Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D09724g3.500ON1391397196e-99
TDEL0D056803.500ON1401405201e-68
NCAS0F035903.500ON1401404836e-63
Skud_16.4473.500ON1401404621e-59
Smik_16.4053.500ON1391394602e-59
YPR153W3.500ON1401404567e-59
Suva_16.4813.500ON1391394532e-58
CAGL0L08382g3.500ON1401404437e-57
Kpol_480.93.500ON1411424299e-55
KNAG0A079803.500ON1471404117e-52
TPHA0A057103.500ON1411384082e-51
SAKL0F02508g3.500ON1401404002e-50
TBLA0C045203.500ON1401363976e-50
KLTH0G02354g3.500ON1401403942e-49
KAFR0G037303.500ON1441343655e-45
KLLA0E03895g3.500ON1401403273e-39
AFR319W3.500ON1411322701e-30
Kwal_47.189033.500ON113451585e-14
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D09724g
         (139 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {O...   281   6e-99
TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 14...   204   1e-68
NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.50...   190   6e-63
Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 a...   182   1e-59
Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W...   181   2e-59
YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {...   180   7e-59
Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W...   179   2e-58
CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {...   175   7e-57
Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 1...   169   9e-55
KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 14...   162   7e-52
TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3....   161   2e-51
SAKL0F02508g Chr6 complement(217712..217835,217912..218205,21827...   158   2e-50
TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3....   157   6e-50
KLTH0G02354g Chr7 complement(185220..185343,185400..185693,18576...   156   2e-49
KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa...   145   5e-45
KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423...   130   3e-39
AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa...   108   1e-30
Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON} YPR15...    65   5e-14

>ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {ON}
           similar to uniprot|Q06HN0 Saccharomyces cerevisiae
           YPR153W Hypothetical ORF
          Length = 139

 Score =  281 bits (719), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 139/139 (100%), Positives = 139/139 (100%)

Query: 1   MRSFITTNDVPVGYETPSFPSLYWPTESRTSLHVIYDVSAIWKFTLYWSLIFNFGFYALT 60
           MRSFITTNDVPVGYETPSFPSLYWPTESRTSLHVIYDVSAIWKFTLYWSLIFNFGFYALT
Sbjct: 1   MRSFITTNDVPVGYETPSFPSLYWPTESRTSLHVIYDVSAIWKFTLYWSLIFNFGFYALT 60

Query: 61  GLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCCA 120
           GLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCCA
Sbjct: 61  GLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCCA 120

Query: 121 VAQVLYDFTASFSSSASIL 139
           VAQVLYDFTASFSSSASIL
Sbjct: 121 VAQVLYDFTASFSSSASIL 139

>TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 140
           aa] {ON} Anc_3.500 YPR153W
          Length = 140

 Score =  204 bits (520), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 95/140 (67%), Positives = 116/140 (82%), Gaps = 1/140 (0%)

Query: 1   MRSFITTNDVPVGYETPSFPSLYWP-TESRTSLHVIYDVSAIWKFTLYWSLIFNFGFYAL 59
           MRSFIT NDVP+GY TPSFPSL+WP +  + SL V+YDV  IWKFTLYWSLIFN  FY +
Sbjct: 1   MRSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGI 60

Query: 60  TGLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCC 119
            GLWAS+SHR++AGGLWIMA+Y  YGG+Q VA GT+ GFLIG+IYS+GLFSMSTWIP CC
Sbjct: 61  AGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCC 120

Query: 120 AVAQVLYDFTASFSSSASIL 139
            + Q+L+DF+ S+ SS +I+
Sbjct: 121 VIVQILFDFSVSYLSSGTIM 140

>NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score =  190 bits (483), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 109/140 (77%), Gaps = 1/140 (0%)

Query: 1   MRSFITTNDVPVGYETPSFPSLYWPTESRT-SLHVIYDVSAIWKFTLYWSLIFNFGFYAL 59
           MRSFIT ND+P+GY TP FPSLYWP  ++   +  +Y++S IWKFTLYW+LIFN  FY  
Sbjct: 1   MRSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGA 60

Query: 60  TGLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCC 119
            GL ASFSHR+  GG+WIM +Y T+ GVQG+A+GTI GFLIG IY +GLF+MSTWIP CC
Sbjct: 61  AGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCC 120

Query: 120 AVAQVLYDFTASFSSSASIL 139
           AVAQ+L+D   ++SS + IL
Sbjct: 121 AVAQILFDVIMAYSSVSGIL 140

>Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 aa]
           {ON} YPR153W (REAL)
          Length = 140

 Score =  182 bits (462), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 104/140 (74%), Gaps = 1/140 (0%)

Query: 1   MRSFITTNDVPVGYETPSFPSLYWP-TESRTSLHVIYDVSAIWKFTLYWSLIFNFGFYAL 59
           MRSF+T ND+PVGY TP FPSLYWP   SR ++  +Y +S IWKF+LYW+LIFN  FY  
Sbjct: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINSSRYNIAFLYYISDIWKFSLYWTLIFNGAFYVT 60

Query: 60  TGLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCC 119
           TGL+AS +HRK+ G +WI  +Y  YGGVQG+  GT+ GFLIG IY SGLFSMSTWIP CC
Sbjct: 61  TGLYASLTHRKKGGSIWIFVMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCC 120

Query: 120 AVAQVLYDFTASFSSSASIL 139
           AV Q+L+D    +S   S++
Sbjct: 121 AVVQILFDVILGYSMIGSVM 140

>Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score =  181 bits (460), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 105/139 (75%), Gaps = 1/139 (0%)

Query: 2   RSFITTNDVPVGYETPSFPSLYWPTES-RTSLHVIYDVSAIWKFTLYWSLIFNFGFYALT 60
           RSF+T ND+PVGY TP FPSLYWP  + R +   +Y +S IWKF+LYW+LIFN  FY +T
Sbjct: 1   RSFVTNNDIPVGYVTPKFPSLYWPINNPRYNTAFLYYISDIWKFSLYWTLIFNGAFYIVT 60

Query: 61  GLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCCA 120
           GL+AS +HRK+AG LWI ++Y  YGGVQG+  GT+ GFLIG IY SGLFSMSTWIP CCA
Sbjct: 61  GLYASLTHRKKAGSLWIFSMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCCA 120

Query: 121 VAQVLYDFTASFSSSASIL 139
           V Q+L+D    +S   S++
Sbjct: 121 VVQILFDVVLGYSMVGSVM 139

>YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {ON}
           Putative protein of unknown function
          Length = 140

 Score =  180 bits (456), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 82/140 (58%), Positives = 104/140 (74%), Gaps = 1/140 (0%)

Query: 1   MRSFITTNDVPVGYETPSFPSLYWP-TESRTSLHVIYDVSAIWKFTLYWSLIFNFGFYAL 59
           MRSF+T ND+PVGY TP FPSLYWP   S+ +   +Y +S IWKF+LYW+LIFN  FY  
Sbjct: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVT 60

Query: 60  TGLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCC 119
            G++AS +HRK+AG +WI  +Y  YGGVQG+  GT+ GFLIG IY SGLFSMSTW+P CC
Sbjct: 61  AGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCC 120

Query: 120 AVAQVLYDFTASFSSSASIL 139
           AV Q+L+D   S+S   S++
Sbjct: 121 AVVQILFDVVLSYSMVGSVM 140

>Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score =  179 bits (453), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 102/139 (73%), Gaps = 1/139 (0%)

Query: 2   RSFITTNDVPVGYETPSFPSLYWP-TESRTSLHVIYDVSAIWKFTLYWSLIFNFGFYALT 60
           RSFIT ND+PVGY TP FPSLYWP   SR +   +Y +S IWKF+LYW+LIFN  FY   
Sbjct: 1   RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA 60

Query: 61  GLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCCA 120
           GL+AS +HRK+AG +WI  +Y  +GGVQG+  GTI GFLIG IY SGLFSMSTWIP CCA
Sbjct: 61  GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA 120

Query: 121 VAQVLYDFTASFSSSASIL 139
           V Q+L+D    +S   SI+
Sbjct: 121 VVQILFDVVLGYSMIGSIM 139

>CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {ON}
           highly similar to uniprot|Q06537 Saccharomyces
           cerevisiae YPR153w
          Length = 140

 Score =  175 bits (443), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 102/140 (72%), Gaps = 1/140 (0%)

Query: 1   MRSFITTNDVPVGYETPSFPSLYWP-TESRTSLHVIYDVSAIWKFTLYWSLIFNFGFYAL 59
           M+SFIT+ DVP+GY+TPSFPSLYWP  + R     +Y +  IWKFTLYW+ IFN  FY  
Sbjct: 1   MKSFITSTDVPIGYKTPSFPSLYWPINDRRYDTAFLYFIEDIWKFTLYWTFIFNGAFYGG 60

Query: 60  TGLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCC 119
            GL+AS +H K+ GGLWI  +Y  Y GVQG+ +GT+ GFLIG IY SGLFSMSTW+P CC
Sbjct: 61  AGLYASLTHWKRGGGLWIFGIYMLYAGVQGMIIGTVMGFLIGAIYRSGLFSMSTWVPMCC 120

Query: 120 AVAQVLYDFTASFSSSASIL 139
           AV Q+L D T S+S   SI+
Sbjct: 121 AVVQILLDVTMSYSMVGSIM 140

>Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 141
           aa] {ON} complement(19229..19649,19756..19760) [426 nt,
           142 aa]
          Length = 141

 Score =  169 bits (429), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 104/142 (73%), Gaps = 4/142 (2%)

Query: 1   MRS-FITTNDVPVGYETPSFPSLYWPTESRTSLHV--IYDVSAIWKFTLYWSLIFNFGFY 57
           MRS F+T+ D+PVGY  P FPSLYWP  S+   HV  +YD   IW+FT+YWS+I N GFY
Sbjct: 1   MRSSFLTSEDIPVGYHKPPFPSLYWPISSK-KYHVSYLYDTKTIWEFTVYWSVILNGGFY 59

Query: 58  ALTGLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPF 117
            ++GL AS++HRK+AGGLWIM +Y   G  QGV  GT+TG+L+  IY SGLF+MSTWIP 
Sbjct: 60  LISGLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPL 119

Query: 118 CCAVAQVLYDFTASFSSSASIL 139
           CCA+ QVL+D  +SFS    ++
Sbjct: 120 CCAITQVLFDLCSSFSLGGMVM 141

>KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 147
           aa] {ON} Anc_3.500 YPR153W
          Length = 147

 Score =  162 bits (411), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 74/140 (52%), Positives = 98/140 (70%), Gaps = 1/140 (0%)

Query: 1   MRSFITTNDVPVGYETPSFPSLYWPTESRT-SLHVIYDVSAIWKFTLYWSLIFNFGFYAL 59
           +R+F+  N++PVGY TPSFPSLYWP  + + SL  +Y++  IWKFT+YW LI N  FY  
Sbjct: 8   LRTFVANNEIPVGYHTPSFPSLYWPISNESYSLAFLYNIEDIWKFTMYWCLILNGAFYGT 67

Query: 60  TGLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCC 119
           +GL A+ SH K    + I+ LY  Y G+QGV +G I G L+G IY +GLF+MSTWIP CC
Sbjct: 68  SGLVATISHWKNPHAILIVGLYLLYAGIQGVVIGIIAGLLLGAIYRAGLFTMSTWIPLCC 127

Query: 120 AVAQVLYDFTASFSSSASIL 139
           AVAQ+L+D   S+S   S+L
Sbjct: 128 AVAQILFDVVMSYSHVGSLL 147

>TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3.500
           YPR153W
          Length = 141

 Score =  161 bits (408), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 77/138 (55%), Positives = 100/138 (72%), Gaps = 1/138 (0%)

Query: 3   SFITTNDVPVGYETPSFPSLYWP-TESRTSLHVIYDVSAIWKFTLYWSLIFNFGFYALTG 61
           +F+T+ND+PVGY TPSFPSLYWP   S+ +   +YD   IW FT+YWSLI N  FY + G
Sbjct: 4   NFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAG 63

Query: 62  LWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCCAV 121
             A F+HRK+ GG WI+A+Y   GGVQG+ +GTI G++I   Y S LFSMSTWIP CCAV
Sbjct: 64  ALACFTHRKKGGGFWILAIYLVLGGVQGIVLGTIIGYIISATYLSALFSMSTWIPLCCAV 123

Query: 122 AQVLYDFTASFSSSASIL 139
           AQVL++ T S+S   +++
Sbjct: 124 AQVLFEVTTSYSLVGNLM 141

>SAKL0F02508g Chr6
           complement(217712..217835,217912..218205,218273..218277)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  158 bits (400), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 75/140 (53%), Positives = 99/140 (70%), Gaps = 1/140 (0%)

Query: 1   MRSFITTNDVPVGYETPSFPSLYWP-TESRTSLHVIYDVSAIWKFTLYWSLIFNFGFYAL 59
           M+SF+TT DVP+GY TPSFPSLYWP    + SL  +Y  S IW+FT+YW+LI   GFY  
Sbjct: 1   MKSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGS 60

Query: 60  TGLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCC 119
            GL AS+SHRK AGG+WIM  Y   GG+Q +A GT+ G LI  IY +GLF+MSTW+P  C
Sbjct: 61  AGLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSC 120

Query: 120 AVAQVLYDFTASFSSSASIL 139
           A+ Q+L++ + S+  +  I+
Sbjct: 121 ALMQILFNVSTSYLMAGVII 140

>TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score =  157 bits (397), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 95/136 (69%), Gaps = 1/136 (0%)

Query: 1   MRSFITTNDVPVGYETPSFPSLYWPTESRT-SLHVIYDVSAIWKFTLYWSLIFNFGFYAL 59
           M+SFIT ND+PVGY TP FPSLYWP  ++  +   +YD + IWKF++YW +I N  FY +
Sbjct: 1   MKSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGV 60

Query: 60  TGLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCC 119
           TG  A  SHR + G +WI+ +Y   G VQG+  GTI G++I  IY+SGLF MSTWIPFCC
Sbjct: 61  TGTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCC 120

Query: 120 AVAQVLYDFTASFSSS 135
           AV Q+L+D   SF  S
Sbjct: 121 AVVQILFDVVQSFPIS 136

>KLTH0G02354g Chr7
           complement(185220..185343,185400..185693,185765..185769)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  156 bits (394), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 95/140 (67%), Gaps = 1/140 (0%)

Query: 1   MRSFITTNDVPVGYETPSFPSLYWP-TESRTSLHVIYDVSAIWKFTLYWSLIFNFGFYAL 59
           M+SF+T  DVP+GY TP FPSL+WP    R +L  +Y  + IWKFT++W+LI   GFY  
Sbjct: 1   MKSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTA 60

Query: 60  TGLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCC 119
            GLWAS SHRK+A GLWIMA Y   GG Q +A GT+TG ++   Y +GLF MSTWIP C 
Sbjct: 61  AGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCS 120

Query: 120 AVAQVLYDFTASFSSSASIL 139
           AV  +L+  + ++S +  I+
Sbjct: 121 AVVLILFHVSTTYSMAGIII 140

>KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa]
           {ON} Anc_3.500 YPR153W Intron coordinates are guessed,
           not conserved begining when aligned with the rest of the
           pillar proteins.
          Length = 144

 Score =  145 bits (365), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 72/134 (53%), Positives = 87/134 (64%), Gaps = 2/134 (1%)

Query: 8   NDVPVGYETPSFPSLYWPTESRTSLH--VIYDVSAIWKFTLYWSLIFNFGFYALTGLWAS 65
             VP+GY TP FPSLYWP     S     +Y V  IWKFTLYWSLIFN  FY   G  A 
Sbjct: 11  QSVPIGYITPKFPSLYWPIGFDESFDNAFLYSVVDIWKFTLYWSLIFNGAFYVSAGAVAC 70

Query: 66  FSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCCAVAQVL 125
            + +K++  L I A Y  +GG+QGV VGT+ GFL+G IY +GLF MS WIP CCAVAQ+L
Sbjct: 71  LTTKKKSRSLLIFATYTVFGGLQGVIVGTVMGFLVGTIYRAGLFGMSCWIPMCCAVAQIL 130

Query: 126 YDFTASFSSSASIL 139
           YD   S+S+   I+
Sbjct: 131 YDVLVSYSTVGRIM 144

>KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423
           bp, 140 aa] {ON} similar to uniprot|Q06HN0 Saccharomyces
           cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  130 bits (327), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 90/140 (64%), Gaps = 1/140 (0%)

Query: 1   MRSFITTNDVPVGYETPSFPSLYWPTES-RTSLHVIYDVSAIWKFTLYWSLIFNFGFYAL 59
           M++F  T DVPVGY+ P FPSLYWP  + + S+  +Y +  IW+FT++W++I     Y  
Sbjct: 1   MKTFFITGDVPVGYQVPDFPSLYWPMNNGKFSVAYLYYLPDIWRFTIFWTMILFAIVYGT 60

Query: 60  TGLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCC 119
           TG  A  +H+K   G W++ LY   G  Q    GT+ G LI  IY +GLF+MSTWIP CC
Sbjct: 61  TGAIAWTTHKKILFGFWMIPLYIMIGMAQAFVSGTVVGILIAIIYKAGLFAMSTWIPLCC 120

Query: 120 AVAQVLYDFTASFSSSASIL 139
           AV Q+L++ + S+S ++ I+
Sbjct: 121 AVVQILFNVSTSYSMTSPII 140

>AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YPR153W; 1-intron
          Length = 141

 Score =  108 bits (270), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 51/132 (38%), Positives = 77/132 (58%)

Query: 8   NDVPVGYETPSFPSLYWPTESRTSLHVIYDVSAIWKFTLYWSLIFNFGFYALTGLWASFS 67
            + P GY +PSFPSL W  + R +  ++Y    I +FT++W+LI   G Y   GL A +S
Sbjct: 10  GNPPAGYISPSFPSLLWTADDRANGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGYS 69

Query: 68  HRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCCAVAQVLYD 127
           HR+  GG+ I+A+Y   G +  +  GT +G +   IY + L +MSTWIP   AV Q LY 
Sbjct: 70  HRRITGGVGILAIYLLLGALHAILGGTFSGLITAAIYRAALIAMSTWIPLASAVVQALYL 129

Query: 128 FTASFSSSASIL 139
             A+F + + ++
Sbjct: 130 LCAAFVAQSKLI 141

>Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON}
          YPR153W - Hypothetical ORF [contig 189] FULL
          Length = 113

 Score = 65.5 bits (158), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 30/45 (66%), Positives = 33/45 (73%)

Query: 55 GFYALTGLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFL 99
          GFYA  GLWAS SHR+ AGGLWIMA Y   GG Q VA GT+TG +
Sbjct: 2  GFYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.138    0.461 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,508,336
Number of extensions: 548295
Number of successful extensions: 1677
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1662
Number of HSP's successfully gapped: 26
Length of query: 139
Length of database: 53,481,399
Length adjustment: 98
Effective length of query: 41
Effective length of database: 42,244,131
Effective search space: 1732009371
Effective search space used: 1732009371
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 60 (27.7 bits)