + + Y   Y E           S I      H          I AGYDD+   ++Y+ 
Sbjct: 79  QHYLELYTMQYGEP-SASTAASLFSTICYENKDH-----LTAGIIVAGYDDKNKGEVYSI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTYDRV 211
              G+         G+ ++         +++D+  +  I+    +LS+     A+ +D  
Sbjct: 133 PLGGSVHKAPYAIAGSGSTFIYGYCDKHFREDMSKEETIDFMKHSLSQ-----AIKWDGS 187

Query: 212 EFATIK---LGENGKLYQKVFKPEEIQTL 237
               I+   L E G   + +F PE+ + L
Sbjct: 188 SGGVIRMVVLTEAGA-ERLIFYPEDYENL 215

>KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 bp,
           216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 93/210 (44%), Gaps = 17/210 (8%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
           GT+I  +  + G++L A+ + T+     +  T+KL R++DKI    +G  +D + + +  
Sbjct: 19  GTSIMAVTFDGGVILGADSRTTTGAYIANRVTDKLTRIDDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-QLYT 150
           + H + Y   Y     +E        +   Y     L       I AGYDD+    ++Y+
Sbjct: 79  QYHLELYTSQYGTP-SIETAAAVFKTLT--YENKDALSA---GIIVAGYDDKKKKGEVYS 132

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTYDR 210
               G+    K    G+ ++        +Y++++  +  +E    +LS+     A+ +D 
Sbjct: 133 IPLGGSVHKQKYAIAGSGSAFIYGYCDKNYRENMNKEETVEFVKHSLSQ-----AIKWDG 187

Query: 211 VEFATIK---LGENGKLYQKVFKPEEIQTL 237
                I+   L E+G + + +F P+E + L
Sbjct: 188 SSGGVIRLVILTESG-VERLIFYPDEYENL 216

>KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 85/202 (42%), Gaps = 14/202 (6%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAE--- 85
           I+H  T +    + GI++A + + T+       + +K+  +N  ++  +AG  +D +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK   + I V    K LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LKE-KDRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+ A+ L  +++       
Sbjct: 184 GPTVYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLGKRSILAAAHRD 243

Query: 205 ALTYDRVEFATIKLGENGKLYQ 226
           A +   +    +   ENG +Y 
Sbjct: 244 AYSGGSINLYHVT--ENGWVYH 263

>KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 285

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/202 (20%), Positives = 85/202 (42%), Gaps = 14/202 (6%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEI-- 86
           I+H  T +    + GI++A + + T+       + +K+  +N  ++  +AG  +D +   
Sbjct: 69  IAHGTTTLAFRFKGGIIVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 128

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    L+   E I V    K LS++   Y   G      +  +  GY  + 
Sbjct: 129 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKE 180

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +Y+ D+ V+ A+ +  +++       
Sbjct: 181 GPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYRWDLSVEEALYIGKRSILAAAHRD 240

Query: 205 ALTYDRVEFATIKLGENGKLYQ 226
           A +   +    +   ENG +Y 
Sbjct: 241 AYSGGSINLYHVT--ENGWVYH 260

>Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar to
           Ashbya gossypii AEL326C
          Length = 285

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 83/202 (41%), Gaps = 14/202 (6%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAE--- 85
           I+H  T +    + GIV+A + + T+       + +K+  +N  ++  +AG  +D +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 129

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   E I V    K L ++   Y   G      +  +  GY  + 
Sbjct: 130 TWLGAQCRLHE---LKE-KERISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKE 181

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+ A+ L  +++       
Sbjct: 182 GPTIYYVDSDGMRLKGDLFCVGSGQTFAYGVLDTNYKWDLTVEEALYLGKRSILAAAHRD 241

Query: 205 ALTYDRVEFATIKLGENGKLYQ 226
           A +   V    +   ENG ++ 
Sbjct: 242 AYSGGSVNLYHVT--ENGWVFH 261

>SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137)
           [648 bp, 215 aa] {ON} similar to uniprot|P38624
           Saccharomyces cerevisiae YJL001W PRE3 20S proteasome
           beta-type subunit, responsible for cleavage after acidic
           residues in peptides
          Length = 215

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL R++DKI    +G  +D + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE 104
           + H + Y   Y E
Sbjct: 79  QYHLELYDSQYGE 91

>TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 44/212 (20%), Positives = 91/212 (42%), Gaps = 21/212 (9%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL R+ DKI    +G  +D + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-Q 147
           +   + Y   + E    +   I      D K   +            I AG+DD+    +
Sbjct: 79  QYQLELYTAQFGEPSTKVAASIFKTMCYDNKDNLS---------AGIIVAGFDDKENKGE 129

Query: 148 LYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALT 207
           +Y+    G+    K    G+ ++        +YK+++  D  ++    +LS+     A+ 
Sbjct: 130 VYSIPLGGSLHKQKYAIAGSGSTFIYGYCDKNYKENMTKDETVDFMKHSLSQ-----AIK 184

Query: 208 YDRVEFATIKLGENGK--LYQKVFKPEEIQTL 237
           +D      I++    K  + + +F P+E + L
Sbjct: 185 WDGSSGGVIRMVVVTKDGVERLIFYPDEYENL 216

>SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 37.7 bits (86), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 74/173 (42%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEI-- 86
           I+H  T +    + GI++A + + T+       + +K+  +N  ++  +AG  +D +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGSWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   + I V    K L ++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGTQCRLHE---LKE-KQRISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ ++ A+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYKWDLTIEDALYLGKRSI 236

>KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 37.0 bits (84), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 94/211 (44%), Gaps = 20/211 (9%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL R+++K+    +G  +D + + +  
Sbjct: 19  GTSIMAVTFRDGVILGADSRTTTGAYIANRVTDKLTRVHEKVWCCRSGSAADTQAVADI- 77

Query: 92  RIHAQNYLKTYNEDIPVEILVKRLSDIKQ--GYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
               Q+YL+ Y      E   K  + I +   Y     L       I AGYD++   ++Y
Sbjct: 78  ---VQHYLELYTAQFG-EPSTKTAASIFKTLCYENKDNLTA---GIIVAGYDEKNKGEVY 130

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTYD 209
           +    G+    K    G+ ++        +YK+++  D  +     +LS+     A+ +D
Sbjct: 131 SIPLGGSVHKQKYAIAGSGSTFIYGYCDKNYKENMSKDETVSFMKNSLSQ-----AIKWD 185

Query: 210 RVEFATIK---LGENGKLYQKVFKPEEIQTL 237
                 I+   L ++G   + +F PE+ + L
Sbjct: 186 GSSGGVIRMVVLTKDGA-ERLIFYPEDYENL 215

>KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [651
           bp, 216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL R++DKI    +G  +D + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTY 102
           + H + Y   Y
Sbjct: 79  QYHLELYESQY 89

>KLTH0G00550g Chr7 (38715..39512) [798 bp, 265 aa] {ON} highly
           similar to uniprot|P30657 Saccharomyces cerevisiae
           YFR050C PRE4 20S proteasome beta-type subunit
          Length = 265

 Score = 36.6 bits (83), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 85/191 (44%), Gaps = 16/191 (8%)

Query: 20  YQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAG 79
           Y   +  + I    + I +  +DG+++AA+R  +   L + +  E+L+ +    VV ++G
Sbjct: 29  YPSMHTQQPIVTGTSVISMKYKDGVIIAADRLGSYGSLLRFSDVERLFPVGRNTVVGISG 88

Query: 80  LTSDAEILINT--ARIHAQNYLKTYNED---IPVEILVKRLSDIKQGYTQHGGLRPFGVS 134
             SD + L N         NY   Y ED   +    + + L+++   Y +   + P   +
Sbjct: 89  DISDMQHLENLLDEMQTENNYDNEYAEDEEALKPSYVFEYLANVM--YNRRSKMNPLWNA 146

Query: 135 FIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--VDYKDDIK------V 186
            I AG +D   +  Y +     Y+   +++ G     A  LL+  VD + D+K       
Sbjct: 147 LIVAGLEDGKPFLKYVNLLGVTYSA-PSLATGFGAHLALPLLRKIVDSESDVKKTSAEDA 205

Query: 187 DGAIELALKTL 197
           + +I+ A+K L
Sbjct: 206 EKSIKEAMKVL 216

>NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 36.2 bits (82), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 94/211 (44%), Gaps = 19/211 (9%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL R++DK+    +G  +D + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRIHDKVWCCRSGSAADTQAVADI- 77

Query: 92  RIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDD--RYGYQLY 149
               Q YL  Y             S  K    ++      G+  I AG+DD  + G ++Y
Sbjct: 78  ---VQYYLDLYTTQYGTPSTKTAASVFKTLCYENKDNLTAGI--IVAGFDDDTKKG-EVY 131

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTYD 209
           +    G+    K    G+ ++        ++K+D+  D  I     +LS+     A+ +D
Sbjct: 132 SVPLGGSIHKQKYAIAGSGSTFIYGYCDKNFKEDMTKDETIHFIKHSLSQ-----AIKWD 186

Query: 210 RVEFATIK---LGENGKLYQKVFKPEEIQTL 237
                 I+   L E+G + + +F P+E + L
Sbjct: 187 GSSGGVIRMVILTESG-VERLIFYPDEYENL 216

>NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 35.4 bits (80), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 45/213 (21%), Positives = 89/213 (41%), Gaps = 23/213 (10%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL +++DKI    +G  +D + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNY---LKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-Q 147
           + H   Y     T +      +      + K   T            I AG+DD     +
Sbjct: 79  QYHLDIYSTQFGTPSTKTAASVFKTLCYENKDNLT---------AGIIVAGFDDATNKGE 129

Query: 148 LYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALT 207
           +Y+    G+    K    G+ ++        ++KDD+  D  +     +LS+     A+ 
Sbjct: 130 VYSVPLGGSIHKQKYAIAGSGSTFIYGYCDKNFKDDMTKDETVHFIKHSLSQ-----AIK 184

Query: 208 YDRVEFATIK---LGENGKLYQKVFKPEEIQTL 237
           +D      I+   L   G + + +F P+E + L
Sbjct: 185 WDGSSGGVIRMVVLTSEG-VERLIFYPDEYENL 216

>CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P38624 Saccharomyces
           cerevisiae YJL001w PRE3
          Length = 215

 Score = 35.0 bits (79), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 44/211 (20%), Positives = 91/211 (43%), Gaps = 20/211 (9%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL R++D I    +G  +D + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDNIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNED--IPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
           + +   Y   + E        + K L      Y     L       I AGYD++   ++Y
Sbjct: 79  QYYLDMYEGQFGEPDTYTAANMFKTLC-----YQNKDALT---AGIIVAGYDEKNKGEVY 130

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTYD 209
           +    G+         G+ ++        ++++++  D  I+    +LS+     A+ +D
Sbjct: 131 SIPLGGSIHKQPYAIAGSGSTFIYGYCDKNFRENMSKDETIDFIKHSLSQ-----AIKWD 185

Query: 210 RVEFATIK---LGENGKLYQKVFKPEEIQTL 237
                 I+   L ++G   + +F PEE + L
Sbjct: 186 GSSGGVIRMVVLTKDGP-ERLIFYPEEYENL 215

>Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W
           (REAL)
          Length = 349

 Score = 33.1 bits (74), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 4   RRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIV 45
           RR++   T+  P+G LY V++A    +H G  +  +  DGI+
Sbjct: 96  RRWNKLCTLNDPKGSLYSVKFA---PAHLGLKLACLGNDGIL 134

>KLTH0C07348g Chr3 (636295..637245) [951 bp, 316 aa] {ON} weakly
           similar to uniprot|P38236 YBR057C Saccharomyces
           cerevisiae MUM2 Cytoplasmic protein essential for
           meiotic DNA replication and sporulation
          Length = 316

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 64/127 (50%), Gaps = 15/127 (11%)

Query: 7   DSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERK----VTSKLLEQDTS 62
           DSR +  S +GR  ++  +LESI H  +++ I A+D  +    R+    VT+  L    S
Sbjct: 188 DSRVSSASQKGRTVEMPVSLESIFHKMSSV-IAAKDKELEETSRRLESIVTAIALNPSNS 246

Query: 63  TEKLYR-----LNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSD 117
             KL R     L  K+VV +  LT + +   + A++    Y ++  + I +E++ +   +
Sbjct: 247 VTKLGRYDEEALAHKMVVRLETLTKENQ---DMAKMLG--YGRSKEQHIELELIKRENQE 301

Query: 118 IKQGYTQ 124
           +K+  +Q
Sbjct: 302 LKRKLSQ 308

>KNAG0F03310 Chr6 (625561..628143) [2583 bp, 860 aa] {ON} 
          Length = 860

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 184 IKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTLLVKNGI 243
            K DGA+ + LK    T D+ +L    ++F T K+G+      K+    +I  ++   G 
Sbjct: 29  FKFDGAVSVTLKVNDDTVDTVSLNSIDIDFHTAKIGDVENAEIKLDNESQIAAIVFPKG- 87

Query: 244 TKAGEDE 250
           T AG+DE
Sbjct: 88  TLAGKDE 94

>Kwal_23.2949 s23 (85646..90499) [4854 bp, 1617 aa] {ON} YOR093C -
           Hypothetical ORF [contig 247] FULL
          Length = 1617

 Score = 31.2 bits (69), Expect = 2.7,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 8/69 (11%)

Query: 7   DSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQDTSTEKL 66
           DS   I     RLY+ E A+  I+H     GI + D + L AER      +  + +  KL
Sbjct: 158 DSLPAILRARSRLYERETAILGINHKNKETGI-SWDKLYLRAER------VAHELTKHKL 210

Query: 67  YRLNDKIVV 75
           Y++ DK+++
Sbjct: 211 YKM-DKVLL 218

>TBLA0E00150 Chr5 (19516..20313) [798 bp, 265 aa] {ON} Anc_3.574
           YFR050C
          Length = 265

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 73/161 (45%), Gaps = 13/161 (8%)

Query: 33  GTAIGIMA-EDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEIL---- 87
           GT++  M  + G+V+AA+   +   L +    E+L ++    VV V+G  SD + +    
Sbjct: 41  GTSVLAMKYKGGVVIAADNLASYGSLLRFNGIERLIKVGQNTVVGVSGDVSDMQHIERLL 100

Query: 88  --INTARIHAQNYLKTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYG 145
             I T   +   Y +++ +  P  +  K LS +   Y++   + P   + I AG ++   
Sbjct: 101 EEIETDNNYDNTYSESFEQLQPSYVF-KYLSAVM--YSRRSKMNPLWNAIIVAGVENGAP 157

Query: 146 YQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--VDYKDDI 184
           +  Y +     YT    ++ G     A  L++  VD ++D+
Sbjct: 158 FMRYVNLLGVTYTS-PTLATGFGAHLANPLMRRVVDREEDV 197

>TDEL0B07110 Chr2 complement(1254814..1257480) [2667 bp, 888 aa]
           {ON} Anc_2.618 YKL073W
          Length = 888

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 10/56 (17%)

Query: 111 LVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-----QLYTSNPSGNYTGWK 161
           L+K L D K+    HGGL     +F  AGY+ +  +       Y SNP    +GW+
Sbjct: 697 LIKELEDAKE--VTHGGLASINETFNQAGYNSQQEFAKINLPHYISNP---LSGWQ 747

>TDEL0D02350 Chr4 (456952..458988) [2037 bp, 678 aa] {ON} Anc_1.364
           YOL023W
          Length = 678

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 69/165 (41%), Gaps = 29/165 (17%)

Query: 26  LESISHAGTA-----IGIMAEDGIVLAAER-----KVTSKLLEQDTSTEKLYRLNDKIVV 75
           +E+I HA  +     + I   D I  A ER     KVT+ L+ QD + EK+    D  V+
Sbjct: 238 IEAIKHAKNSGNELIVAITKIDRISQAKERERAMEKVTNDLITQDIAVEKIG--GDVQVI 295

Query: 76  AVAGLTSDAE--------ILINTARIHAQNYLKTYNEDIPVEILVKRLSD------IKQG 121
            ++  T +          IL +   I A+N  KT  E   +E  VK+         +K+G
Sbjct: 296 PISAKTGENMDLLEESIVILSDVMDIKAENSPKTVAEGWILESQVKKTVGNVATVLVKKG 355

Query: 122 YTQHGGLRPFGVSFIYA-GYDDRYGYQLYTSNPSG--NYTGWKAI 163
             Q G +   G ++       +  G Q+  + PS      GWK +
Sbjct: 356 TVQKGKILVCGNTYCKVRSIHNEGGQQVPKALPSDAVEVLGWKEL 400

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa]
           {ON} some similarities with uniprot|Q02455 Saccharomyces
           cerevisiae YKR095W MLP1 Myosin-like protein associated
           with the nuclear envelope, connects the nuclear pore
           complex with the nuclear interior; involved in the Tel1p
           pathway that controls telomere length; involved in the
           retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score = 29.6 bits (65), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 65  KLYRLNDKIVV---AVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRL 115
           +L   N K+ V    VA L ++ E+L ++ R   +NYLK   E   + I+V +L
Sbjct: 750 ELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKLSEERNSLRIMVSQL 803

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.132    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,312,276
Number of extensions: 1100216
Number of successful extensions: 3049
Number of sequences better than 10.0: 262
Number of HSP's gapped: 2852
Number of HSP's successfully gapped: 262
Length of query: 253
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 146
Effective length of database: 41,212,137
Effective search space: 6016972002
Effective search space used: 6016972002
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)