Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D09702g3.501ON1581586273e-84
TDEL0D056903.501ON2011574221e-52
NCAS0F036003.501ON2371763922e-47
Skud_16.4483.501ON2081553771e-45
TBLA0C045303.501ON2221653745e-45
Smik_16.4063.501ON2121563701e-44
YPR154W (PIN3)3.501ON2151593571e-42
KNAG0A079903.501ON2211613536e-42
NDAI0B059203.501ON2351793521e-41
KAFR0G037403.501ON2341563503e-41
Kwal_47.189053.501ON2361813401e-39
CAGL0F04829g3.501ON2021583371e-39
Suva_16.4823.501ON2351613382e-39
Kpol_480.83.501ON239592861e-31
TPHA0A057203.501ON220592772e-30
KLTH0G02332g3.501ON233602772e-30
SAKL0F02486g3.501ON230642624e-28
AFR320W3.501ON257792628e-28
Suva_7.4243.501ON249812487e-26
KLLA0E03873g3.501ON220692405e-25
YGR136W (LSB1)3.501ON241812331e-23
Smik_6.2323.501ON241812321e-23
Ecym_12283.501ON253762243e-22
ZYRO0G20372gsingletonON150562079e-21
Skud_7.4473.501ON238972102e-20
KNAG0B007503.501ON2171582058e-20
TBLA0D029103.501ON269551851e-16
NCAS0A089901.356ON434511397e-10
TPHA0C040202.502ON485521335e-09
TBLA0D049501.356ON468511325e-09
Suva_15.1991.356ON457511282e-08
Smik_8.811.356ON468511282e-08
NCAS0A119205.470ON463571273e-08
Skud_8.681.356ON475511254e-08
YHR016C (YSC84)1.356ON468511255e-08
KNAG0C020401.356ON464511246e-08
Ecym_27471.356ON452511246e-08
CAGL0K02761g2.502ON450561238e-08
TBLA0B054702.502ON539521238e-08
KLTH0D06138g2.502ON489521221e-07
NCAS0B072501.356ON441511221e-07
Smik_7.3351.356ON460511221e-07
TPHA0O012801.356ON454511221e-07
KAFR0D033602.502ON455581221e-07
YFR024C-A (LSB3)1.356ON459511211e-07
TBLA0A025705.470ON493551212e-07
SAKL0G03454g5.470ON468571212e-07
TPHA0A022101.356ON397511202e-07
TDEL0D022401.356ON433511202e-07
KAFR0C044001.356ON459511202e-07
Kwal_0.3711.356ON217511182e-07
SAKL0D09702g1.356ON428511183e-07
NDAI0A043505.470ON459571183e-07
TBLA0F034901.356ON511511184e-07
KLTH0H12980g1.356ON399511174e-07
AEL017W1.356ON416501175e-07
CAGL0I08965g1.356ON437511175e-07
Ecym_24402.502ON459531175e-07
KNAG0C046305.470ON516571175e-07
KAFR0E036405.470ON441571166e-07
SAKL0E02200g2.502ON511521167e-07
Skud_6.1081.356ON459511158e-07
TDEL0A027802.502ON451521159e-07
KLLA0A08360g1.356ON423511159e-07
NDAI0B045801.356ON424511151e-06
Suva_6.961.356ON455511151e-06
KLLA0B13475g2.502ON508521151e-06
NDAI0G059601.356ON423561132e-06
Suva_8.512.502ON456521132e-06
KLTH0F15114g5.470ON435551132e-06
Kwal_55.212875.470ON461561122e-06
ZYRO0B01298g2.502ON411531122e-06
Skud_4.6615.470ON460551122e-06
Kpol_1056.372.502ON501521113e-06
ZYRO0G00792g1.356ON469511113e-06
CAGL0M01650g5.470ON466551113e-06
YDR388W (RVS167)5.470ON482551104e-06
TDEL0A033405.470ON473531105e-06
Smik_4.6585.470ON472551095e-06
ABR008C2.502ON443501096e-06
KAFR0A009701.356ON396511087e-06
Kpol_440.105.470ON470561088e-06
Kpol_1008.251.356ON449511088e-06
NCAS0A050802.502ON450521088e-06
ZYRO0D11110g5.470ON459551089e-06
Smik_8.472.502ON447521071e-05
YHL002W (HSE1)2.502ON452521071e-05
AFR140C5.470ON388491061e-05
Kwal_26.79022.502ON532521052e-05
SAKL0H21912g4.108ON1253751053e-05
YHR114W (BZZ1)2.159ON633521043e-05
TPHA0E015005.470ON457571034e-05
Skud_8.432.502ON454521034e-05
KNAG0A067102.502ON41954991e-04
Kwal_47.178942.159ON62152991e-04
ACR266W2.159ON62650991e-04
CAGL0A02145g1.356ON39152982e-04
NDAI0K021302.502ON45953982e-04
Ecym_23165.470ON42154963e-04
YLR191W (PEX13)7.365ON38660963e-04
Smik_12.2517.365ON38860954e-04
KLTH0B04818g7.365ON38060954e-04
KNAG0I015801.356ON58151955e-04
Skud_12.2567.365ON40360945e-04
Skud_8.1752.159ON63352938e-04
KLLA0E03059g5.470ON42856938e-04
Suva_10.2877.365ON39260920.001
KLTH0E09790g2.159ON62252920.001
ZYRO0G10098g4.108ON139262910.002
TPHA0F031007.365ON38160910.002
Kpol_1072.562.159ON63752910.002
Smik_8.1922.159ON63352900.002
NCAS0A034904.108ON123557900.002
Ecym_23082.591ON67856900.002
Smik_13.2982.440ON120880900.002
Kpol_538.255.170ON70756900.002
TPHA0B028902.159ON63452880.003
KLLA0F23848g2.159ON64948880.004
SAKL0E10780g2.159ON62553870.006
Ecym_47107.365ON39960850.008
TDEL0F023804.108ON125560860.008
Suva_15.3102.159ON63476850.009
Kpol_325.126.366ON57056850.010
NDAI0A033304.108ON122657840.012
TDEL0B052202.159ON61352840.013
KNAG0C029104.108ON124454840.014
TDEL0E055204.45ON158962830.018
SAKL0E06820g2.319ON90552830.019
KAFR0L015807.365ON34460820.023
AGR306C5.170ON92389820.024
ABR082W2.591ON68356820.025
SAKL0G17600g4.335ON44160810.025
NCAS0A145707.419ON35553800.040
Suva_2.564singletonON4339730.041
NCAS0B060202.319ON86455800.047
CAGL0E02783g4.108ON120362800.049
ZYRO0B16214g2.159ON65948790.053
TBLA0B096202.319ON94157790.054
NDAI0I002206.366ON61550790.057
TBLA0C041004.108ON130261790.059
ZYRO0D17358g6.366ON66850790.060
Ecym_72314.108ON114661790.067
KLTH0E07744g4.108ON124960780.073
Smik_2.1134.108ON123057780.074
SAKL0A00594g6.366ON63653780.077
ADL288C2.319ON92553780.078
Ecym_25266.366ON52451780.078
Suva_2.1184.108ON116659780.081
TBLA0C055602.159ON67351770.11
KLLA0F14575g5.170ON85173770.12
AGR170C4.108ON112155770.12
Kpol_1025.404.108ON1202119770.12
KNAG0I027006.366ON57550760.12
Skud_3.1606.366ON58650760.13
CAGL0E03476g4.45ON156449760.13
CAGL0C03597g6.366ON58053760.14
Kwal_47.174814.108ON124990760.14
NCAS0B069802.159ON63969760.14
KAFR0I010404.108ON120360760.16
KNAG0B022307.413ON90454750.17
TPHA0K016004.108ON113660750.18
Ecym_54262.159ON67250750.19
KAFR0J026506.366ON55350750.20
TBLA0F002806.366ON57657750.20
Smik_13.2022.591ON66362750.21
KLLA0E23365g8.539ON57551740.22
YCR088W (ABP1)6.366ON59250740.22
Ecym_11678.539ON55054740.23
TBLA0A006108.539ON59750740.24
TPHA0F003804.45ON161842740.24
SAKL0H10098g8.539ON55572740.24
Kpol_534.62.319ON88653740.25
ZYRO0A02662g2.319ON88653730.32
TDEL0A078106.366ON55850730.33
Skud_2.1044.108ON121452730.34
NDAI0B033302.319ON91953730.36
KLLA0E06953g7.419ON35752720.37
Suva_13.2012.591ON66862730.38
ZYRO0B04004g7.419ON37152720.43
YBL007C (SLA1)4.108ON124452720.44
KAFR0L018807.413ON93065720.45
Smik_4.1192.319ON88753720.49
NDAI0A014707.419ON36753710.51
SAKL0H15048g8.344ON20750700.53
KAFR0K020007.419ON33247710.55
Ecym_33662.319ON90653710.63
Suva_4.1292.319ON88753710.64
TDEL0G024902.319ON85053710.64
KNAG0C033907.419ON34252700.67
YMR032W (HOF1)2.591ON66962710.68
Skud_4.1372.319ON88753710.70
Smik_5.2637.419ON36852700.71
Smik_3.1866.366ON59150700.72
KLLA0E09043g2.319ON81452700.74
NDAI0A015007.413ON104748700.75
TPHA0K006807.419ON35547700.78
AGL286C7.419ON33076700.82
TPHA0G009302.319ON82492700.86
Kwal_27.107077.419ON34354690.87
KLLA0A04983g4.108ON125183700.88
TPHA0H023806.366ON52850700.91
KLTH0D08580g2.591ON60061690.99
Suva_3.1246.366ON60050690.99
AGL293C7.413ON98454691.1
KLLA0D16874g8.344ON22768681.2
TDEL0C027307.413ON101650691.2
KLTH0C06028g7.419ON34247681.2
KLTH0A07348g6.366ON62651681.3
Kwal_23.64376.366ON63159681.3
TDEL0C028107.419ON33747681.4
NCAS0D047406.366ON59450681.4
Ecym_71347.419ON33247681.4
Suva_2.337.413ON98255681.4
YDL117W (CYK3)2.319ON88553672.1
TBLA0E015604.45ON139472672.1
CAGL0C01881g7.413ON99948662.6
Skud_13.1882.591ON66962662.7
KAFR0F007502.159ON60252662.7
NCAS0A059704.45ON132359662.8
Kpol_457.12singletonON56750662.9
Smik_2.357.413ON98555662.9
Suva_5.2397.419ON36854653.0
NDAI0J008508.344ON24563653.0
AGL237C6.366ON57851653.2
KAFR0B058608.344ON24962643.5
TPHA0K007207.413ON101155653.6
Ecym_42288.344ON26152643.7
TBLA0H011608.344ON22450634.4
TBLA0I010507.419ON37147644.6
NDAI0B043202.159ON63257645.1
Kpol_1024.458.539ON55458645.3
CAGL0E01045g8.344ON21350626.1
KLLA0D09306g4.45ON153758636.3
ZYRO0F13882g8.344ON28873636.4
Kpol_2000.28.344ON22550626.4
Suva_2.3268.344ON24050626.9
NCAS0D019505.170ON93951636.9
Ecym_71417.413ON102954628.1
Skud_4.4208.344ON23350618.6
YBL085W (BOI1)7.413ON98055628.7
NCAS0B022208.539ON55458628.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D09702g
         (158 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {O...   246   3e-84
TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3....   167   1e-52
NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.50...   155   2e-47
Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W...   149   1e-45
TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3....   148   5e-45
Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W...   147   1e-44
YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protei...   142   1e-42
KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3....   140   6e-42
NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3....   140   1e-41
KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.50...   139   3e-41
Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR15...   135   1e-39
CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar...   134   1e-39
Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W...   134   2e-39
Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON} c...   114   1e-31
TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3....   111   2e-30
KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {O...   111   2e-30
SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {O...   105   4e-28
AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic h...   105   8e-28
Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W (...   100   7e-26
KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {O...    97   5e-25
YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein...    94   1e-23
Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W (...    94   1e-23
Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON} ...    91   3e-22
ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakl...    84   9e-21
Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W (...    86   2e-20
KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON...    84   8e-20
TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON...    76   1e-16
NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201) [...    58   7e-10
TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {O...    56   5e-09
TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa] ...    55   5e-09
Suva_15.199 Chr15 complement(345409..346735,346904..346950) [137...    54   2e-08
Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 b...    54   2e-08
NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON} Anc_5...    54   3e-08
Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 b...    53   4e-08
YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,...    53   5e-08
KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {O...    52   6e-08
Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [13...    52   6e-08
CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} simil...    52   8e-08
TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa] ...    52   8e-08
KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} simila...    52   1e-07
NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072) [...    52   1e-07
Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 ...    52   1e-07
TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {...    52   1e-07
KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {O...    52   1e-07
YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 b...    51   1e-07
TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {O...    51   2e-07
SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some s...    51   2e-07
TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.3...    51   2e-07
TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 a...    51   2e-07
KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 a...    51   2e-07
Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON} Y...    50   2e-07
SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [128...    50   3e-07
NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {O...    50   3e-07
TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 a...    50   4e-07
KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406) ...    50   4e-07
AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {...    50   5e-07
CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {...    50   5e-07
Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar t...    50   5e-07
KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.4...    50   5e-07
KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {O...    49   6e-07
SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {...    49   7e-07
Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 ...    49   8e-07
TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.5...    49   9e-07
KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [127...    49   9e-07
NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa] ...    49   1e-06
Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 b...    49   1e-06
KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]...    49   1e-06
NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON} Anc_1...    48   2e-06
Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W (R...    48   2e-06
KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]...    48   2e-06
Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {...    48   2e-06
ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} simila...    48   2e-06
Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388...    48   2e-06
Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON} (92852....    47   3e-06
ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa] ...    47   3e-06
CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa] ...    47   3e-06
YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}  RVS167Ac...    47   4e-06
TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.4...    47   5e-06
Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388...    47   5e-06
ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON} S...    47   6e-06
KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.3...    46   7e-06
Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON} (25697..2...    46   8e-06
Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 b...    46   8e-06
NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON} Anc_2...    46   8e-06
ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} simila...    46   9e-06
Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)    46   1e-05
YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subuni...    46   1e-05
AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON} S...    45   1e-05
Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W...    45   2e-05
SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa...    45   3e-05
YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3 do...    45   3e-05
TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {O...    44   4e-05
Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)    44   4e-05
KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa] ...    43   1e-04
Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114...    43   1e-04
ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic ho...    43   1e-04
CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 ...    42   2e-04
NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2....    42   2e-04
Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}...    42   3e-04
YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}  PEX13Inte...    42   3e-04
Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191...    41   4e-04
KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {...    41   4e-04
KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 a...    41   5e-04
Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191...    41   5e-04
Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W ...    40   8e-04
KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} simila...    40   8e-04
Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191...    40   0.001
KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} simila...    40   0.001
ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa] ...    40   0.002
TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {O...    40   0.002
Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa] ...    40   0.002
Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W ...    39   0.002
NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {...    39   0.002
Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}...    39   0.002
Smik_13.298 Chr13 (470071..473697) [3627 bp, 1208 aa] {ON} YMR10...    39   0.002
Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON} (50807..5...    39   0.002
TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {O...    39   0.003
KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} simi...    39   0.004
SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} simila...    38   0.006
Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar...    37   0.008
TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4....    38   0.008
Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114...    37   0.009
Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON} (19571..2...    37   0.010
NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {...    37   0.012
TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {O...    37   0.013
KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {...    37   0.014
TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON} Anc_...    37   0.018
SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {...    37   0.019
KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {...    36   0.023
AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}...    36   0.024
ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic ho...    36   0.025
SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]...    36   0.025
NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa] ...    35   0.040
Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W ...    33   0.041
NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON} Anc_2...    35   0.047
CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} simil...    35   0.049
ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} simi...    35   0.053
TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa] ...    35   0.054
NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366...    35   0.057
TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4....    35   0.059
ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} simi...    35   0.060
Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON...    35   0.067
KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa] ...    35   0.073
Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 ...    35   0.074
SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON...    35   0.077
ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON} S...    35   0.078
Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar...    35   0.078
Suva_2.118 Chr2 complement(206707..206754,206785..206832,206899....    35   0.081
TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa] ...    34   0.11 
KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]...    34   0.12 
AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON...    34   0.12 
Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON} (104...    34   0.12 
KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {O...    34   0.12 
Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W ...    34   0.13 
CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa] ...    34   0.13 
CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {...    34   0.14 
Kwal_47.17481 s47 complement(421795..425544) [3750 bp, 1249 aa] ...    34   0.14 
NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON} Anc_2...    34   0.14 
KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4....    34   0.16 
KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.4...    33   0.17 
TPHA0K01600 Chr11 (338182..341592) [3411 bp, 1136 aa] {ON} Anc_4...    33   0.18 
Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar t...    33   0.19 
KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {...    33   0.20 
TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}...    33   0.20 
Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032...    33   0.21 
KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987) ...    33   0.22 
YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}  ABP1Actin-...    33   0.22 
Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]...    33   0.23 
TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {O...    33   0.24 
TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45...    33   0.24 
SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 ...    33   0.24 
Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON} (20451..23...    33   0.25 
ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} simila...    33   0.32 
TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON} Anc_6...    33   0.33 
Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {O...    33   0.34 
NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON} Anc_2.3...    33   0.36 
KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON} unipro...    32   0.37 
Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032...    33   0.38 
ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {...    32   0.43 
YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON} ...    32   0.44 
KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {...    32   0.45 
Smik_4.119 Chr4 (225256..227919) [2664 bp, 887 aa] {ON} YDL117W ...    32   0.49 
NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.4...    32   0.51 
SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some ...    32   0.53 
KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {O...    32   0.55 
Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}...    32   0.63 
Suva_4.129 Chr4 (237039..239702) [2664 bp, 887 aa] {ON} YDL117W ...    32   0.64 
TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.3...    32   0.64 
KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.4...    32   0.67 
YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud n...    32   0.68 
Skud_4.137 Chr4 (244217..246880) [2664 bp, 887 aa] {ON} YDL117W ...    32   0.70 
Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON...    32   0.71 
Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W ...    32   0.72 
KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {...    32   0.74 
NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7....    32   0.75 
TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7....    32   0.78 
AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON} Sy...    32   0.82 
TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.3...    32   0.86 
Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118...    31   0.87 
KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa] ...    32   0.88 
TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.3...    32   0.91 
KLTH0D08580g Chr4 (719409..721211) [1803 bp, 600 aa] {ON} simila...    31   0.99 
Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W ...    31   0.99 
AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON} S...    31   1.1  
KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa] ...    31   1.2  
TDEL0C02730 Chr3 complement(479746..482796) [3051 bp, 1016 aa] {...    31   1.2  
KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} simila...    31   1.2  
KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} simila...    31   1.3  
Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR08...    31   1.3  
TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {O...    31   1.4  
NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {O...    31   1.4  
Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to...    31   1.4  
Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)    31   1.4  
YDL117W Chr4 (248581..251238) [2658 bp, 885 aa] {ON}  CYK3SH3-do...    30   2.1  
TBLA0E01560 Chr5 (365693..369877) [4185 bp, 1394 aa] {ON} Anc_4....    30   2.1  
CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} simila...    30   2.6  
Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032...    30   2.7  
KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {O...    30   2.7  
NCAS0A05970 Chr1 complement(1177678..1181649) [3972 bp, 1323 aa]...    30   2.8  
Kpol_457.12 s457 complement(23020..24723) [1704 bp, 567 aa] {ON}...    30   2.9  
Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W (REAL)    30   2.9  
Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON...    30   3.0  
NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.3...    30   3.0  
AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON} S...    30   3.2  
KAFR0B05860 Chr2 complement(1210822..1211571) [750 bp, 249 aa] {...    29   3.5  
TPHA0K00720 Chr11 (147285..150320) [3036 bp, 1011 aa] {ON} Anc_7...    30   3.6  
Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to...    29   3.7  
TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.34...    29   4.4  
TBLA0I01050 Chr9 (210595..211710) [1116 bp, 371 aa] {ON} Anc_7.4...    29   4.6  
NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON} Anc_2...    29   5.1  
Kpol_1024.45 s1024 (120171..121835) [1665 bp, 554 aa] {ON} (1201...    29   5.3  
CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar t...    28   6.1  
KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} simil...    29   6.3  
ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa] ...    29   6.4  
Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON} c...    28   6.4  
Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}...    28   6.9  
NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170     29   6.9  
Ecym_7141 Chr7 (283803..286892) [3090 bp, 1029 aa] {ON} similar ...    28   8.1  
Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}...    28   8.6  
YBL085W Chr2 (63876..66818) [2943 bp, 980 aa] {ON}  BOI1Protein ...    28   8.7  
NCAS0B02220 Chr2 (363992..365656) [1665 bp, 554 aa] {ON} Anc_8.539     28   8.8  

>ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {ON}
           weakly similar to uniprot|Q06449 Saccharomyces
           cerevisiae YPR154W PIN3 Protein that induces appearance
           of [PIN ] prion when overproduced
          Length = 158

 Score =  246 bits (627), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 125/158 (79%)

Query: 1   MGGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFS 60
           MGGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFS
Sbjct: 1   MGGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFS 60

Query: 61  GGFDRPAAPPPPQYDQKAMASQPSGGNAMWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 120
           GGFDRPAAPPPPQYDQKAMASQPSGGNAMW                              
Sbjct: 61  GGFDRPAAPPPPQYDQKAMASQPSGGNAMWQQPSPYPPPSTNYYQPPPPQQQQPQPMVVQ 120

Query: 121 XXXGKRHHGLGKFGSKLGNAAIFGAGATLGSDLINSIF 158
              GKRHHGLGKFGSKLGNAAIFGAGATLGSDLINSIF
Sbjct: 121 QEQGKRHHGLGKFGSKLGNAAIFGAGATLGSDLINSIF 158

>TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3.501
           YPR154W
          Length = 201

 Score =  167 bits (422), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 86/157 (54%), Positives = 101/157 (64%), Gaps = 1/157 (0%)

Query: 2   GGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSG 61
           GGE++EA+Y+FDPQQ+GDLAL PGDKIEVLEKPS EWF+GRCNGRVGMFP+NYVK A+SG
Sbjct: 46  GGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSG 105

Query: 62  GFDRPAAPPPPQYDQKAMASQPSGGNAMWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 121
             DRP+ PPPPQY+Q    +      +                                 
Sbjct: 106 S-DRPSVPPPPQYEQAQRTNTGQSSGSYQQPFPPPSTNYYQQPPQQYQQPQQQQPQQEQQ 164

Query: 122 XXGKRHHGLGKFGSKLGNAAIFGAGATLGSDLINSIF 158
                H+ L KFGSKLGNAAIFGAGAT+GSDL+NSIF
Sbjct: 165 QQHHSHNHLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201

>NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.501
           YGR136W
          Length = 237

 Score =  155 bits (392), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 89/176 (50%), Positives = 103/176 (58%), Gaps = 19/176 (10%)

Query: 1   MGGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAF- 59
            G EFVEAIY F+PQQ+GDLAL PGDKIEV+EKPSPEWF+GRCNG+ GMFPSNYVKPAF 
Sbjct: 63  QGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPAFS 122

Query: 60  --SGGFDRPAAPP-PPQYDQKAMASQ--------------PSGGNAMWXXXXXXXXXXXX 102
             SG  ++ A P  PPQY Q ++ +Q              P+  N               
Sbjct: 123 GSSGSVNKVARPNGPPQY-QNSLQTQNSHTPSFQQPAPFPPALTNYYQQQQPQFIQTPQQ 181

Query: 103 XXXXXXXXXXXXXXXXXXXXXGKRHHGLGKFGSKLGNAAIFGAGATLGSDLINSIF 158
                                   HHGL KFGSKLGNAAIFGAGAT+GSD++NSIF
Sbjct: 182 QQPQQVQQQPVQQQQPQQQEQHHSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSIF 237

>Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W
           (REAL)
          Length = 208

 Score =  149 bits (377), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 96/155 (61%), Gaps = 3/155 (1%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSGGF 63
           E+VEA+Y+FDPQQ+GDL L PGDK+++LEK SPEW++G CNGRVG+FP+NYVKPAFSG  
Sbjct: 57  EYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFSGSN 116

Query: 64  DRPAAPPPPQYDQKAMASQPSGGNAMWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 123
                PPPPQY  + +   P+  +A+                                  
Sbjct: 117 GSSNLPPPPQYKAQELQQAPTQNSAV---SSYQQQPFPPPSTNYYQQPQQQPQQAPPQQQ 173

Query: 124 GKRHHGLGKFGSKLGNAAIFGAGATLGSDLINSIF 158
              H+ L  FGSKLGNAAIFGAGA++GSD++NSIF
Sbjct: 174 PSSHNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 208

>TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3.501
           YPR154W
          Length = 222

 Score =  148 bits (374), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 98/165 (59%), Gaps = 10/165 (6%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSGGF 63
           E+VEAIY+FDPQQ+GDL L PGDKI V EKPSPEWF+G+CNG+VG+FPSNYV+PAFSG  
Sbjct: 58  EWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSN 117

Query: 64  DRP----AAPPPPQYDQKAMASQPSGGNAMWXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 119
           +      AAPP  Q D   ++   S  ++M                              
Sbjct: 118 NEKSRSDAAPPQYQQDDHHISKHSSHQSSMMPPQPYPQQQQVYQAPPPQQQQAYQAPPQQ 177

Query: 120 XXXX---GKRHH---GLGKFGSKLGNAAIFGAGATLGSDLINSIF 158
                   K+HH    L  FGSKLGNAAIFGAGATLGSDL+NSIF
Sbjct: 178 VVVEQAPAKQHHEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222

>Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W
           (REAL)
          Length = 212

 Score =  147 bits (370), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 96/156 (61%), Gaps = 1/156 (0%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSGGF 63
           E+VEA+Y+FDPQQ+GDL L PGDKI++LEK SPEW++G CNGR G+FP+NYVKPAFSG  
Sbjct: 57  EYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSN 116

Query: 64  DRPAAPPPPQYDQKAMASQPSGGNAMWXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXX 122
            +   PPPPQY  + +   P+  +A+                                  
Sbjct: 117 GQSNLPPPPQYKAQELQPVPTQNSAVSSYQQQPFPPPSTNYYQQPQQAPAPAPQQQQQQQ 176

Query: 123 XGKRHHGLGKFGSKLGNAAIFGAGATLGSDLINSIF 158
               H+ L  FGSKLGNAAIFGAGA++GSD++NSIF
Sbjct: 177 QPNSHNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 212

>YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protein
           that induces appearance of [PIN+] prion when
           overproduced
          Length = 215

 Score =  142 bits (357), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 73/159 (45%), Positives = 93/159 (58%), Gaps = 4/159 (2%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSGGF 63
           E+VEA+Y+FDPQQ+GDL L PGDK+++LEK SPEW++G CNGR G+FP+NYVKPAFSG  
Sbjct: 57  EYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSN 116

Query: 64  DRPAAPPPPQYDQKAMASQPSGGNAMWXXXXX----XXXXXXXXXXXXXXXXXXXXXXXX 119
                PPPPQY  + +   P+  +A                                   
Sbjct: 117 GPSNLPPPPQYKAQELQQIPTQNSAASSYQQQPFPPPSTNYYQQPQQQPQQAPPPQQQQQ 176

Query: 120 XXXXGKRHHGLGKFGSKLGNAAIFGAGATLGSDLINSIF 158
                  H  L  FGSKLGNAAIFGAGA++GSD++N+IF
Sbjct: 177 QQQHQSSHSHLKSFGSKLGNAAIFGAGASIGSDIVNNIF 215

>KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3.501
           YPR154W
          Length = 221

 Score =  140 bits (353), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 96/161 (59%), Gaps = 8/161 (4%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSGGF 63
           E+VEA+Y F PQQ+GDL L PGDKI+VLEKPS EW++G+C G+VGMFPSNYVKPAFSG  
Sbjct: 63  EYVEALYAFQPQQDGDLELRPGDKIQVLEKPSAEWYKGKCGGQVGMFPSNYVKPAFSGES 122

Query: 64  DRPAAP--PPPQYDQKAMAS----QPSGGNAMWXXXXXXXXXXXXXXXXXXXXXXXXXXX 117
             P  P  PP Q  Q+ +A+    QP   N  +                           
Sbjct: 123 SAPKRPAGPPYQPQQQHLAAPMYQQPQ--NTGYSQSSNPPFPPQSANYYPPQQQQQPQQV 180

Query: 118 XXXXXXGKRHHGLGKFGSKLGNAAIFGAGATLGSDLINSIF 158
                   +H+   KFGS+LGNAAIFGAGAT+GSD++NSIF
Sbjct: 181 VVEQQQPHKHNAFKKFGSQLGNAAIFGAGATIGSDIVNSIF 221

>NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3.501
          Length = 235

 Score =  140 bits (352), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 103/179 (57%), Gaps = 26/179 (14%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSGGF 63
           E+VEAIY F+PQQEGDLAL  GDKI+V+EKPSPEWF+G+CNG+VG+FPSNYV+PAFSG  
Sbjct: 59  EYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGT- 117

Query: 64  DRPA----APPPPQYDQKAMASQ---------------PSGGNAMWXXXXXXXXXXXXXX 104
            +P+     P PPQY Q ++ +Q               P+  N                 
Sbjct: 118 SQPSKTRLTPGPPQY-QASVETQSIHSSSNVSYQPPFPPASTNYYQQPAQQPQAQYIPPP 176

Query: 105 XXXXXXXXXXXXXXXXXXXGKRHH-----GLGKFGSKLGNAAIFGAGATLGSDLINSIF 158
                               ++HH      L KFGSKLGNAAIFGAGAT+GSD++NSIF
Sbjct: 177 QPVQQVQQQVQQQPQQQQPQQQHHHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235

>KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.501
           YPR154W
          Length = 234

 Score =  139 bits (350), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 92/156 (58%), Gaps = 7/156 (4%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSGGF 63
           E+VEA+Y F+PQQEGDL L  GDK+++LEKPS EW++G CNG++GMFP+NYVKP     F
Sbjct: 85  EYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYVKPVTKDSF 144

Query: 64  DRPAAPPPPQYDQKAMA-SQPSGGNAMWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 122
               APPPPQY Q +    QPS     +                                
Sbjct: 145 ----APPPPQYQQYSNNYQQPSYSQPAY--PPASTGYYQQPQQVQVQQPQQVQVQQQPQQ 198

Query: 123 XGKRHHGLGKFGSKLGNAAIFGAGATLGSDLINSIF 158
             + +  L +FGSKLGNAAIFGAGATLGSDL+NSIF
Sbjct: 199 QSQTNEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234

>Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR154W
           (PIN3) -  [contig 189] FULL
          Length = 236

 Score =  135 bits (340), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/181 (45%), Positives = 94/181 (51%), Gaps = 25/181 (13%)

Query: 3   GEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSGG 62
            EFVEAIY F  QQ+GDL L  GDKIEVLEKPSPEW++GRCNGRVGMFPSNYVKPAFSG 
Sbjct: 56  SEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGS 115

Query: 63  ---FDRPA--APPPPQYDQKAMASQPSGGNAMWXX------------------XXXXXXX 99
               +RP   APP  Q  Q    +  +  N+ +                           
Sbjct: 116 NASLERPNVPAPPEYQSQQIVPQATNTSANSNYSQPPFPPPSTAYYQGPPQQYQPQQQYQ 175

Query: 100 XXXXXXXXXXXXXXXXXXXXXXXXGKRHHG--LGKFGSKLGNAAIFGAGATLGSDLINSI 157
                                   G  H G    KFG KLGNAAIFGAGAT+GSD++NSI
Sbjct: 176 QQYYQGQQATPQPAPAAPAAQQGTGSSHTGAAFKKFGGKLGNAAIFGAGATIGSDIVNSI 235

Query: 158 F 158
           F
Sbjct: 236 F 236

>CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar to
           uniprot|Q06449 Saccharomyces cerevisiae YPR154w
          Length = 202

 Score =  134 bits (337), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 90/158 (56%), Gaps = 5/158 (3%)

Query: 1   MGGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFS 60
           M  E+VEA+Y F PQQ+GDLA+  GDKI+VLEKPS EW+RG  NGR GMFPSNYV+PA +
Sbjct: 50  MSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRPAAA 109

Query: 61  GGFDRPAAPPPPQYDQKAMASQPSGGNAMWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 120
              +      PP YD   ++ QP+   +                                
Sbjct: 110 PSANL----APPAYDNPKLSPQPT-VQSFQPPAQPIVAQPSPQPAYYQAPPQQVVVEQQP 164

Query: 121 XXXGKRHHGLGKFGSKLGNAAIFGAGATLGSDLINSIF 158
                 H+GL  FGSKLGNAAIFGAGATLGSDL+NSIF
Sbjct: 165 VQQSSAHNGLKSFGSKLGNAAIFGAGATLGSDLVNSIF 202

>Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W
           (REAL)
          Length = 235

 Score =  134 bits (338), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 69/161 (42%), Positives = 92/161 (57%), Gaps = 6/161 (3%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSGGF 63
           E+VEA+Y+FDPQQ+GDL L  GDK+++LEK SPEW++G CNGR G+FP+NYVKP FS   
Sbjct: 75  EYVEAVYQFDPQQDGDLGLKQGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPVFSDSD 134

Query: 64  DRPAAPPPPQYDQKAMASQPSGGNAMWXXX------XXXXXXXXXXXXXXXXXXXXXXXX 117
            +   PPPPQY  + +   P+  + +                                  
Sbjct: 135 GQHRLPPPPQYKAQELQQIPTQNSNVSSYQPQPFPPPSTNYYQQPLQQPQLQPQQPPPPQ 194

Query: 118 XXXXXXGKRHHGLGKFGSKLGNAAIFGAGATLGSDLINSIF 158
                    ++ L  FGSKLGNAAIFGAGA++GSD++NSIF
Sbjct: 195 QQQQQQSSSNNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 235

>Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON}
           complement(17610..18329) [720 nt, 240 aa]
          Length = 239

 Score =  114 bits (286), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 57/59 (96%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSGG 62
           E+VEAIYRFDPQQ+GDLA+ PGDKI+VLEK SPEW++G+CNG+VG+FPSNYVKPAFSGG
Sbjct: 59  EYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGKCNGKVGVFPSNYVKPAFSGG 117

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/26 (96%), Positives = 26/26 (100%)

Query: 133 FGSKLGNAAIFGAGATLGSDLINSIF 158
           FGSKLGNAAIFGAGATLGSDL+NSIF
Sbjct: 214 FGSKLGNAAIFGAGATLGSDLVNSIF 239

>TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3.501
           YPR154W
          Length = 220

 Score =  111 bits (277), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 46/59 (77%), Positives = 54/59 (91%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSGG 62
           E+VEAIYRFDPQQ+GDLA+ PGDKI+VLEK SPEW++G CNG+VG+FPSNY KPAFSG 
Sbjct: 63  EYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSGS 121

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 5/37 (13%)

Query: 127 HHG-----LGKFGSKLGNAAIFGAGATLGSDLINSIF 158
           HH      L  FGSKLGNAAIFGAGAT+GSD++NSIF
Sbjct: 184 HHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220

>KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 233

 Score =  111 bits (277), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 49/60 (81%), Positives = 53/60 (88%)

Query: 3   GEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSGG 62
           GEFVEAIY F  QQ+GDL L  GDK+EVLEKPSPEWF+G+CNGRVGMFPSNYVKPAFSG 
Sbjct: 56  GEFVEAIYAFQAQQDGDLNLQVGDKVEVLEKPSPEWFKGKCNGRVGMFPSNYVKPAFSGS 115

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 26/27 (96%)

Query: 132 KFGSKLGNAAIFGAGATLGSDLINSIF 158
           KFG KLGNAA+FGAGAT+GSD++NSIF
Sbjct: 207 KFGGKLGNAAVFGAGATIGSDIVNSIF 233

>SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 230

 Score =  105 bits (262), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 54/64 (84%), Gaps = 2/64 (3%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSG-- 61
           E+VEAIY F  QQ+GDL L PGDKI+VLEKPS EW++G+CNG VGMFPSNYVKPAFSG  
Sbjct: 57  EYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGSN 116

Query: 62  GFDR 65
           GF R
Sbjct: 117 GFTR 120

 Score = 53.5 bits (127), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%)

Query: 128 HGLGKFGSKLGNAAIFGAGATLGSDLINSIF 158
               KFGSKLGNAAIFGAGAT+GSD++NSIF
Sbjct: 200 QAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230

>AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR136W (LSB1) and
           YPR154W (PIN3)
          Length = 257

 Score =  105 bits (262), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 52/79 (65%), Positives = 60/79 (75%), Gaps = 1/79 (1%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSGGF 63
           E+VEA+Y F  QQ GDL    G+KIEVLEKPSPEW++GRCNG+VGMFPSNYVKPAFSGG 
Sbjct: 57  EYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSGGS 116

Query: 64  DRPAAPPPPQYDQKAMASQ 82
               A  PP+Y  +A A Q
Sbjct: 117 LMKEA-SPPRYPAQASAPQ 134

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/27 (92%), Positives = 27/27 (100%)

Query: 132 KFGSKLGNAAIFGAGATLGSDLINSIF 158
           KFGSKLGNAAIFGAGATLGSDL++SIF
Sbjct: 231 KFGSKLGNAAIFGAGATLGSDLVHSIF 257

>Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W
           (REAL)
          Length = 249

 Score =  100 bits (248), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 57/81 (70%), Gaps = 13/81 (16%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAF---- 59
           EFVEA+Y F+PQQEGDL L  GDKI++LEK SP+W+RG+ N RVG+FP+NYVKPAF    
Sbjct: 56  EFVEALYDFEPQQEGDLPLKTGDKIQILEKISPDWYRGKANNRVGIFPANYVKPAFARSA 115

Query: 60  ---------SGGFDRPAAPPP 71
                    S    RP+APPP
Sbjct: 116 SPENEGASLSSKVSRPSAPPP 136

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/26 (80%), Positives = 26/26 (100%)

Query: 133 FGSKLGNAAIFGAGATLGSDLINSIF 158
           FGSKLGNAAIFGAG+T+GSD+++SIF
Sbjct: 224 FGSKLGNAAIFGAGSTIGSDIVHSIF 249

>KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 220

 Score = 97.1 bits (240), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 54/69 (78%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSGGF 63
           E VEA+Y F PQQ+GDLAL PGDKIE+LEK SPEW++G+CNG+VG+FPSNYVK   +   
Sbjct: 54  EIVEALYAFQPQQDGDLALKPGDKIEILEKLSPEWYKGKCNGQVGVFPSNYVKSVDTKDV 113

Query: 64  DRPAAPPPP 72
           ++ ++   P
Sbjct: 114 EKRSSSATP 122

 Score = 54.3 bits (129), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 25/27 (92%), Positives = 27/27 (100%)

Query: 132 KFGSKLGNAAIFGAGATLGSDLINSIF 158
           KFGSKLGNAAIFGAGAT+GSDL+NSIF
Sbjct: 194 KFGSKLGNAAIFGAGATIGSDLVNSIF 220

>YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein
           containing an N-terminal SH3 domain; binds Las17p, which
           is a homolog of human Wiskott-Aldrich Syndrome protein
           involved in actin patch assembly and actin
           polymerization
          Length = 241

 Score = 94.4 bits (233), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 42/81 (51%), Positives = 56/81 (69%), Gaps = 13/81 (16%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAF---- 59
           E+VEA+Y F+ QQ+GDL+L  GDKI+VLEK SP+W+RG+ N ++G+FP+NYVKPAF    
Sbjct: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFTRSA 115

Query: 60  ---------SGGFDRPAAPPP 71
                    S    RP+ PPP
Sbjct: 116 SPKSAEAASSSTVSRPSVPPP 136

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/26 (80%), Positives = 25/26 (96%)

Query: 133 FGSKLGNAAIFGAGATLGSDLINSIF 158
           FGSKLGNAAIFGAG+ +GSD++NSIF
Sbjct: 216 FGSKLGNAAIFGAGSAIGSDIVNSIF 241

>Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W
           (REAL)
          Length = 241

 Score = 94.0 bits (232), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 56/81 (69%), Gaps = 13/81 (16%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAF---- 59
           E+VEA+Y F+ QQ+GDL+L  GDKI+VLEK SP+W++G+ N RVG+FP+NYVKPAF    
Sbjct: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRSV 115

Query: 60  ---------SGGFDRPAAPPP 71
                    S    RP+ PPP
Sbjct: 116 LTKPEEGDLSSKVSRPSVPPP 136

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/26 (80%), Positives = 25/26 (96%)

Query: 133 FGSKLGNAAIFGAGATLGSDLINSIF 158
           FGSKLGNAAIFGAG+ +GSD++NSIF
Sbjct: 216 FGSKLGNAAIFGAGSAIGSDIVNSIF 241

>Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii AFR320W
          Length = 253

 Score = 90.9 bits (224), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 46/76 (60%), Positives = 53/76 (69%), Gaps = 8/76 (10%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFS--- 60
           E+VEA+Y F PQQ GDL    GDKIEVLEKPS +W++G+ NGRVGMFPSNYVK   +   
Sbjct: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPN 115

Query: 61  -GGFDRPAAPPPPQYD 75
            G FD     PPPQY 
Sbjct: 116 GGRFDE----PPPQYS 127

 Score = 48.5 bits (114), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 21/27 (77%), Positives = 26/27 (96%)

Query: 132 KFGSKLGNAAIFGAGATLGSDLINSIF 158
           KFGSKLGNAA+FGAGAT+GS+L++ IF
Sbjct: 227 KFGSKLGNAAVFGAGATMGSELVHHIF 253

>ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakly
          similar to uniprot|Q06449 Saccharomyces cerevisiae
          YPR154W PIN3 Protein that induces appearance of [PIN ]
          prion when overproduced
          Length = 150

 Score = 84.3 bits (207), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 33/56 (58%), Positives = 45/56 (80%)

Query: 3  GEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPA 58
          GE+VE +Y F PQ + DL + PGDK+EV+EK S +W++G+CNG+ GMFP+NYVKP 
Sbjct: 14 GEYVEVLYEFKPQNKEDLHIKPGDKVEVVEKLSADWYKGKCNGKEGMFPANYVKPV 69

 Score = 59.7 bits (143), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 27/33 (81%), Positives = 30/33 (90%)

Query: 126 RHHGLGKFGSKLGNAAIFGAGATLGSDLINSIF 158
           RHH LGK GSKLGNAAIFG GATLG+DL++SIF
Sbjct: 118 RHHALGKVGSKLGNAAIFGVGATLGNDLVDSIF 150

>Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W
           (REAL)
          Length = 238

 Score = 85.5 bits (210), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 61/97 (62%), Gaps = 19/97 (19%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAF---- 59
           E+VEA+Y F+ QQ+GDL+L  GDKI++LEK S +W++G+ N  +G+FP+NYVKPAF    
Sbjct: 56  EYVEALYDFEAQQDGDLSLKTGDKIQILEKISLDWYKGKANDMIGIFPANYVKPAFTRST 115

Query: 60  ---------SGGFDRPAAPPP------PQYDQKAMAS 81
                    S    RP+ PPP      P+Y  + +++
Sbjct: 116 SPDFEKTPLSSRVSRPSVPPPSYEPAVPEYSSQQVSA 152

 Score = 48.9 bits (115), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 22/26 (84%), Positives = 26/26 (100%)

Query: 133 FGSKLGNAAIFGAGATLGSDLINSIF 158
           FGSKLG+AAIFGAG+T+GSD+INSIF
Sbjct: 213 FGSKLGDAAIFGAGSTIGSDIINSIF 238

>KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON}
           Anc_3.501 YPR154W
          Length = 217

 Score = 83.6 bits (205), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 79/158 (50%), Gaps = 8/158 (5%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPA-FSGG 62
           E+VEAI+R+ PQ++ DL L  GDK+E+LEK S +W+RG+  G+VG+FPSNYVK   FSG 
Sbjct: 60  EYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSGV 119

Query: 63  FDRPAAPPPPQYDQKAMASQPSGGNAMWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 122
            D      PP     + ++Q      +                                 
Sbjct: 120 DDAMFQDIPPS----SFSTQQYVPPYVPPPQEKPQQPKPQPQPQPQPQPQPQPQPQPEPK 175

Query: 123 XGKRHH--GLGK-FGSKLGNAAIFGAGATLGSDLINSI 157
             K+HH  G GK    + GN+ +FGAG  +GSD++N I
Sbjct: 176 PQKQHHHSGAGKNLLKQFGNSIVFGAGQRIGSDIVNGI 213

>TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON}
           Anc_3.501 YPR154W
          Length = 269

 Score = 75.9 bits (185), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 44/55 (80%)

Query: 2   GGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVK 56
           G ++VEAIY +  +Q+GDL L PGD IEV+ K SP+W+ GR NG+VG+FP+NYVK
Sbjct: 67  GPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 20/23 (86%)

Query: 136 KLGNAAIFGAGATLGSDLINSIF 158
           KLGNAA+FGAG+  G+D++N IF
Sbjct: 247 KLGNAALFGAGSAFGADIVNDIF 269

>NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201)
           [1305 bp, 434 aa] {ON} Anc_1.356 YFR024C-A
          Length = 434

 Score = 58.2 bits (139), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (72%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSP--EWFRGRCNGRVGMFPSNYVK 56
           A+YRF  +Q+GDL+   GDKI +L++     +W+ GR NG+ G+FP+NYV+
Sbjct: 382 ALYRFTGEQKGDLSFQKGDKITILKRTESQNDWWSGRVNGKEGIFPANYVE 432

>TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {ON}
           Anc_2.502 YHL002W
          Length = 485

 Score = 55.8 bits (133), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 34/52 (65%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKP 57
           V A+Y    Q+E +L+   GD I VLE+   +W+RG  +G++G+FP NYV P
Sbjct: 234 VRAMYELISQEENELSFRKGDVITVLEQVYRDWWRGTLHGKIGIFPLNYVTP 285

>TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 468

 Score = 55.5 bits (132), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           A+Y FD ++ GDL+   GD I +++K   +  W+ GRCNG  G+FP+NYV+
Sbjct: 416 ALYTFDGEERGDLSFRKGDIIVIIKKSESQDDWWSGRCNGEEGIFPANYVE 466

>Suva_15.199 Chr15 complement(345409..346735,346904..346950) [1374
           bp, 457 aa] {ON} YHR016C (REAL)
          Length = 457

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSP--EWFRGRCNGRVGMFPSNYVK 56
           A+Y F  +Q GDLA   GD I +L+K     +W+ GR NG+ G+FP+NYV+
Sbjct: 405 ALYNFAGEQSGDLAFKKGDVITILKKSDSQNDWWTGRVNGKEGIFPANYVR 455

>Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 bp,
           468 aa] {ON} YHR016C (REAL)
          Length = 468

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSP--EWFRGRCNGRVGMFPSNYVK 56
           A+Y F  +Q GDLA   GD I +L+K     +W+ GR NG+ G+FP+NYV+
Sbjct: 416 ALYNFAGEQSGDLAFKKGDVISILKKSDSQNDWWTGRANGKEGIFPANYVR 466

>NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON}
           Anc_5.470
          Length = 463

 Score = 53.5 bits (127), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 2   GGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKP--SPEWFRGRCNGRVGMFPSNYVK 56
           GGE V A+Y +  Q  GDL+   G  IE++E+     EW+ GR NG+ G+FP NYV+
Sbjct: 403 GGETVTALYEYQAQAAGDLSFPAGAVIEIVERTPDVNEWWTGRYNGQQGVFPGNYVQ 459

>Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 bp,
           475 aa] {ON} YHR016C (REAL)
          Length = 475

 Score = 52.8 bits (125), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSP--EWFRGRCNGRVGMFPSNYVK 56
           A+Y F  +Q GDLA   GD I +L+K     +W+ GR NG+ G+FP+NYV+
Sbjct: 423 ALYNFAGEQPGDLAFKKGDAISILKKSDSQNDWWTGRINGKEGIFPANYVR 473

>YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,
           468 aa] {ON}  YSC84Actin-binding protein involved in
           bundling of actin filaments and endocytosis of actin
           cortical patches; activity stimulated by Las17p;
           contains SH3 domain similar to Rvs167p
          Length = 468

 Score = 52.8 bits (125), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSP--EWFRGRCNGRVGMFPSNYVK 56
           A+Y F  +Q GDLA   GD I +L+K     +W+ GR NG+ G+FP+NYV+
Sbjct: 416 ALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVR 466

>KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 464

 Score = 52.4 bits (124), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           A+Y F  ++ GDL    GD I VL+K   +  W+ GR NGR G+FP+NYV+
Sbjct: 412 ALYSFTGEESGDLPFRKGDVITVLKKSDSQNDWWTGRVNGREGIFPANYVE 462

>Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [1359
           bp, 452 aa] {ON} similar to Ashbya gossypii AEL017W
           1-intron
          Length = 452

 Score = 52.4 bits (124), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           A+Y F  +Q+GDL    GD I +L+K + +  W+ GR NG+ G+FP+NYV+
Sbjct: 400 ALYTFKGEQDGDLPFRTGDVIAILKKSNSQDDWWTGRVNGQEGIFPANYVE 450

>CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002w
          Length = 450

 Score = 52.0 bits (123), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (62%)

Query: 2   GGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKP 57
           G   V A+Y  +  ++ +L+   GD I VLE+   +W+RG  +G++G+FP NYV P
Sbjct: 213 GIRRVRALYDLNANEQDELSFRKGDVIVVLEQVYRDWWRGSLHGKIGIFPLNYVTP 268

>TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa]
           {ON} Anc_2.502 YHL002W
          Length = 539

 Score = 52.0 bits (123), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 32/52 (61%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKP 57
           V A+Y     + G+L+   GD I+V+E+   +W+RG   G VG+FP NYV P
Sbjct: 245 VRAMYDLTASEPGELSFKKGDIIKVIEQVYRDWWRGSLRGTVGIFPLNYVNP 296

>KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p- Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 489

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 33/52 (63%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKP 57
           V A++    ++  +L+   GD I V+E+   +W+RGR  GRVG+FP NYV P
Sbjct: 217 VRALHDLTGRESDELSFRKGDIIVVIEQVYKDWWRGRLRGRVGIFPLNYVTP 268

>NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072)
           [1326 bp, 441 aa] {ON} Anc_1.356 YFR024C-A
          Length = 441

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           A+Y F  ++ GDL    GD I +L+K   +  W+ GR NGR G+FP+NYV+
Sbjct: 389 ALYSFSGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 439

>Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 bp,
           460 aa] {ON} YFR024C-A (REAL)
          Length = 460

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           A+Y F  ++ GDL    GD I +L+K   +  W+ GR NGR G+FP+NYV+
Sbjct: 408 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVE 458

>TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 454

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           A+Y F  ++ GDL+   GD I +L+K   +  W+ GR NG+ G+FP+NYV+
Sbjct: 402 ALYTFSGEESGDLSFKKGDVIAILKKSDSQDDWWTGRVNGKEGIFPANYVE 452

>KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {ON}
           Anc_2.502 YHL002W
          Length = 455

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (58%)

Query: 2   GGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAF 59
           G + V A+Y F   +  +L+   GD I VLE+   +W+RG   GR+G+FP NYV P  
Sbjct: 212 GVKKVRAMYDFPSTEADELSFKKGDIIIVLEQVYRDWWRGSLRGRIGIFPLNYVTPIM 269

>YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 bp,
           459 aa] {ON}  LSB3Protein containing a C-terminal SH3
           domain; binds Las17p, which is a homolog of human
           Wiskott-Aldrich Syndrome protein involved in actin patch
           assembly and actin polymerization
          Length = 459

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           A+Y F  ++ GDL    GD I +L+K   +  W+ GR NGR G+FP+NYV+
Sbjct: 407 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVE 457

>TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {ON}
           Anc_5.470 YDR388W
          Length = 493

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSP--EWFRGRCNGRVGMFPSNYVK 56
           E V A+Y +  Q EGDL+   G  IE++++ +   EW+ G+ NG+ G+FP NYVK
Sbjct: 435 ETVTALYEYQAQAEGDLSFPAGAVIEIVQRTADINEWWTGKYNGQQGVFPGNYVK 489

>SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some
           similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 468

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 2   GGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           G E V A+Y +  Q EGDL    G  IEV+E+ +    W+ GR NG+ G+FP NYV+
Sbjct: 408 GVETVTALYDYQAQAEGDLTFPVGAIIEVVERTTDTNGWWTGRYNGQQGVFPGNYVQ 464

>TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 397

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           A++RF  +Q GDL+ + GD + +L+K   +  W+ GR N + G+FP+NYV+
Sbjct: 345 ALFRFKGEQAGDLSFNKGDVVTILKKTDTQNDWWTGRVNNQEGIFPANYVE 395

>TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 433

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           A+Y F  ++ GDL    GD I +L+K   +  W+ GR NGR G+FP+NYV+
Sbjct: 381 ALYSFAGEESGDLPFRKGDVITILKKSESQDDWWTGRVNGREGIFPANYVE 431

>KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 459

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           A+Y F  ++ GDL    GD I +L+K   +  W+ GR NGR G+FP+NYV+
Sbjct: 407 ALYSFAGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 457

>Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON}
           YFR024C - Hypothetical ORF [contig 89] FULL
          Length = 217

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           A+Y F+ +Q GDL    GD I +L+K   +  W+ GR NG+ G+FP+NYV+
Sbjct: 165 ALYTFNGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYVE 215

>SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [1287
           bp, 428 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 428

 Score = 50.1 bits (118), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           A+Y F  +Q GDL    GD + +L+K   +  W+ GR NG+ G+FP+NYV+
Sbjct: 376 ALYTFKGEQSGDLPFRKGDVVTILKKSDSQDDWWTGRVNGQEGIFPANYVE 426

>NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {ON}
           Anc_5.470
          Length = 459

 Score = 50.1 bits (118), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 2   GGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSP--EWFRGRCNGRVGMFPSNYVK 56
           G E V A+Y +  Q  GDL+   G  IE++E+ S   EW+ G+ NG+ G+FP NYV+
Sbjct: 399 GVETVTALYDYQAQAAGDLSFPAGAVIEIVERTSDANEWWTGKYNGQQGVFPGNYVQ 455

>TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 511

 Score = 50.1 bits (118), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSP--EWFRGRCNGRVGMFPSNYVK 56
           A+Y F  ++ GDL+   GD I +++K     +W+ GR +GR G+FP+NYV+
Sbjct: 459 ALYSFTGEERGDLSFRKGDVITIIKKSESQNDWWTGRVSGREGIFPANYVE 509

>KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406)
           [1200 bp, 399 aa] {ON} similar to Saccharomyces
           cerevisiae YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 399

 Score = 49.7 bits (117), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           A+Y F  +Q GDL    GD I +L+K   +  W+ GR NG+ G+FP+NYV+
Sbjct: 347 ALYTFKGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYVE 397

>AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR024C-A
           (LSB3) and YHR016C (YSC84); 1-intron
          Length = 416

 Score = 49.7 bits (117), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYV 55
           A+Y F  +Q+GDL    GD I +L++   +  W+ GR NG+ G+FP+NYV
Sbjct: 364 ALYTFKGEQKGDLPFRKGDVIMILKRTESQDDWWTGRINGQEGIFPANYV 413

>CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {ON}
           highly similar to uniprot|P43603 Saccharomyces
           cerevisiae YFR024ca or uniprot|P32793 Saccharomyces
           cerevisiae YHR016c YSC84
          Length = 437

 Score = 49.7 bits (117), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           A+Y F  ++ GDL+   GD I +++K   +  W+ G+ NGR G+FP+NYV+
Sbjct: 385 ALYSFAGEEAGDLSFRKGDVITIIKKSDSQNDWWTGKVNGREGIFPANYVE 435

>Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar to
           Ashbya gossypii ABR008C
          Length = 459

 Score = 49.7 bits (117), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPA 58
           V A+Y  +  +  +L+   GD I V+E+   +W+RG   G+VG+FP NYV P 
Sbjct: 231 VRAMYSLNASESDELSFVKGDVITVIEQVYKDWWRGTLRGKVGIFPLNYVTPC 283

>KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.470
           YDR388W
          Length = 516

 Score = 49.7 bits (117), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 2   GGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSP--EWFRGRCNGRVGMFPSNYVK 56
           G E V A+Y +  Q  GDL+   G  IE++++ +   EW+ GR NG+ G+FP NYV+
Sbjct: 457 GVETVTALYDYQAQAAGDLSFPAGATIEIVQRTADVNEWWTGRYNGQQGVFPGNYVQ 513

>KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {ON}
           Anc_5.470 YDR388W
          Length = 441

 Score = 49.3 bits (116), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 2   GGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           G E V A+Y +  Q  GDL+   G  IE++++ + E  W+ GR NG+ G+FP NYV+
Sbjct: 382 GMETVTALYEYQAQAAGDLSFPAGAVIEIVQRTANENEWWTGRYNGQQGVFPGNYVQ 438

>SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {ON}
           similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 511

 Score = 49.3 bits (116), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 31/52 (59%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKP 57
           V A+Y     +  +L+   GD I V+E+   +W+RG   GRVG+FP NYV P
Sbjct: 233 VRAMYDLTATESDELSFKKGDVITVVEQVYRDWWRGNIRGRVGIFPLNYVTP 284

>Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 bp,
           459 aa] {ON} YFR024C-A (REAL)
          Length = 459

 Score = 48.9 bits (115), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           A+Y F  ++ GDL    GD I +L+K   +  W+ GR +GR G+FP+NYV+
Sbjct: 407 ALYTFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVSGREGIFPANYVE 457

>TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.502
           YHL002W
          Length = 451

 Score = 48.9 bits (115), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKP 57
           V A+Y    ++  +L+   GD I VLE+   +W+RG   G+VG+FP NYV P
Sbjct: 228 VRAMYDLSSEEPDELSFRKGDVIVVLEQVYRDWWRGTLCGKVGIFPLNYVTP 279

>KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [1272
           bp, 423 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 423

 Score = 48.9 bits (115), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           A+Y F  ++ GDL    GD I +++K   +  W+ GR NG+ G+FP+NYV+
Sbjct: 371 ALYTFKGEESGDLPFRKGDVISIIKKSESQDDWWTGRVNGKEGIFPANYVE 421

>NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa]
           {ON} Anc_1.356
          Length = 424

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           A+Y F  ++  DL    GD I +L+K   +  W+ GR NGR G+FP+NYV+
Sbjct: 372 ALYSFAGEETDDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 422

>Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 bp,
           455 aa] {ON} YFR024C-A (REAL)
          Length = 455

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           A++ F  ++ GDL    GD + +L+K   +  W+ GR NGR G+FP+NYV+
Sbjct: 403 ALFSFAGEESGDLPFRKGDVVTILKKSDSQNDWWTGRVNGREGIFPANYVE 453

>KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]
           {ON} similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation, as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 508

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 33/52 (63%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKP 57
           V A+Y F+  ++ +L+   GD I V+E+   +W+RG   G VG+FP NYV P
Sbjct: 227 VRAMYDFNSTEQDELSFKKGDLICVVEQVYRDWWRGTLAGSVGIFPLNYVTP 278

>NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON}
           Anc_1.356
          Length = 423

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 3   GEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
            E V A+Y F  +Q+GDLA   GD I V++K   +  W+ G+   + G+FP+NYV+
Sbjct: 366 AEKVVALYTFVGEQKGDLAFKKGDIITVIKKTKSQDDWWTGKLGNKEGIFPANYVE 421

>Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W
           (REAL)
          Length = 456

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKP 57
           V A+Y     +  +L+   GD I VLE+   +W++G   GR+G+FP NYV P
Sbjct: 226 VRAMYDLSTNEPDELSFRKGDVITVLEQVYRDWWKGALRGRMGIFPLNYVTP 277

>KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]
           {ON} some similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 435

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           E V A+Y +  Q EGDL    G  IEV+E+ +    W+ GR NG  G+FP NYV+
Sbjct: 378 ETVTALYDYQAQAEGDLTFPAGAIIEVVERTNDTNGWWTGRYNGYQGVFPGNYVQ 432

>Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {ON}
           YDR388W (RVS167) - 1:1 [contig 130] FULL
          Length = 461

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 4/56 (7%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPE---WFRGRCNGRVGMFPSNYVK 56
           E V A+Y +  Q EGDL    G  IEV+E+ +P+   W+ GR NG  G+FP NYV+
Sbjct: 404 ETVTALYDYQAQAEGDLTFPAGAIIEVVER-TPDVNGWWTGRYNGYQGVFPGNYVQ 458

>ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p-Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 411

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPA 58
           V+A+Y     +  +LA   GD I VLE+   +W+RG   G +G+FP NYV P 
Sbjct: 232 VKALYDLASNEPDELAFKKGDIIVVLEQVYRDWWRGSLRGSIGIFPLNYVTPV 284

>Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388W
           (REAL)
          Length = 460

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKP--SPEWFRGRCNGRVGMFPSNYVK 56
           E V A+Y +  Q  GDL+   G  IE++++   + EW+ GR NG+ G+FP NYV+
Sbjct: 402 ETVSALYDYQAQAAGDLSFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 456

>Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON}
           (92852..94357) [1506 nt, 502 aa]
          Length = 501

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 30/52 (57%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKP 57
           V A+Y     +  +L+   GD I VLE+   +W++G   G +G+FP NYV P
Sbjct: 240 VRAMYDLSSNEPDELSFKKGDIITVLEQVYRDWWKGTLRGNIGIFPLNYVTP 291

>ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa]
           {ON} similar to Saccharomyces cerevisiae YFR024C-A LSB3
           or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
           YHR016C YSC84
          Length = 469

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSP--EWFRGRCNGRVGMFPSNYVK 56
           A+Y F  ++ GDL    GD I +L+K     +W+ GR  GR G+FP+NYV+
Sbjct: 417 ALYTFSGEEYGDLPFRKGDVITILKKSDSQDDWWTGRVGGREGIFPANYVE 467

>CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa]
           {ON} highly similar to uniprot|P39743 Saccharomyces
           cerevisiae YDR388w RVS167
          Length = 466

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKP--SPEWFRGRCNGRVGMFPSNYVK 56
           E V A+Y +  Q  GDL+   G  IEV+++     EW+ GR NG+ G+FP NYV+
Sbjct: 410 ETVTALYDYQAQAAGDLSFPAGAVIEVVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 464

>YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}
           RVS167Actin-associated protein with roles in endocytosis
           and exocytosis; interacts with Rvs161p to regulate actin
           cytoskeleton, endocytosis, and viability following
           starvation or osmotic stress; recruited to bud tips by
           Gyl1p and Gyp5p during polarized growth; homolog of
           mammalian amphiphysin
          Length = 482

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSP--EWFRGRCNGRVGMFPSNYVK 56
           E V A+Y +  Q  GDL+   G  IE++++     EW+ GR NG+ G+FP NYV+
Sbjct: 424 ETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 478

>TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.470
           YDR388W
          Length = 473

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSP--EWFRGRCNGRVGMFPSNYVK 56
           V A+Y +  Q  GDL+   G  IEV+++     EW+ GR NG+ G+FP NYV+
Sbjct: 417 VTALYDYQAQAPGDLSFTAGAVIEVVQRTDDPNEWWTGRYNGQQGVFPGNYVQ 469

>Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388W
           (REAL)
          Length = 472

 Score = 46.6 bits (109), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKP--SPEWFRGRCNGRVGMFPSNYVK 56
           E V A+Y +  Q  GDL+   G  IE++++     EW+ GR NG+ G+FP NYV+
Sbjct: 414 ETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 468

>ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL002W
          Length = 443

 Score = 46.6 bits (109), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYV 55
           V+AI+  +  +  +L+   GD I V+E+   +W+RG   G+VG+FP NYV
Sbjct: 215 VKAIFDLNASEPDELSFKKGDVITVIEQVYKDWWRGLLRGKVGIFPVNYV 264

>KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 396

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           A+Y F  ++EGDL    GD I ++++   +  W+ G  NG+ G+FP+NYV+
Sbjct: 344 ALYNFGGKEEGDLIFKRGDIIAIVKRSDSQYDWWTGNLNGKEGLFPANYVE 394

>Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON}
           (25697..27109) [1413 nt, 471 aa]
          Length = 470

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 3   GEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSP--EWFRGRCNGRVGMFPSNYVK 56
            E   ++Y +  Q  GDL+   G  IE++E+ +   EW+ GR NG+ G+FP NYV+
Sbjct: 412 AETCTSLYEYQAQAAGDLSFPAGVLIEIVERTANVNEWWTGRYNGQQGVFPGNYVQ 467

>Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 bp,
           449 aa] {ON} complement(50905..52207,52597..52643) [1350
           nt, 450 aa]
          Length = 449

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE--WFRGRCNGRVGMFPSNYVK 56
           A+Y F  ++ GDL    GD I +L+K   +  W+ GR N   G+FP+NYV+
Sbjct: 397 ALYSFAGEESGDLRFKKGDVITILKKSDSQDDWWTGRVNTSEGIFPANYVE 447

>NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON}
           Anc_2.502
          Length = 450

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKP 57
           V A+Y     +  +L+   GD I VLE+   +W+RG   G  G+FP NYV P
Sbjct: 220 VRALYDLSSPEADELSFVKGDVITVLEQVYKDWWRGTLRGNTGIFPLNYVTP 271

>ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} similar
           to DEHA0G12903g and some similarites with YDR388W
           uniprot|P39743 Saccharomyces cerevisiae YDR388W RVS167
           BAR adaptor protein subunit of a complex (Rvs161p-
           Rvs167p) that regulates actin endocytosis and viability
           following starvation or osmotic stress
          Length = 459

 Score = 46.2 bits (108), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKP--SPEWFRGRCNGRVGMFPSNYVK 56
           E V A+Y +  Q  GDL+      IE++++   + EW+ GR +G+VG+FP NYV+
Sbjct: 401 ETVTALYDYQAQAPGDLSFPANAVIEIVQRTQDTNEWWTGRYHGQVGVFPGNYVQ 455

>Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)
          Length = 447

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKP 57
           V A+Y     +  +L+   GD I VLE+   +W++G   G++G+FP NYV P
Sbjct: 217 VRALYDLATNESEELSFRKGDVIIVLEQVYRDWWKGALRGKMGIFPLNYVTP 268

>YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subunit
           of the endosomal Vps27p-Hse1p complex required for
           sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation, as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 452

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKP 57
           V A+Y     +  +L+   GD I VLE+   +W++G   G +G+FP NYV P
Sbjct: 222 VRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYVTP 273

>AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR388W
           (RVS167)
          Length = 388

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPE-WFRGRCNGRVGMFPSNYV 55
           A+Y F  Q +GDL+      IE+L++     W+ GR NGR G+FP+NYV
Sbjct: 336 ALYDFAAQADGDLSFPVNAIIEILDRSDAAGWWTGRYNGREGLFPANYV 384

>Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W
           (HSE1) - Hypothetical ORF [contig 55] FULL
          Length = 532

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 31/52 (59%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKP 57
           V A++    +   +L+   GD I V+E+   +W+RG   G++G+FP NYV P
Sbjct: 229 VRALHDLVGRGSDELSFRKGDVIRVMEQVYRDWWRGSLRGKIGIFPLNYVTP 280

>SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1253

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 7   EAIYRFDPQQEGD--LALHPGDKIEVLEKPSPEWF--RGRCNGRVGMFPSNYVKPAFSGG 62
           +A+Y +D  Q  D  L  H GD+ +V +   P+W     + +G +G  P NYV+ + +  
Sbjct: 75  KALYDYDQVQNPDEELLFHEGDEFDVYDNRDPDWILCSSKTSGEIGFVPGNYVEISEATP 134

Query: 63  FDRPAAPPPPQYDQK 77
               + PPPPQ+  K
Sbjct: 135 VGSNSFPPPPQHVSK 149

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 7  EAIYRFDPQQEGDLALHPGDKIEVLEKPS-PEWF--RGRCNGR-----VGMFPSNYVKPA 58
          +AIY + PQ   +LA+   D + +L+K    +W+  + R  G      VG+ P+NY++ A
Sbjct: 9  KAIYAYQPQNPEELAIDEEDLLYLLQKSDVDDWWTVKKRVIGTDQEEPVGLVPNNYIEQA 68

>YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3
           domain protein implicated in the regulation of actin
           polymerization, able to recruit actin polymerization
           machinery through its SH3 domains, colocalizes with
           cortical actin patches and Las17p, interacts with type I
           myosins
          Length = 633

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLE-KPSPEWFRGRCNGRVGMFPSNYVK 56
           +EAIY ++ Q + ++++ PGD I V+       W  G C+G  G+FP++Y K
Sbjct: 582 MEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGLKGLFPTSYCK 633

 Score = 32.7 bits (73), Expect = 0.34,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 8/75 (10%)

Query: 7   EAIYRFDPQQEGDLALHPGDKIEVLEKPSPE-WFR--GRCNGRVGMFPSNYVK---PAFS 60
           + +Y +  + + ++ + PGDKI ++ + +   W +      G  G+ P+ Y++    A  
Sbjct: 499 KVLYAYVQKDDDEITITPGDKISLVARDTGSGWTKINNDTTGETGLVPTTYIRISSAATV 558

Query: 61  GGFDRPAAP--PPPQ 73
              DR  AP  PPP+
Sbjct: 559 KANDRGPAPEVPPPR 573

>TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {ON}
           Anc_5.470 YDR388W
          Length = 457

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 2   GGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSP--EWFRGRCNGRVGMFPSNYVK 56
            GE+  ++Y +  Q +GDL+   G  I+++++ +   +W+ G  NG+ G+FP NYV+
Sbjct: 398 AGEYCTSLYEYQAQAQGDLSFPAGAVIQIVQRSADVNDWWTGVYNGQQGVFPGNYVQ 454

>Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)
          Length = 454

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKP 57
           V A+Y     +  +L+    D I VLE+   +W++G   G++G+FP NYV P
Sbjct: 225 VRALYDLSTNEPDELSFRKDDVIIVLEQVYRDWWKGALRGKMGIFPLNYVTP 276

>KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa]
           {ON} Anc_2.502 YHL002W
          Length = 419

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAF 59
           V A+Y  +     +LA    D I V+E+   +W+ G    RVG+FP NYV P  
Sbjct: 219 VRAMYDLETSDPKELAFRKDDIIVVIEQSYKDWWLGSLGRRVGIFPLNYVTPII 272

>Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114W
           (BZZ1) - Myo3/5p-Bee1p-Vrp1p actin assembly complex
           component [contig 204] FULL
          Length = 621

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPE-WFRGRCNGRVGMFPSNYVK 56
           VEA+Y +  Q E + +L  GD I VL+      W  G  NG  G+FP++Y K
Sbjct: 570 VEAVYSYQAQGEDETSLTEGDVITVLKADDGSGWTYGEVNGEKGLFPTSYCK 621

 Score = 34.7 bits (78), Expect = 0.068,   Method: Composition-based stats.
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 9   IYRFDPQQEGDLALHPGDKIEVLEKPSPE-WFRGRCN--GRVGMFPSNYVKPAFSGGFDR 65
           +Y +  Q + ++++ PGD I +L   +   W + + +  G+ G+ P+ YV          
Sbjct: 496 LYLYQKQDDDEVSISPGDPITLLVADTGSGWTKIKNDRTGQTGLVPTTYVDIKEKARSSA 555

Query: 66  PAAPPP 71
           P APPP
Sbjct: 556 PRAPPP 561

>ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR114W (BZZ1)
          Length = 626

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPE-WFRGRCNGRVGMFPSNY 54
           V AIY +  Q + ++++  GD I+VL   +   W  G  NG  G+FPSNY
Sbjct: 575 VTAIYDYSAQDDDEISIRAGDVIKVLRGDTGNGWTYGEVNGSKGLFPSNY 624

>CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 aa]
           {ON} similar to uniprot|P32793 Saccharomyces cerevisiae
           YHR016c YSC84 and similar to uniprot|P43603
           Saccharomyces cerevisiae YFR024C-A LSB3
          Length = 391

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSP--EWFRGRCNGRVGMFPSNYV 55
           V A+Y F+ QQ+GDL+    D I V +K     +W+ G  +G  G+FP+NYV
Sbjct: 337 VRALYDFNGQQQGDLSFKKDDIIVVQKKTDSHNDWWYGVAHGVEGVFPANYV 388

>NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2.502
          Length = 459

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPA 58
           V A+Y        +L+   GD I VLE+   +W++G+   + G+FP NYV P 
Sbjct: 233 VRALYDLAGSGSDELSFKKGDVIMVLEQVYKDWWKGKLRDQTGIFPLNYVTPV 285

>Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}
           similar to Ashbya gossypii AFR140C
          Length = 421

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKP-SPEWFRGRCNGRVGMFPSNYVK 56
           E   ++Y F  Q + DL       IE+L++  S  W+ GR NG+ G+FP NYV+
Sbjct: 364 ETCTSLYAFAAQDKADLTFPANAVIEILDRADSSGWWTGRYNGQEGLFPGNYVR 417

>YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}
           PEX13Integral peroxisomal membrane protein required for
           translocation of peroxisomal matrix proteins, interacts
           with the PTS1 signal recognition factor Pex5p and the
           PTS2 signal recognition factor Pex7p, forms a complex
           with Pex14p and Pex17p
          Length = 386

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 7/60 (11%)

Query: 4   EFVEAIYRFDPQQ-EGDLALHPGDKIEVLEKPSP-----EWFRGRC-NGRVGMFPSNYVK 56
           EF  A+Y F P+  E ++AL  GD + +L K  P     +W++ R  NG +G  P NY++
Sbjct: 309 EFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYNYIE 368

>Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191W
           (REAL)
          Length = 388

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 7/60 (11%)

Query: 4   EFVEAIYRFDPQQ-EGDLALHPGDKIEVLEKPSP-----EWFRGRC-NGRVGMFPSNYVK 56
           EF  A+Y F P+  E ++AL  GD + +L K  P     +W++ R  NG +G  P NY++
Sbjct: 311 EFARALYDFVPENPEMEVALKKGDLMAILSKKDPVGRDSDWWKVRTKNGNIGYIPYNYIE 370

>KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {ON}
           weakly similar to uniprot|P80667 Saccharomyces
           cerevisiae YLR191W PEX13 Integral peroxisomal membrane
           receptor
          Length = 380

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 7/60 (11%)

Query: 4   EFVEAIYRFDPQQ-EGDLALHPGDKIEVLEKPSP-----EWFRGRCN-GRVGMFPSNYVK 56
           EF  A+Y F P+  + + AL  GD + V+ K  P     EW++ R   G VG  PSNYV+
Sbjct: 311 EFARAVYDFTPENPQVEAALRKGDLMAVISKQDPLGNASEWWQVRTKKGDVGYVPSNYVE 370

>KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 581

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSP--EWFRGRCNGRVGMFPSNYVK 56
           A++ F   + GDL    GD I ++++     +W+ GR N R G+FP+NYV+
Sbjct: 529 ALFDFGGAEPGDLTFKKGDVITIIKRSQSQNDWWLGRINEREGLFPANYVE 579

>Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191W
           (REAL)
          Length = 403

 Score = 40.8 bits (94), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 7/60 (11%)

Query: 4   EFVEAIYRFDPQQ-EGDLALHPGDKIEVLEKPSP-----EWFRGRC-NGRVGMFPSNYVK 56
           EF  A+Y F P+  + ++AL  GD + +L K  P     +W++ R  NG++G  P NY++
Sbjct: 326 EFARALYDFVPENPQIEVALTKGDLMAILSKKDPIGKNSDWWKVRTKNGKIGYIPYNYIE 385

>Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 40.4 bits (93), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLE-KPSPEWFRGRCNGRVGMFPSNYVK 56
           +EA+Y ++ Q + ++++  GD+I V+       W  G C+G  G+FP++Y +
Sbjct: 582 MEAVYAYEAQGDDEMSIDVGDEITVIRGDDGSGWTYGECDGLKGLFPTSYCR 633

>KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} similar
           to uniprot|P39743 Saccharomyces cerevisiae YDR388W
           RVS167 BAR adaptor protein subunit of a complex
           (Rvs161p-Rvs167p) that regulates actin endocytosis and
           viability following starvation or osmotic stress
          Length = 428

 Score = 40.4 bits (93), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 2   GGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPE-WFRGRCNGRVGMFPSNYVK 56
           G E   A+Y +  Q EGDL    G  I+V+++     W+ G  NG  G+FP NYV+
Sbjct: 369 GVETCTALYDYTAQAEGDLTFPAGAIIQVVDRSDAAGWWVGVYNGVQGVFPGNYVE 424

>Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191W
           (REAL)
          Length = 392

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 7/60 (11%)

Query: 4   EFVEAIYRFDPQQ-EGDLALHPGDKIEVLEKPSP-----EWFRGRC-NGRVGMFPSNYVK 56
           EF  A+Y F P+  + ++AL  GD + +L K  P     +W++ R  NG +G  P NY++
Sbjct: 315 EFARALYDFIPENPQMEVALKKGDLMAILSKKDPLGKDSDWWKVRTKNGSIGYIPYNYIE 374

>KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 622

 Score = 40.0 bits (92), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPE-WFRGRCNGRVGMFPSNYVK 56
           V+A++ ++ Q + ++++  GD I VL+      W  G  NG+ G+FP+NY +
Sbjct: 571 VKALFDYEAQGDDEISIRQGDLISVLKADDGSGWTYGELNGQKGLFPTNYCQ 622

 Score = 33.9 bits (76), Expect = 0.13,   Method: Composition-based stats.
 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 9   IYRFDPQQEGDLALHPGDKIEVLEKPSPE-WFRGR--CNGRVGMFPSNYVKPAFSGGFDR 65
           ++++  Q   ++++ PG+ I +L   S   W R +    G  G+ P++Y++         
Sbjct: 496 LFQYQKQDNDEVSVSPGNAISLLTADSGSGWTRIKNDSTGEAGLVPTSYIEINEKPRSSA 555

Query: 66  PAAPPP 71
           P APPP
Sbjct: 556 PRAPPP 561

>ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa]
          {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
          YBL007C SLA1 Cytoskeletal protein binding protein
          required for assembly of the cortical actin
          cytoskeleton contains 3 SH3 domains interacts with
          proteins regulating actin dynamics and with proteins
          required for endocytosis
          Length = 1392

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 8/62 (12%)

Query: 5  FVEAIYRFDPQQEGDLALHPGDKIEVLEKPS-PEWF--RGRCNGR-----VGMFPSNYVK 56
           V+A+Y ++PQ + +LA+   D + +LEK    EW+  + R  G       G+ PSNYV+
Sbjct: 7  VVKALYDYEPQTDEELAIKEDDILYLLEKSDVDEWWTVKKRVIGLDAEEPTGLVPSNYVE 66

Query: 57 PA 58
          PA
Sbjct: 67 PA 68

>TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {ON}
           Anc_7.365 YLR191W
          Length = 381

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 7/60 (11%)

Query: 4   EFVEAIYRFDPQ-QEGDLALHPGDKIEVLEKPSP-----EWFRGRC-NGRVGMFPSNYVK 56
           EF  A++ F+P+ ++ +L L  GD + +L K  P     +W++ R  NG  G  PSNY++
Sbjct: 307 EFARALFDFNPENRKIELTLTKGDLMAILTKKDPYGNTSKWWKVRTKNGDTGYVPSNYIE 366

>Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa]
           {ON} complement(127771..129684) [1914 nt, 638 aa]
          Length = 637

 Score = 39.7 bits (91), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLE-KPSPEWFRGRCNGRVGMFPSNYVK 56
           VEAIY ++   + +L++  G+ I+V+       W  G  NG  G+FPS+Y K
Sbjct: 586 VEAIYDYEAAGDDELSISQGETIKVIRGDDGSGWTYGESNGAKGLFPSSYCK 637

>Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 39.3 bits (90), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLE-KPSPEWFRGRCNGRVGMFPSNYVK 56
           +EA+Y ++ Q + ++++  GD I V+       W  G C+G  G+FP++Y K
Sbjct: 582 LEAMYAYEAQGDDEISIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYCK 633

 Score = 31.2 bits (69), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/75 (22%), Positives = 39/75 (52%), Gaps = 8/75 (10%)

Query: 7   EAIYRFDPQQEGDLALHPGDKIEVLEKPSPE-WFR--GRCNGRVGMFPSNYVKPAFSG-- 61
           + +Y +  Q + ++++ PGD+I ++ + +   W +      G  G+ P+ Y++ + +   
Sbjct: 499 KVLYAYVKQDDDEISISPGDRISLVARDTGSGWTKINNDSTGESGLVPTTYIRISTTDTA 558

Query: 62  -GFDRPAAP--PPPQ 73
              +R  AP  PPP+
Sbjct: 559 TANNRGPAPEVPPPR 573

>NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1235

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 6   VEAIYRFDP--QQEGDLALHPGDKIEVLEKPSPEWF--RGRCNGRVGMFPSNYVKPA 58
           ++A+Y +     QE +L  H  D  +V +   P+W   + R +  VG  P NYV+P 
Sbjct: 74  MKALYDYTEAQNQEEELTFHENDIFDVYDDKDPDWLLVKSRTSNEVGFIPGNYVEPV 130

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 8/60 (13%)

Query: 7  EAIYRFDPQQEGDLALHPGDKIEVLEKPS-PEWF--RGRCNGR-----VGMFPSNYVKPA 58
          +AIY ++PQ   +L +H  D + +LEK    EW+  + R  G      VG+ PSNY++ A
Sbjct: 9  KAIYDYEPQTPEELEIHEDDLLYLLEKSEVDEWWTVKKRVIGSDVVEPVGLVPSNYIEEA 68

>Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii ABR082W
          Length = 678

 Score = 39.3 bits (90), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 5   FVEAIYRFDPQQEGD-LALHPGDKIEVLEKPSPEWFRGRC---NGRVGMFPSNYVK 56
           + +A+Y F    E D L    GD + + EK + +W+ G     NGR G+ P NYVK
Sbjct: 620 YAKALYSFTEPNENDILNFQMGDHLLLTEKLNTDWYIGEVHNSNGRQGLIPMNYVK 675

>Smik_13.298 Chr13 (470071..473697) [3627 bp, 1208 aa] {ON} YMR109W
            (REAL)
          Length = 1208

 Score = 39.3 bits (90), Expect = 0.002,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 36/80 (45%), Gaps = 7/80 (8%)

Query: 7    EAIYRFDPQ-QEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYVKPAFSGGF 63
            EA Y F       +L L  GD + +  +    W  G+     + G  P+ Y+KP  SG +
Sbjct: 1076 EAAYDFPGSGSPSELPLKRGDVVYITREEPSGWSLGKLLDGSKEGWVPTAYMKP-HSGNY 1134

Query: 64   DRPAAPPPPQYDQKAMASQP 83
              P   PPP   QK  ASQP
Sbjct: 1135 STPTPAPPP---QKRTASQP 1151

>Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON}
          (50807..52930) [2124 nt, 708 aa]
          Length = 707

 Score = 39.3 bits (90), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 5/56 (8%)

Query: 6  VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGR-----VGMFPSNYVK 56
          V A+  ++PQ   DL +  GDKI VL      W+ GR   +      G+FPS++VK
Sbjct: 11 VVAVQAYEPQFTADLKISKGDKITVLYVEDDRWYYGRYVDKDGFTNSGIFPSSHVK 66

>TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {ON}
           Anc_2.159 YHR114W
          Length = 634

 Score = 38.5 bits (88), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLE-KPSPEWFRGRCNGRVGMFPSNYVK 56
           V+A+Y ++ Q + ++++  GD I V++      W  G  NG  G+FPS+Y K
Sbjct: 583 VQALYDYEAQGDDEISISVGDTITVIKGDDGSGWTFGELNGIKGLFPSSYCK 634

 Score = 30.4 bits (67), Expect = 1.9,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 37/69 (53%), Gaps = 6/69 (8%)

Query: 7   EAIYRFDPQQEGDLALHPGDKIEVLEKPSPE-WFRGRCN--GRVGMFPSNYV--KPAFSG 61
           + +Y+++ Q   ++++  GD I +++  +   W R + N  G  G+ P++YV  K   S 
Sbjct: 505 KVLYQYNKQDADEISIDVGDSISLVQADTGSGWTRIKNNTTGEEGLVPTSYVEIKTQESR 564

Query: 62  GFDRPAAPP 70
           G   P APP
Sbjct: 565 G-PAPVAPP 572

>KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 649

 Score = 38.5 bits (88), Expect = 0.004,   Method: Composition-based stats.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVL-EKPSPEWFRGRCNGRVGMFPSNY 54
           A Y +  Q   +L+L  GDKI+VL E     W  G  NG  G+FP+ Y
Sbjct: 600 AAYPYQSQGPDELSLQVGDKIKVLKEDEGNGWTFGELNGTQGLFPTTY 647

>SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} similar
           to uniprot|Q75BK5 Ashbya gossypii ACR266W ACR266Wp and
           some similarites with YHR114W uniprot|P38822
           Saccharomyces cerevisiae YHR114W BZZ1 SH3 domain protein
           implicated in the regulation of actin polymerization
           able to recruit actin polymerization machinery through
           its SH3 domains colocalizes with cortical actin patches
           and Las17p interacts with type I myosins
          Length = 625

 Score = 38.1 bits (87), Expect = 0.006,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 3/53 (5%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPS--PEWFRGRCNGRVGMFPSNYVK 56
           +EA+Y +  Q + +L+++ G  ++VL KP     W  G  +G  G+FP++Y K
Sbjct: 574 IEALYDYQAQGDDELSIYAGSVVKVL-KPDDGSGWTYGELDGAKGLFPTSYCK 625

>Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar to
           Ashbya gossypii ACR230C
          Length = 399

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 7/60 (11%)

Query: 4   EFVEAIYRFDPQQ-EGDLALHPGDKIEVLEKPSP-----EWFRGRCN-GRVGMFPSNYVK 56
           EF  A+Y F P+    + +L  GD + ++ K  P     +W++ R   G VG  PSNY++
Sbjct: 315 EFARAVYDFTPENPRIECSLKKGDLMAIISKLDPTGNESQWWKVRTKKGEVGYIPSNYIE 374

>TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4.108
           YBL007C
          Length = 1255

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 6   VEAIYRFDPQQEGD--LALHPGDKIEVLEKPSPEWF--RGRCNGRVGMFPSNYVKPAFSG 61
           V A+Y +D  Q  D  L  H  ++ +V +   P+W   + +  G  G  P NYV+P   G
Sbjct: 74  VRALYDYDQAQNPDEELTFHENEEFDVYDDQDPDWLLVQQKSTGACGFVPGNYVEPCGQG 133

 Score = 34.3 bits (77), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 8/60 (13%)

Query: 7  EAIYRFDPQQEGDLALHPGDKIEVLEKPS-PEWF--RGRCNGR-----VGMFPSNYVKPA 58
          +A+Y ++PQ   +LA+   + + +LEK    EW+  + R  G      VG+ PSNYV+ A
Sbjct: 9  KALYDYEPQTTEELAIREDELLYLLEKSDVDEWWTVKKRVIGSDADEPVGLVPSNYVEQA 68

>Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114W
           (REAL)
          Length = 634

 Score = 37.4 bits (85), Expect = 0.009,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 9/76 (11%)

Query: 7   EAIYRFDPQQEGDLALHPGDKIEVLEKPSPE-WFR--GRCNGRVGMFPSNYVKPAFSGGF 63
           + +Y +  Q   ++++ PGDKI ++ + S   W +      G  G+ P+ YV+ + + G 
Sbjct: 499 KVLYAYSKQDTDEISISPGDKISLVARDSGSGWTKINNDSTGETGLVPTTYVRISNADGG 558

Query: 64  D----RPAAP--PPPQ 73
           D    R  AP  PPP+
Sbjct: 559 DAANGRGPAPEVPPPR 574

 Score = 36.6 bits (83), Expect = 0.016,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLE-KPSPEWFRGRCNGRVGMFPSNYVK 56
           +EA Y ++ + + ++++  GD I V+       W  G C+G  G+FP++Y K
Sbjct: 583 LEAAYAYEAKGDDEMSIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYCK 634

>Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON}
           (19571..21283) [1713 nt, 571 aa]
          Length = 570

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 2   GGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYV 55
           GG    A Y +D  ++ +L    GDKI  +E    +W+ G     G  G+FPSNYV
Sbjct: 511 GGPSAVAEYDYDAAEDNELTFVEGDKIVNIEFVDDDWWLGELEKTGEKGLFPSNYV 566

>NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1226

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 6   VEAIYRFDPQQ--EGDLALHPGDKIEVLEKPSPEWF--RGRCNGRVGMFPSNYVKPA 58
           V+A+Y ++  Q  E +L  H  D   V +   P+W   + + +  VG  P NYV+P 
Sbjct: 74  VKALYDYEQIQNPEEELIFHENDLFSVYDDKDPDWLLVKSQISNEVGFVPGNYVQPV 130

 Score = 34.3 bits (77), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 7  EAIYRFDPQQEGDLALHPGDKIEVLEKPS-PEWF--RGRCNGR-----VGMFPSNYVKPA 58
          +AIY ++PQ   +L L   D + +LEK    +W+  + R  G      VG+ PSNY++ A
Sbjct: 9  KAIYDYEPQTPEELELKENDLLYLLEKSEVDDWWTVKKRVIGSDAEEPVGLVPSNYIEEA 68

>TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {ON}
           Anc_2.159 YHR114W
          Length = 613

 Score = 37.0 bits (84), Expect = 0.013,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLE-KPSPEWFRGRCNGRVGMFPSNYVK 56
           ++A Y ++ Q + +L+L P D + V+       W  G  NG  G+FP++Y +
Sbjct: 562 MQAQYDYEAQGDDELSLTPNDVVNVIRGDDGSGWTYGELNGEKGLFPTSYCR 613

>KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1244

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 8   AIYRFDPQQEGD--LALHPGDKIEVLEKPSPEWF--RGRCNGRVGMFPSNYVKP 57
           A+Y +D  Q  D  LA    D  ++ +   P+W   R + +G VG  P NYV+P
Sbjct: 76  ALYDYDQPQNPDEELAFKENDTFDLFDAQDPDWLLVRSQRDGSVGFVPGNYVEP 129

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 8/58 (13%)

Query: 7  EAIYRFDPQQEGDLALHPGDKIEVLEKPS-PEWF--RGRCNGR-----VGMFPSNYVK 56
          +A+Y ++PQ E +LA+   D + +L+K    +W+  + R  G       G+ PSNY++
Sbjct: 9  KAVYDYEPQTEEELAVRENDMLYLLQKSDVDDWWTVKKRVIGSDVEEPSGLVPSNYIE 66

>TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON}
           Anc_4.45 Scer_YGOB_SDC25
          Length = 1589

 Score = 36.6 bits (83), Expect = 0.018,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 5/62 (8%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRG---RCNGRV--GMFPSNYVKPA 58
           + V AI+ ++ + + +L L  GD I V+ K    W+ G     NG+V  G FP NY + +
Sbjct: 49  DVVVAIFDYNRKGKNELNLQQGDTIYVIGKNESGWWDGLSIEANGKVHRGWFPQNYCRSS 108

Query: 59  FS 60
            S
Sbjct: 109 HS 110

>SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa]
          {ON} similar to uniprot|Q07533 Saccharomyces cerevisiae
          YDL117W CYK3 SH3-domain protein located in the
          mother-bud neck and the cytokinetic actin ring mutant
          phenotype and genetic interactions suggest a role in
          cytokinesis
          Length = 905

 Score = 36.6 bits (83), Expect = 0.019,   Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 6  VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYV 55
          V+AIY +  ++E DL     D IEV  K    W+ GR   N + G FP+NYV
Sbjct: 12 VKAIYSWSGEKEYDLGFIEEDIIEV-TKAKGGWYYGRLLRNKKSGSFPANYV 62

>KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {ON}
           Anc_7.365 YLR191W
          Length = 344

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 7/60 (11%)

Query: 4   EFVEAIYRFDPQQEG-DLALHPGDKIEVLEKPSP-----EWFRGRC-NGRVGMFPSNYVK 56
           EF  AIY F P+    ++ L  GD + +L K        +W++ R  NG VG  P NY++
Sbjct: 260 EFARAIYNFVPENPNIEVNLQKGDLMAILSKKDSFGNDSQWWKVRTKNGSVGFVPFNYIE 319

>AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YJL020C
          (BBC1)
          Length = 923

 Score = 36.2 bits (82), Expect = 0.024,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 38/89 (42%), Gaps = 22/89 (24%)

Query: 6  VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC-----NGRVGMFPSNYVKPAFS 60
          V A Y ++   +GDL    G +IEV+     +W+ G       N + G+FP NYV+ A  
Sbjct: 13 VIAKYTYESIHDGDLNFEDGQRIEVISIEDNQWYYGHFVDGAGNEQEGIFPKNYVEVA-- 70

Query: 61 GGFDRPAAPPPPQYDQKAMASQPSGGNAM 89
                         Q  + S P+GG  M
Sbjct: 71 ---------------QDDIHSAPTGGIGM 84

>ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR032W (HOF1)
          Length = 683

 Score = 36.2 bits (82), Expect = 0.025,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 5   FVEAIYRF-DPQQEGDLALHPGDKIEVLEKPSPEWFRGRC---NGRVGMFPSNYVK 56
           +  AIY F +P     L    GD + + EK + +W+ G     NG+ G+ P NYV+
Sbjct: 625 YARAIYSFTEPNDNDILYFEMGDHLLLTEKLNTDWYIGEVHNGNGKQGLIPMNYVE 680

>SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]
           {ON} conserved hypothetical protein
          Length = 441

 Score = 35.8 bits (81), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 7/60 (11%)

Query: 5   FVEAIYRF--DPQQEG---DLALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYVKP 57
           +  A+Y +  DP Q+G   DL    GD I V++K    W+ G      R G FP N+V+ 
Sbjct: 378 YATALYDYSPDPNQQGTGEDLTFKNGDMIRVIKKTENNWWYGEVLRTKRRGYFPVNFVET 437

>NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa]
           {ON} Anc_7.419 YER118C
          Length = 355

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 6   VEAIYRF--DPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVK 56
           V+A+Y +  D     +L+   GD ++V +     W   + NG+ G+ PSNYVK
Sbjct: 300 VKALYSYKADDSDAYELSFEQGDILKVSDIEGRWWKARKENGQTGIIPSNYVK 352

>Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W
          (REAL)
          Length = 43

 Score = 32.7 bits (73), Expect = 0.041,   Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 20 LALHPGDKIEVLEKP--SPEWFRGRCNGRVGMFPSNYVK 56
          L    G  IE++++   + EW+ GR NG+ G+FP NYV+
Sbjct: 1  LTFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 39

>NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON}
          Anc_2.319 YDL117W
          Length = 864

 Score = 35.4 bits (80), Expect = 0.047,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query: 6  VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGR-VGMFPSNYVKP 57
          V A Y +  Q +GDL    GD +EV  + + +WF GR   N +  G FP+N+V P
Sbjct: 13 VRARYGWSGQTKGDLGFLEGDIMEV-TRVAGDWFYGRLLRNKKCAGYFPNNFVIP 66

>CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} similar
           to uniprot|P32790 Saccharomyces cerevisiae YBL007c SLA1
          Length = 1203

 Score = 35.4 bits (80), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 4/62 (6%)

Query: 6   VEAIYRFDPQQ--EGDLALHPGDKIEVLEKPSPEWF--RGRCNGRVGMFPSNYVKPAFSG 61
           + A+Y FD  Q  + +L     D  +V +   P+W   R   +   G  P NYV+PA   
Sbjct: 74  MRALYDFDQAQNPQEELVFKENDMFDVYDDKDPDWILVRSHSSNEYGFVPGNYVEPAGGA 133

Query: 62  GF 63
           G 
Sbjct: 134 GM 135

 Score = 32.0 bits (71), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 7  EAIYRFDPQQEGDLALHPGDKIEVLEKPS-PEWF--RGRCNGR-----VGMFPSNYVKPA 58
          +A+Y ++PQ   +LA+   D + +LEK    +W+  + R  G       G+ PSNY++ A
Sbjct: 9  KAVYSYEPQTPEELAIQEDDLLYLLEKSEVDDWWTVKKRIIGSDAEEPQGLVPSNYIEAA 68

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVL-EKPSPEWFRGR--CNGRVGMFPSNYVK 56
           A+Y F+ +   +L +  GD + V+ +K S +W+      NG+ G+ P+ +++
Sbjct: 377 ALYDFEAESPDELTIRQGDAVYVINDKKSKDWWMVELISNGKKGLVPAQFIE 428

>ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 659

 Score = 35.0 bits (79), Expect = 0.053,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 10  YRFDPQQEGDLALHPGDKIEVL-EKPSPEWFRGRCNGRVGMFPSNYVK 56
           Y +D Q+E ++ +  GD + VL E     W     +G  G+ P+NY K
Sbjct: 612 YDYDAQEENEMTVEVGDVVNVLKEDDGSGWTLAELDGDSGLIPTNYCK 659

 Score = 32.0 bits (71), Expect = 0.63,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 10/78 (12%)

Query: 9   IYRFDPQQEGDLALHPGDKIEVLEKPSPE-WFRGRCN--GRVGMFPSNYV----KPAFSG 61
           +Y F  +   +++++PGD I+VL   +   W + R N  G  G+ P++Y+    KP  S 
Sbjct: 527 VYAFRGRDNDEVSVNPGDSIKVLAPDTGSGWTKLRNNTTGDQGLAPTSYLEINEKPINSH 586

Query: 62  GFDR--PAAPPPPQYDQK 77
             +R  P + PPP+  +K
Sbjct: 587 A-ERGVPPSVPPPRGSKK 603

>TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa]
          {ON} Anc_2.319 YDL117W
          Length = 941

 Score = 35.0 bits (79), Expect = 0.054,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 10/57 (17%)

Query: 6  VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGR------CNGRVGMFPSNYVK 56
          V+A Y +  Q +GDL    GD +EV  K + +W+ GR      C+   G FP+N+VK
Sbjct: 15 VKAKYGWSGQAKGDLGFLEGDVMEV-TKITGDWYYGRLLRNRKCS---GYFPNNFVK 67

>NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366
           YCR088W
          Length = 615

 Score = 35.0 bits (79), Expect = 0.057,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYV 55
           A Y +D  +E +L     DKI  +E    +W+ G    NG  G+FPSNYV
Sbjct: 562 AEYDYDAGEENELTFVENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 611

>TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4.108
           YBL007C
          Length = 1302

 Score = 35.0 bits (79), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 5/61 (8%)

Query: 6   VEAIYRFDPQQEGD--LALHPGDKIEVLEKPSPEWF--RGRCNGRVGMFPSNYVKPAFSG 61
           V+AIY +D  Q  D  L  +  +  +V +    +W   + R   +VG  P NYV+P  SG
Sbjct: 74  VKAIYNYDEAQNPDEELLFNENEIFDVFDDRDQDWLLVKSRSANQVGFVPGNYVEP-ISG 132

Query: 62  G 62
           G
Sbjct: 133 G 133

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 7  EAIYRFDPQQEGDLALHPGDKIEVLEKPS-PEWF--RGRCNGR-----VGMFPSNYVKPA 58
          +A+Y ++PQ   +LA+   D + +LEK    +W+  + R  G       G+ PSNYV+ A
Sbjct: 9  KAVYAYEPQTPEELAIEEDDLLYLLEKSDVDDWWTVKKRVLGTDADEPTGLVPSNYVEEA 68

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 10  YRFDPQQEGDLALHPGDKIEVL-EKPSPEWFRGR--CNGRVGMFPSNYVKP 57
           Y F  +   +L +H GD + V+ ++ S EW+       G+ G+ P+++V+P
Sbjct: 403 YDFLAESHDELTVHAGDAVYVIDDQKSSEWWMVELISTGKKGVVPADFVEP 453

>ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 668

 Score = 35.0 bits (79), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGR--CNGRVGMFPSNYV 55
           A Y +D  ++ +L     DKI  +E    +W+ G     G  G+FPSNYV
Sbjct: 615 AEYDYDAAEDNELTFRENDKIVNIEFVDEDWWLGELGSTGEKGLFPSNYV 664

>Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON}
           similar to Ashbya gossypii AGR170C
          Length = 1146

 Score = 35.0 bits (79), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 4/61 (6%)

Query: 6   VEAIYRFDPQQEGD--LALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYVKPAFSG 61
           V AIY +   Q  D  L+   GD  ++ +    +WF  R   + +VG  P NYV+    G
Sbjct: 74  VHAIYDYKQVQNPDEELSFQEGDVFDIFDDRDADWFLVRAVKDKKVGFIPGNYVETIEEG 133

Query: 62  G 62
           G
Sbjct: 134 G 134

 Score = 34.3 bits (77), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 8/60 (13%)

Query: 7  EAIYRFDPQQEGDLALHPGDKIEVLEKPS-PEWFRGR-------CNGRVGMFPSNYVKPA 58
          +AIY ++PQ + +L +   D + VLEK    +W+  +           VG+ P+NY++ A
Sbjct: 9  KAIYSYEPQTDEELRIEEDDLLYVLEKSEVDDWWTVKKREIGTDTEELVGLVPNNYIEEA 68

>KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa]
          {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
          YBL007C SLA1 Cytoskeletal protein binding protein
          required for assembly of the cortical actin
          cytoskeleton contains 3 SH3 domains interacts with
          proteins regulating actin dynamics and with proteins
          required for endocytosis
          Length = 1249

 Score = 34.7 bits (78), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 37/60 (61%), Gaps = 8/60 (13%)

Query: 7  EAIYRFDPQQEGDLALHPGDKIEVLEKPS-PEWF--RGRCNGR-----VGMFPSNYVKPA 58
          +A+++++PQ + +LA+  GD + +L+K    +W+  + R  G      VG+ P+NY++ A
Sbjct: 9  KAVFQYEPQSDEELAIDEGDMLYLLQKSDVDDWWTVKKRVIGSDAEEPVGLVPNNYIEEA 68

>Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 bp,
           1230 aa] {ON} YBL007C (REAL)
          Length = 1230

 Score = 34.7 bits (78), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 4/57 (7%)

Query: 6   VEAIYRFDPQQEGD--LALHPGDKIEVLEKPSPEWF--RGRCNGRVGMFPSNYVKPA 58
           V AIY +   Q  D  L  H  D  +V +    +W   +   +   G  P NYV+PA
Sbjct: 74  VRAIYDYGQVQNADEELTFHENDTFDVFDDNDADWLLVKSTVSNEFGFIPGNYVEPA 130

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 10  YRFDPQQEGDLALHPGDKIEVL-EKPSPEWFRGRC--NGRVGMFPSNYVKPA 58
           Y F  + + +L +  GDK+ +L +K S +W+  +   +G+ G+ P+ +++P 
Sbjct: 359 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLIDSGKSGLVPAQFIEPV 410

 Score = 32.0 bits (71), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 8/59 (13%)

Query: 8  AIYRFDPQQEGDLALHPGDKIEVLEKPS-PEWF--RGRCNGR-----VGMFPSNYVKPA 58
          AIY ++PQ   +LA+   D + +L+K    +W+  + R  G      VG+ PS Y++ A
Sbjct: 10 AIYAYEPQTPEELAIQEDDLLYLLQKSDIDDWWTVKKRVIGSDSEEPVGLVPSTYIEEA 68

>SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON}
           some similarities with uniprot|P15891 Saccharomyces
           cerevisiae YCR088W ABP1 Actin-binding protein of the
           cortical actin cytoskeleton important for activation of
           the Arp2/3 complex that plays a key role actin in
           cytoskeleton organization
          Length = 636

 Score = 34.7 bits (78), Expect = 0.077,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYVKPA 58
           A Y ++  +E +L    GDKI  +E    +W+ G     G  G+FPSNYV+ A
Sbjct: 583 AEYDYEAGEENELTFTEGDKIINIEFVDDDWWLGELEKTGEKGLFPSNYVELA 635

>ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YDL117W
          (CYK3)
          Length = 925

 Score = 34.7 bits (78), Expect = 0.078,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 6  VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYVK 56
          V+A+Y +  + E DL     D IEV  K    W  GR   N + G FP NYV+
Sbjct: 12 VKAVYSWSGEHEQDLGFLESDIIEV-TKVKGNWLYGRLLRNKKSGYFPVNYVQ 63

>Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii AGL237C
          Length = 524

 Score = 34.7 bits (78), Expect = 0.078,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRG--RCNGRVGMFPSNYVK 56
           A Y ++  ++ +L    GD+I  +E    +W+ G  +  G  G+FPSNYVK
Sbjct: 471 AEYDYEAGEDNELTFKEGDRIIDIEFVDDDWWLGVLKNTGEKGLFPSNYVK 521

>Suva_2.118 Chr2
          complement(206707..206754,206785..206832,
          206899..207209,207250..207279,207310..207393,
          207427..210403) [3498 bp, 1166 aa] {ON} YBL007C (REAL)
          Length = 1166

 Score = 34.7 bits (78), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 8/59 (13%)

Query: 8  AIYRFDPQQEGDLALHPGDKIEVLEKPS-PEWF--RGRCNGR-----VGMFPSNYVKPA 58
          AIY ++PQ   +LA+H  D + +L+K    +W+  + R  G      VG+ PS Y++ A
Sbjct: 10 AIYDYEPQTPEELAIHEDDLLYLLQKSDIDDWWTVKRRVIGSDSDEPVGLVPSTYIEEA 68

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 10  YRFDPQQEGDLALHPGDKIEVL-EKPSPEWFRGRC--NGRVGMFPSNYVKPA 58
           Y F  + + +L +  GDK+ +L +K S +W+  +   +G+ G+ P+ +V+P 
Sbjct: 354 YDFLAESQDELTIKSGDKVYILDDKKSSDWWMCQLIDSGKSGLVPAQFVEPV 405

>TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa]
           {ON} Anc_2.159 YHR114W
          Length = 673

 Score = 34.3 bits (77), Expect = 0.11,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPS--PEWFRGRCNGRVGMFPSNYVK 56
           A+Y ++ Q + +++L  GD I+V+ KP     W  G  N +  +FP++Y K
Sbjct: 619 ALYPYEAQGDDEMSLAVGDTIKVI-KPDDGSGWTFGELNNKQSLFPTSYCK 668

 Score = 33.9 bits (76), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 32/53 (60%), Gaps = 3/53 (5%)

Query: 7   EAIYRFDPQQEGDLALHPGDKIEVLEKPSPE-WFR--GRCNGRVGMFPSNYVK 56
           + +Y +    + +++++PGD I+V+EK +   W +      G +G+ PS+Y++
Sbjct: 538 KVLYAYTKDDDDEVSINPGDSIDVVEKDTGSGWTKINNHSTGEIGLVPSSYLE 590

>KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]
          {ON} some similarities with uniprot|P47068
          Saccharomyces cerevisiae YJL020C/YJL021C BBC1 Protein
          possibly involved in assembly of actin patches
          Length = 851

 Score = 34.3 bits (77), Expect = 0.12,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 31/73 (42%), Gaps = 5/73 (6%)

Query: 6  VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGR---CNGRV--GMFPSNYVKPAFS 60
          VEA++ +    E DL    G  I VLE    EWF G     +G+   G+FP  +V     
Sbjct: 7  VEALFPYTSDFEDDLPFSKGQIITVLEIEDDEWFFGEFKDADGKTKQGIFPKGFVSEPLK 66

Query: 61 GGFDRPAAPPPPQ 73
               PA    P+
Sbjct: 67 ETASEPAQEKQPE 79

>AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL007C
           (SLA1)
          Length = 1121

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 4/55 (7%)

Query: 6   VEAIYRFDPQQEGD--LALHPGDKIEVLEKPSPEWF--RGRCNGRVGMFPSNYVK 56
           V ++Y ++  Q  D  L    GD+ +V +    +W   R R +G VG  P NYV+
Sbjct: 74  VRSVYDYEEAQNPDEELVFREGDEFDVYDDRDADWVLVRKRADGSVGFAPGNYVE 128

>Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON}
           (104879..108487) [3609 nt, 1203 aa]
          Length = 1202

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 40/119 (33%), Gaps = 37/119 (31%)

Query: 6   VEAIYRFDPQQEGD--LALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYVKP--AF 59
           V+A+Y +   Q  D  L  +  D  +V +   P+W   R     + G  P NYV+P  A 
Sbjct: 74  VKAVYDYHEVQNPDEELVFNENDTFDVYDDKDPDWILARSISTNQFGFIPGNYVEPLNAE 133

Query: 60  SG-------------------------------GFDRPAAPPPPQYDQKAMASQPSGGN 87
           +G                                 D    PPPPQ+  K  A     GN
Sbjct: 134 TGSAVPPSQPAAAAALPPPIATSATSPPAPALTAIDISTLPPPPQHSSKTNAQASDSGN 192

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 7  EAIYRFDPQQEGDLALHPGDKIEVLEKPS-PEWF--RGRCNGR-----VGMFPSNYVKPA 58
          +AIY ++PQ   +L +   D + +LEK +  +W+  + R  G       G+ PSNYV+ A
Sbjct: 9  KAIYNYEPQTPDELTIQEDDLLYLLEKSNVDDWWTVKKRVIGSDIDEPAGLVPSNYVEVA 68

>KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {ON}
           Anc_6.366 YCR088W
          Length = 575

 Score = 33.9 bits (76), Expect = 0.12,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYV 55
           A Y +D  +E +L     DKI  +E    +W+ G    NG  G+FPSNYV
Sbjct: 522 AEYDYDAGEENELTFVEKDKIINIEFVDDDWWLGELERNGEKGLFPSNYV 571

>Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W
           (REAL)
          Length = 586

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYV 55
           A Y +D  ++ +L     DKI  +E    +W+ G    +G  G+FPSNYV
Sbjct: 533 AEYDYDAAEDNELTFVENDKIVNIEFVDDDWWLGELEKDGSKGLFPSNYV 582

>CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa]
          {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
          YLR310c CDC25 GDP/GTP exchange factor for RAS1P and
          RAS2P
          Length = 1564

 Score = 33.9 bits (76), Expect = 0.13,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 6/49 (12%)

Query: 15 QQEGDLALHPGDKIEVLEKPSPEWFRG-----RCNGRV-GMFPSNYVKP 57
          ++E  L++ PGD + VL K    W+ G     + +  V G FP NY KP
Sbjct: 33 KKEKYLSMQPGDTVYVLAKDQSGWWDGLIIDEKSDKAVRGWFPQNYTKP 81

>CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088w ABP1
          Length = 580

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 5   FVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYV 55
           +  A Y ++  ++ +L     DKI  +E    +W+ G     G  G+FPSNYV
Sbjct: 523 WATAEYDYEAAEDNELTFEENDKIINIEFVDDDWWLGELEKTGEKGLFPSNYV 575

>Kwal_47.17481 s47 complement(421795..425544) [3750 bp, 1249 aa]
          {ON} YBL007C (SLA1) - contains 3 SH3 domains, interacts
          with Bee1p [contig 207] FULL
          Length = 1249

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 44/90 (48%), Gaps = 20/90 (22%)

Query: 7  EAIYRFDPQQEGDLALHPGDKIEVLEKPS-PEWF--RGRCNGR-----VGMFPSNYVKPA 58
          +A++++ PQ E +LA+   D + +L+K    +W+  + R  G      VG+ P+NY++ A
Sbjct: 9  KAVFQYTPQSEEELAIEEDDLLYLLQKSDVDDWWTVKKRVIGSDAEEPVGLVPNNYIEEA 68

Query: 59 FSGGFDRPAAPPPPQYDQKAMASQPSGGNA 88
                       P Y+ +A+   P   NA
Sbjct: 69 ------------QPLYEARALYDYPEVQNA 86

>NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON}
           Anc_2.159 YHR114W
          Length = 639

 Score = 33.9 bits (76), Expect = 0.14,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 4/69 (5%)

Query: 7   EAIYRFDPQQEGDLALHPGDKIEVLEKPSPE-W--FRGRCNGRVGMFPSNYVK-PAFSGG 62
           + +Y +  Q   ++ + P D I +L   S   W   +    G  G+ P+ Y+K    S  
Sbjct: 510 KVLYAYTKQDSDEITISPQDIITLLAADSGSGWTKIKNETTGESGLVPTTYIKIEESSHR 569

Query: 63  FDRPAAPPP 71
            + PAAPPP
Sbjct: 570 GNAPAAPPP 578

 Score = 31.6 bits (70), Expect = 0.72,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLE-KPSPEWFRGRCNGRVGMFPSNY 54
           A Y +  Q + +++++ GD I V+       W  G  NG  G+FP++Y
Sbjct: 590 AKYPYVAQGDDEMSINAGDTISVIRGDDGSGWTYGELNGVKGLFPTSY 637

>KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON}
          Anc_4.108 YBL007C
          Length = 1203

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 7  EAIYRFDPQQEGDLALHPGDKIEVLEKPS-PEWF--RGRCNGR-----VGMFPSNYVKPA 58
          +AIY ++PQ   +LAL   D + +LEK    +W+  + R  G       G+ PSNY++ A
Sbjct: 9  KAIYSYEPQTPEELALQEDDFLYLLEKSEVDDWWTVKKRVIGSDAEEPSGLVPSNYIETA 68

>KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON}
          Anc_7.413 YER114C
          Length = 904

 Score = 33.5 bits (75), Expect = 0.17,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 6/54 (11%)

Query: 9  IYRFDPQQEGDLALHPGDKIEVLEKPS---PEWFRGRCNGR---VGMFPSNYVK 56
          I R+  + E +L L PGD+IEVLE        W+ G+   R   VG+FP  + K
Sbjct: 25 INRYAKRMEDELDLVPGDRIEVLEADELYGDGWYTGKNLSRGSQVGLFPEVFTK 78

>TPHA0K01600 Chr11 (338182..341592) [3411 bp, 1136 aa] {ON}
          Anc_4.108 YBL007C
          Length = 1136

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 7  EAIYRFDPQQEGDLALHPGDKIEVLEKPS-PEWF--RGRCNGR-----VGMFPSNYVKPA 58
          +AIY ++PQ   +LA+   D + +LEK    +W+  + R  G       G+ PSNY++ A
Sbjct: 9  KAIYNYEPQTPEELAIQEDDLLYLLEKSDVDDWWTVKKRVIGSDAEEPSGLIPSNYIEEA 68

>Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar to
           Ashbya gossypii ACR266W
          Length = 672

 Score = 33.5 bits (75), Expect = 0.19,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPE-WFRGRCNGRVGMFPSNY 54
           V A+Y +  +   ++++  GD I+V+   +   W  G   G  G+FPSNY
Sbjct: 621 VIAVYDYAAKDFDEISIRAGDVIKVIRDDTGNGWTYGEVRGSRGLFPSNY 670

>KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {ON}
           Anc_6.366 YCR088W
          Length = 553

 Score = 33.5 bits (75), Expect = 0.20,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYV 55
           A Y ++  ++ +L     DKI  +E    +W+ G    NG  G+FPSNYV
Sbjct: 499 AEYDYEAGEDNELTFEENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 548

>TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}
           Anc_6.366 YCR088W
          Length = 576

 Score = 33.5 bits (75), Expect = 0.20,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 2   GGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRG--RCNGRVGMFPSNYVK 56
           GG    A Y ++  ++ +L  +  DKI  +E    +W+ G    +G  G+FPSNYV+
Sbjct: 517 GGATAIAQYDYEAAEDNELTFNENDKIINIEFVDDDWWLGELESSGEKGLFPSNYVE 573

>Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032W
           (REAL)
          Length = 663

 Score = 33.5 bits (75), Expect = 0.21,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 9/62 (14%)

Query: 4   EFVEAIYRFDPQQEGDLA-LHPGDKIEVLEKPSPEWFRGRC--------NGRVGMFPSNY 54
           E+ +A+Y     +   LA  H GD I + E  + +W++G          N RVG+ P N+
Sbjct: 596 EYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWYKGEVYDNDRINRNHRVGLIPYNF 655

Query: 55  VK 56
           ++
Sbjct: 656 IQ 657

>KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987)
           [1728 bp, 575 aa] {ON} similar to uniprot|P29366
           Saccharomyces cerevisiae YBR200W BEM1 Protein containing
           SH3-domains involved in establishing cell polarity and
           morphogenesis functions as a scaffold protein for
           complexes that include Cdc24p Ste5p Ste20p and Rsr1p
          Length = 575

 Score = 33.1 bits (74), Expect = 0.22,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGR--CNGRVGMFPSNY 54
           ++A+Y +  Q  G+L+ + GD   V ++ + +W+      +G+ GM P NY
Sbjct: 68  IKALYNYQAQSAGELSFNKGDFFHVQQEEN-DWYEASNPADGKRGMVPKNY 117

>YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}
           ABP1Actin-binding protein of the cortical actin
           cytoskeleton, important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization; phosphorylation within its PRR
           (Proline-Rich Region), mediated by Cdc28p and Pho85p,
           protects Abp1p from proteolysis mediated by its own PEST
           sequences
          Length = 592

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYV 55
           A Y +D  ++ +L     DKI  +E    +W+ G    +G  G+FPSNYV
Sbjct: 539 AEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 588

>Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]
           {ON} similar to Ashbya gossypii AEL241W  1-intron
          Length = 550

 Score = 33.1 bits (74), Expect = 0.23,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYVKP 57
           ++A+Y +  Q  G+L+   G+ + V+ +   EWF      +GR GM P +Y +P
Sbjct: 69  LKALYTYHAQSPGELSFTKGELVHVIGEDG-EWFEVSSPDSGRKGMVPKSYFEP 121

>TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {ON}
           Anc_8.539 YBR200W
          Length = 597

 Score = 33.1 bits (74), Expect = 0.24,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 9   IYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRV---GMFPSNYV 55
           +Y F+  +E +L ++ G+ + +      EWF GR  GR+   G+ P ++V
Sbjct: 169 LYDFEAAKEDELTVYAGETLFIYAHYEEEWFIGRPLGRIGGPGLVPISFV 218

>TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45
          Scer_YGOB_SDC25
          Length = 1618

 Score = 33.1 bits (74), Expect = 0.24,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 4/42 (9%)

Query: 20 LALHPGDKIEVLEKPSPEWFRG-RCNGRV---GMFPSNYVKP 57
          L  +PGDKI VL K    W+ G   +G+V   G FP ++VKP
Sbjct: 53 LRFNPGDKIYVLNKNDNGWWDGIVLHGKVVTRGWFPLHFVKP 94

>SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 aa]
           {ON} similar to uniprot|P29366 Saccharomyces cerevisiae
           YBR200W BEM1 Protein containing SH3-domains involved in
           establishing cell polarity and morphogenesis functions
           as a scaffold protein for complexes that include Cdc24p
           Ste5p Ste20p and Rsr1p
          Length = 555

 Score = 33.1 bits (74), Expect = 0.24,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 12/72 (16%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGR--CNGRVGMFPSNY------VKP 57
           ++A+Y +  Q  G+L+   GD   VL +   EW+      +G+ GM P +Y       +P
Sbjct: 71  IKAMYNYQAQSPGELSFVKGDFFHVLTEDR-EWYDASNPSDGKRGMVPKSYFEIFGRTRP 129

Query: 58  AF---SGGFDRP 66
                SG FD P
Sbjct: 130 GSVNGSGSFDSP 141

>Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON}
          (20451..23111) [2661 nt, 887 aa]
          Length = 886

 Score = 33.1 bits (74), Expect = 0.25,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 6  VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRG---RCNGRVGMFPSNYV 55
          V A Y +  Q +GDL    GD +EV +K + +WF G   R     G FP N+V
Sbjct: 10 VRARYGWSGQTKGDLGFLEGDVMEV-KKITGDWFYGTLLRNKKCSGYFPKNFV 61

>ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} similar
          to uniprot|Q07533 Saccharomyces cerevisiae YDL117W CYK3
          SH3-domain protein located in the mother-bud neck and
          the cytokinetic actin ring mutant phenotype and genetic
          interactions suggest a role in cytokinesis
          Length = 886

 Score = 32.7 bits (73), Expect = 0.32,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 4/53 (7%)

Query: 6  VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRV-GMFPSNYV 55
          V+A Y +  Q +GDL    GD +EV  + + +WF GR   N +  G FP+N+V
Sbjct: 14 VKARYGWSGQTKGDLGFLEGDVMEV-TRITGDWFYGRLLRNKKCSGYFPNNFV 65

>TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON}
           Anc_6.366 YCR088W
          Length = 558

 Score = 32.7 bits (73), Expect = 0.33,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYV 55
           A Y ++  +E +L  +  DKI  ++    +W+ G    NG  G+FPSNYV
Sbjct: 506 AEYDYEAAEENELTFNENDKIINIDFVDDDWWLGELERNGEKGLFPSNYV 555

>Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {ON}
           YBL007C (REAL)
          Length = 1214

 Score = 32.7 bits (73), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 10  YRFDPQQEGDLALHPGDKIEVLE-KPSPEWFRGRC--NGRVGMFPSNYVKPA 58
           Y F  + + +L +  GDK+ +L+ K S +W+  +   +G+ G+ P+ +++P 
Sbjct: 355 YNFMAESQDELTVKSGDKVYILDAKKSKDWWMCQLVDSGKSGLVPAQFIEPV 406

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 8/59 (13%)

Query: 8  AIYRFDPQQEGDLALHPGDKIEVLEKPS-PEWF--RGRCNGR-----VGMFPSNYVKPA 58
          AIY ++PQ   +LA+   D + +L K    +W+  + R  G      VG+ PS Y++ A
Sbjct: 10 AIYAYEPQTPEELAIEEDDLLYLLHKSDVDDWWTVKKRVIGSDSEEPVGLVPSTYIEEA 68

>NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON}
          Anc_2.319 YDL117W
          Length = 919

 Score = 32.7 bits (73), Expect = 0.36,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 6  VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRG---RCNGRVGMFPSNYV 55
          V A Y +  Q +GDL    GD +EV  + + +WF G   R     G FP+N+V
Sbjct: 15 VRAKYGWSGQAKGDLGFLEGDIMEV-TRVAGDWFYGKLLRNRKCAGYFPNNFV 66

>KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON}
           uniprot|Q9P863 Kluyveromyces lactis sho1 Putative
           membrane protein
          Length = 357

 Score = 32.3 bits (72), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 7   EAIYRFDPQQEG--DLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVK 56
           EA+Y +   Q    +++   G+ + V +     W   + NG  G+ PSNYVK
Sbjct: 299 EALYTYQADQTDAYEISFEQGEILRVGDIEGRWWKAKKSNGETGIIPSNYVK 350

>Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032W
           (REAL)
          Length = 668

 Score = 32.7 bits (73), Expect = 0.38,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 9/62 (14%)

Query: 4   EFVEAIYRFDPQQEGDLA-LHPGDKIEVLEKPSPEWFRGRC--------NGRVGMFPSNY 54
           E+ +A+Y     +   LA  H GD I + E  + +WF+G          + RVG+ P N+
Sbjct: 601 EYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWFKGEVYNNDRIERDHRVGLIPYNF 660

Query: 55  VK 56
           ++
Sbjct: 661 IQ 662

>ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {ON}
           similar to uniprot|P40073 Saccharomyces cerevisiae
           YER118C SHO1 Transmembrane osmosensor participates in
           activation of both the Cdc42p- and MAP kinase-dependent
           filamentous growth pathway and the high-osmolarity
           glycerol response pathway
          Length = 371

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 7   EAIYRF--DPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVK 56
           + +YR+  D     +++   G+ ++V +     W   R  G  G+ PSNYVK
Sbjct: 312 QTLYRYQADEDDAYEISFEQGEILKVSDIEGRWWKAKRSTGETGIIPSNYVK 363

>YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON}
           SLA1Cytoskeletal protein binding protein required for
           assembly of the cortical actin cytoskeleton; interacts
           with proteins regulating actin dynamics and proteins
           required for endocytosis; found in the nucleus and cell
           cortex; has 3 SH3 domains
          Length = 1244

 Score = 32.3 bits (72), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 10  YRFDPQQEGDLALHPGDKIEVL-EKPSPEWFRGRC--NGRVGMFPSNYVKPA 58
           Y F  + + +L +  GDK+ +L +K S +W+  +   +G+ G+ P+ +++P 
Sbjct: 362 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLVDSGKSGLVPAQFIEPV 413

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 8/59 (13%)

Query: 8  AIYRFDPQQEGDLALHPGDKIEVLEKPS-PEWF--RGRCNGR-----VGMFPSNYVKPA 58
          A+Y ++PQ   +LA+   D + +L+K    +W+  + R  G      VG+ PS Y++ A
Sbjct: 10 AVYAYEPQTPEELAIQEDDLLYLLQKSDIDDWWTVKKRVIGSDSEEPVGLVPSTYIEEA 68

>KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa]
          {ON} Anc_7.413 YER114C
          Length = 930

 Score = 32.3 bits (72), Expect = 0.45,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 5/65 (7%)

Query: 8  AIYRFDPQQEGDLALHPGDKIEVL---EKPSPEWFRGRC--NGRVGMFPSNYVKPAFSGG 62
          A+  +  + E ++++ PGDKI+V+   E  +  W+ GR    G+ G+FP  + +      
Sbjct: 33 AVSAYTKRMEDEISIKPGDKIQVITDDEDYNDGWYVGRNLRTGKEGLFPKIFTQKLDIDA 92

Query: 63 FDRPA 67
           D P+
Sbjct: 93 QDSPS 97

>Smik_4.119 Chr4 (225256..227919) [2664 bp, 887 aa] {ON} YDL117W
          (REAL)
          Length = 887

 Score = 32.3 bits (72), Expect = 0.49,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 6  VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRV-GMFPSNYV 55
          V+A Y +  Q +GDL    GD +EV  + +  WF GR   N +  G FP N+V
Sbjct: 14 VKARYGWSGQTKGDLGFLEGDIMEV-TRIAGSWFYGRLLRNKKCSGYFPHNFV 65

>NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.419
           YER118C
          Length = 367

 Score = 32.0 bits (71), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 6   VEAIYRF--DPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVK 56
           V+A+Y +  D     +++   G+ ++V +     W   R NG+ G+ PSNYV+
Sbjct: 311 VKALYSYQADDADAYEISFDQGEILKVSDIEGRWWKAKRENGQTGIIPSNYVE 363

>SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some
           similarities with uniprot|Q12163 Saccharomyces
           cerevisiae YDR162C NBP2 Protein involved in the HOG
           (high osmolarity glycerol) pathway negatively regulates
           Hog1p by recruitment of phosphatase Ptc1p the
           Pbs2p-Hog1p complex found in the nucleus and cytoplasm
           contains an SH3 domain that binds Pbs2p
          Length = 207

 Score = 31.6 bits (70), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGR--VGMFPSNYV 55
           AIY F P+ + +LAL  GD + +  K    W       R   G+ P  YV
Sbjct: 95  AIYDFIPENDNELALKEGDVVYISYKHGQGWLVAENEERTKTGLVPEEYV 144

>KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {ON}
           Anc_7.419 YER118C
          Length = 332

 Score = 32.0 bits (71), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 24/47 (51%)

Query: 10  YRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVK 56
           Y+ D   + +++   G+ + V +     W   R NG  G+ PSNYV+
Sbjct: 278 YQADESDQYEISFEQGEILRVSDIEGRWWKAKRENGETGIIPSNYVQ 324

>Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}
          similar to Ashbya gossypii ADL288C
          Length = 906

 Score = 32.0 bits (71), Expect = 0.63,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 6  VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYVK 56
          V A+Y +  +Q  DL     D IEV  K   +W  GR   N + G FP  YV+
Sbjct: 12 VRALYSWSGEQGQDLGFLESDLIEV-TKVKGDWLYGRLLRNKKTGYFPLGYVQ 63

>Suva_4.129 Chr4 (237039..239702) [2664 bp, 887 aa] {ON} YDL117W
          (REAL)
          Length = 887

 Score = 32.0 bits (71), Expect = 0.64,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 6  VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRV-GMFPSNYV 55
          V+A Y +  Q +GDL    GD +EV  + +  WF GR   N +  G FP N+V
Sbjct: 14 VKARYGWSGQTKGDLGFLEGDIMEV-TRIAGSWFYGRLLRNKKCSGYFPHNFV 65

>TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON}
          Anc_2.319 YDL117W
          Length = 850

 Score = 32.0 bits (71), Expect = 0.64,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 6  VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRG---RCNGRVGMFPSNYV 55
          V+A Y +  Q +GDL    GD +EV  + + +WF G   R     G FP+N+V
Sbjct: 13 VKARYGWSGQTKGDLGFLEGDVMEV-TRITGDWFYGKLLRNKKCSGYFPNNFV 64

>KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.419
           YER118C
          Length = 342

 Score = 31.6 bits (70), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 7   EAIYRFD--PQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVK 56
           +A+Y +D     + +++   G+ ++V +     W   R NG  G+ PSNYV+
Sbjct: 287 KALYSYDADSNDQYEVSFEQGEILKVSDIEGRWWKARRANGETGIIPSNYVE 338

>YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud
           neck-localized, SH3 domain-containing protein required
           for cytokinesis; regulates actomyosin ring dynamics and
           septin localization; interacts with the formins, Bni1p
           and Bnr1p, and with Cyk3p, Vrp1p, and Bni5p
          Length = 669

 Score = 32.0 bits (71), Expect = 0.68,   Method: Composition-based stats.
 Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 9/62 (14%)

Query: 4   EFVEAIYRFDPQQEGDLA-LHPGDKIEVLEKPSPEWFRGRC--------NGRVGMFPSNY 54
           E+ +A+Y     +   LA  H GD + + E  + +W++G          N R+G+ P N+
Sbjct: 602 EYAKAMYPLIGNEAPGLANFHKGDYLLITEIVNKDWYKGEVYDNDRIDRNHRIGLIPYNF 661

Query: 55  VK 56
           ++
Sbjct: 662 IQ 663

>Skud_4.137 Chr4 (244217..246880) [2664 bp, 887 aa] {ON} YDL117W
          (REAL)
          Length = 887

 Score = 32.0 bits (71), Expect = 0.70,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 6  VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRV-GMFPSNYV 55
          V+A Y +  Q +GDL    GD +EV  + +  WF GR   N +  G FP N+V
Sbjct: 14 VKARYGWSGQTKGDLGFLEGDIMEV-TRIAGSWFYGRLLRNKKCSGYFPHNFV 65

>Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 31.6 bits (70), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 7   EAIYRFDPQQEG--DLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVK 56
           +A+Y +D   E   +++    + ++V +     W   R NG  G+ PSNYV+
Sbjct: 307 KALYPYDADDEDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 358

>Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W
           (REAL)
          Length = 591

 Score = 31.6 bits (70), Expect = 0.72,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYV 55
           A Y +D  ++ +L     DKI  +E    +W+ G    +G  G+FPSNYV
Sbjct: 538 AEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 587

>KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa]
          {ON} similar to uniprot|Q07533 Saccharomyces cerevisiae
          YDL117W CYK3 SH3-domain protein located in the
          mother-bud neck and the cytokinetic actin ring mutant
          phenotype and genetic interactions suggest a role in
          cytokinesis
          Length = 814

 Score = 31.6 bits (70), Expect = 0.74,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 6  VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYV 55
          V+  + +  +++ DL    GD IEV  + + +W+ G+   N + G FPSNYV
Sbjct: 11 VKTNFAWSGEKKDDLGFLEGDFIEV-TRVTGDWYFGKLIRNKKQGYFPSNYV 61

>NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON}
          Anc_7.413 YBL085W
          Length = 1047

 Score = 31.6 bits (70), Expect = 0.75,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 5/48 (10%)

Query: 9  IYRFDPQQEGDLALHPGDKIEVL---EKPSPEWFRGRC--NGRVGMFP 51
          I  +  + E +L + PGDKIEVL   E+ +  W+ GR    G  G++P
Sbjct: 47 INEYSKRMEDELDMRPGDKIEVLTDDEEYNDGWYFGRNLRTGEEGLYP 94

>TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7.419
           YER118C
          Length = 355

 Score = 31.6 bits (70), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 26/47 (55%)

Query: 10  YRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVK 56
           Y+ D     +++   G+ ++V +     W   R NG+VG+ PSNYV+
Sbjct: 305 YQADDADGYEISFEQGEILKVSDIEGRWWKSKRENGQVGIIPSNYVQ 351

>AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER118C
           (SHO1)
          Length = 330

 Score = 31.6 bits (70), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 13/76 (17%)

Query: 1   MGGEFV------EAIYRF--DPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPS 52
           MG E V      +A+Y +  D     +++   G+ + V +     W   + NG  G+ PS
Sbjct: 259 MGDELVNFPYTAKALYAYEADASDAYEISFQQGEILRVGDIEGRWWKAKKANGETGIIPS 318

Query: 53  NYVKPAFSGGFDRPAA 68
           NYV+       D PAA
Sbjct: 319 NYVELV-----DDPAA 329

>TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON}
          Anc_2.319 YDL117W
          Length = 824

 Score = 31.6 bits (70), Expect = 0.86,   Method: Composition-based stats.
 Identities = 29/92 (31%), Positives = 40/92 (43%), Gaps = 18/92 (19%)

Query: 6  VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRG---RCNGRVGMFPSNYV------- 55
          V+A Y +  Q +GDL    GD + V  K + +W+ G   R     G FP N+V       
Sbjct: 7  VKARYGWSGQAKGDLGFLEGDIMNV-TKTTGDWYYGFLLRNKKSKGYFPKNFVIELNGKT 65

Query: 56 KP---AFSGGFDRPAAPPPPQYDQKAMASQPS 84
          KP   A +     P  P   +Y+    ASQ S
Sbjct: 66 KPSVEAITADAKLPNIPSRSKYE----ASQSS 93

>Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118C
           (SHO1) - Transmembrane osmosensor [contig 33] FULL
          Length = 343

 Score = 31.2 bits (69), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 5   FVEAIYRF--DPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVK 56
             +A+Y +  D     +++   G+ + V +     W   R NG  G+ PSNYV+
Sbjct: 283 LAKALYTYTADSNDAYEVSFEQGETLRVGDIEGRWWKAKRANGETGIIPSNYVE 336

>KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1251

 Score = 31.6 bits (70), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 39/83 (46%), Gaps = 4/83 (4%)

Query: 1   MGGEFVEAIYRFDPQQEGDLALHPGDKIEVL-EKPSPEWFRGRC--NGRVGMFPSNYVKP 57
           M  +  +A+Y F      +L +  GD I +L ++ S +W+       G+ G+ P+ +V+ 
Sbjct: 410 MTKKRAKAVYDFFANSPDELTVKEGDYINILDDRTSKDWYMCESVETGKRGIVPAQFVET 469

Query: 58  AFSGGFDRPAAPPPPQYDQKAMA 80
             SG   RP+   P +   K  +
Sbjct: 470 RGSGS-SRPSDESPSRSKSKTRS 491

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 8/60 (13%)

Query: 7  EAIYRFDPQQEGDLALHPGDKIEVLEKPS-PEWF--RGRCNGR-----VGMFPSNYVKPA 58
          +A+Y +  Q + +L +  GD + +LEK S  +W+  + R  G      VG+ P  Y++ A
Sbjct: 9  QALYDYSAQTDEELTVKEGDLLYLLEKSSIDDWWTVKKRVIGSDQDEPVGLVPKTYIEEA 68

>TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.366
           YCR088W
          Length = 528

 Score = 31.6 bits (70), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGR--CNGRVGMFPSNYV 55
           A Y +D  ++ +L    G KI  +E    +W+ G     G  G+FP+NYV
Sbjct: 475 AEYDYDAAEDNELTFVEGTKIINIEFVDDDWWLGENGTTGEKGLFPANYV 524

>KLTH0D08580g Chr4 (719409..721211) [1803 bp, 600 aa] {ON} similar
           to uniprot|Q05080 Saccharomyces cerevisiae YMR032W HOF1
           Bud neck-localized SH3 domain- containing protein
           required for cytokinesis
          Length = 600

 Score = 31.2 bits (69), Expect = 0.99,   Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 9/61 (14%)

Query: 5   FVEAIYRF-DPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--------NGRVGMFPSNYV 55
           + +A+Y F +P ++  +  H GD + + E+   +WF G            R G+ P NY+
Sbjct: 537 YAKALYTFMEPNEQQIVNFHVGDYLLLTEQLDQDWFIGEVLDSQNVDPEYRYGIIPRNYI 596

Query: 56  K 56
           +
Sbjct: 597 E 597

>Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W
           (REAL)
          Length = 600

 Score = 31.2 bits (69), Expect = 0.99,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYV 55
           A Y +D  ++ +L     DKI  +E    +W+ G    +G  G+FPSNYV
Sbjct: 547 AEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 596

>AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YER114C
          (BOI2) and YBL085W (BOI1)
          Length = 984

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 8  AIYRFDPQQEGDLALHPGDKIEVL---EKPSPEWFRGRC--NGRVGMFPSNYVK 56
          AI  +  + E +L + PGDKIEV+   ++ +  W+ GR    G  G++P  + +
Sbjct: 34 AINEYSKRMEDELDMKPGDKIEVITDDQEYNDGWYFGRNLRTGEEGLYPKLFTQ 87

>KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 227

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 4/68 (5%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGR--VGMFPSNYVKPAFSGGFD- 64
           A+Y F P+ + +L L  GD + +  K    W     + R   G+ P  YV+     G D 
Sbjct: 67  AMYAFVPENDNELELKEGDVVYISYKHGQGWLVAENHDRSKTGLVPEEYVQLIEDDGEDN 126

Query: 65  -RPAAPPP 71
            R   P P
Sbjct: 127 GRYENPRP 134

>TDEL0C02730 Chr3 complement(479746..482796) [3051 bp, 1016 aa]
          {ON} Anc_7.413 YER114C
          Length = 1016

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 7/50 (14%)

Query: 8  AIYRFDPQQEGDLALHPGDKIEVL---EKPSPEWFRGRCNGRV---GMFP 51
          AI  +  + E +L + PGDKI+V+   E+ +  WF GR N R    G++P
Sbjct: 45 AINEYTKRMEDELDMKPGDKIQVITTDEEYNDGWFYGR-NLRTKEEGLYP 93

>KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} similar
           to uniprot|P40073 Saccharomyces cerevisiae YER118C SHO1
           Transmembrane osmosensor participates in activation of
           both the Cdc42p- and MAP kinase-dependent filamentous
           growth pathway and the high- osmolarity glycerol
           response pathway
          Length = 342

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 22/47 (46%)

Query: 10  YRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVK 56
           Y  D     +++   G+ + V +     W   R NG  G+ PSNYV+
Sbjct: 289 YTADSNDAYEVSFEQGEMLRVGDIEGRWWKAKRANGETGIIPSNYVE 335

>KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 626

 Score = 30.8 bits (68), Expect = 1.3,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYVK 56
           A Y  + ++  +LA   GDKI  +     +W+ G     G  G+FPSNYV+
Sbjct: 573 AEYDNEAEEHNELAFEEGDKIINISFVDDDWWLGELEKTGEKGLFPSNYVQ 623

>Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR088W
           (ABP1) - 1:1 [contig 17] FULL
          Length = 631

 Score = 30.8 bits (68), Expect = 1.3,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 4/59 (6%)

Query: 2   GGEFVEAIYRFDPQQE--GDLALHPGDKIEVLEKPSPEWFRGRC--NGRVGMFPSNYVK 56
           G +   AI  +D + E   +LA   GDKI  +     +W+ G     G  G+FPSNYV+
Sbjct: 570 GEQLHSAIAEYDNEAEEHNELAFKEGDKIVNIVFVDDDWWLGELEKTGEKGLFPSNYVQ 628

>TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {ON}
           Anc_7.419 YER118C
          Length = 337

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 24/47 (51%)

Query: 10  YRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVK 56
           Y+ D     +++   G+ ++V +     W   R NG  G+ PSNYV+
Sbjct: 284 YQADAGDAYEISFDQGEILKVSDIEGRWWKAKRANGETGIIPSNYVQ 330

>NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {ON}
           Anc_6.366 YCR088W
          Length = 594

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGR--CNGRVGMFPSNYV 55
           A Y ++  ++ +L     DKI  +E    +W+ G    +G  G+FPSNYV
Sbjct: 541 AEYDYEAGEDNELTFSENDKIINIEFVDDDWWLGELESSGEKGLFPSNYV 590

>Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to
           Ashbya gossypii AGL286C
          Length = 332

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 22/47 (46%)

Query: 10  YRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVK 56
           Y  D     +++   G+ + V +     W   R NG  G+ PSNYV+
Sbjct: 278 YEADESDAYEISFQQGEILRVGDIEGRWWKAKRSNGETGIIPSNYVE 324

>Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W
          (REAL)
          Length = 982

 Score = 30.8 bits (68), Expect = 1.4,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 7/55 (12%)

Query: 8  AIYRFDPQQEGDLALHPGDKIEVLE---KPSPEWFRGRCNGRV---GMFPSNYVK 56
          A+  +  + E +L++ PGDKIEV+    + +  W+ GR N R    G++P+ + K
Sbjct: 20 AVNEYSKRMEDELSMKPGDKIEVITDDGEYNDGWYYGR-NLRTKEEGLYPAVFTK 73

>YDL117W Chr4 (248581..251238) [2658 bp, 885 aa] {ON}
          CYK3SH3-domain protein located in the mother-bud neck
          and the cytokinetic actin ring; mutant phenotype and
          genetic interactions suggest a role in cytokinesis
          Length = 885

 Score = 30.4 bits (67), Expect = 2.1,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 6  VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRG---RCNGRVGMFPSNYV 55
          V+A Y +  Q +GDL    GD +EV  + +  WF G   R     G FP N+V
Sbjct: 14 VKARYGWSGQTKGDLGFLEGDIMEV-TRIAGSWFYGKLLRNKKCSGYFPHNFV 65

>TBLA0E01560 Chr5 (365693..369877) [4185 bp, 1394 aa] {ON}
          Anc_4.45 Scer_YGOB_SDC25
          Length = 1394

 Score = 30.4 bits (67), Expect = 2.1,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 28/72 (38%), Gaps = 18/72 (25%)

Query: 4  EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWF------RGRCNGRV---------- 47
          + V  I+ F P     L L  G  I V+EK S  W+       G  +G            
Sbjct: 10 DIVVVIHNFTPTSSNMLPLQSGSIIYVIEKNSNGWWDGVQLVAGTQSGSFSPKSGSTQKI 69

Query: 48 --GMFPSNYVKP 57
            G FP+NY KP
Sbjct: 70 IRGWFPANYTKP 81

>CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} similar
          to uniprot|P38041 Saccharomyces cerevisiae YBL085w BOB1
          BEM1 protein-binding protein or uniprot|P39969
          Saccharomyces cerevisiae YER114c BOI2
          Length = 999

 Score = 30.0 bits (66), Expect = 2.6,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 5/48 (10%)

Query: 15 QQEGDLALHPGDKIEVLEKPSPE---WFRGRC--NGRVGMFPSNYVKP 57
          + E ++ + PGDKIEVL         W++G+     +VG++P+ + +P
Sbjct: 14 RMEDEIDMKPGDKIEVLMDDGEYKDGWYQGKNLRTAQVGLYPAVFTQP 61

>Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032W
           (REAL)
          Length = 669

 Score = 30.0 bits (66), Expect = 2.7,   Method: Composition-based stats.
 Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 9/62 (14%)

Query: 4   EFVEAIYRFDPQQEGDLA-LHPGDKIEVLEKPSPEWFRGRC--------NGRVGMFPSNY 54
           E+ +A+Y     +   LA  H GD + + E  + +W++G          + RVG+ P N+
Sbjct: 602 EYAKAMYPLVGNEAPGLANFHKGDYMLITEIVNKDWYKGEVYDNDRIDRDHRVGLIPYNF 661

Query: 55  VK 56
           ++
Sbjct: 662 IQ 663

>KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {ON}
           Anc_2.159 YHR114W
          Length = 602

 Score = 30.0 bits (66), Expect = 2.7,   Method: Composition-based stats.
 Identities = 13/52 (25%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLE-KPSPEWFRGRCNGRVGMFPSNYVK 56
           +E ++ +  Q + +++++ GD + V++      W  G  NG  G+ P++Y K
Sbjct: 551 LEVVFDYVAQGDDEISINVGDVVTVIKGDDGSGWTYGELNGLKGLVPTSYCK 602

>NCAS0A05970 Chr1 complement(1177678..1181649) [3972 bp, 1323 aa]
           {ON} Anc_4.45
          Length = 1323

 Score = 30.0 bits (66), Expect = 2.8,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 7/59 (11%)

Query: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRG-------RCNGRVGMFPSNYV 55
           + V  +Y F P     L L   + + VL KP+  W+ G       +   + G FP  +V
Sbjct: 61  DIVRVVYDFTPSSSDQLQLRQNEIVYVLNKPNTGWWDGITISESPQQQIKRGWFPQTFV 119

>Kpol_457.12 s457 complement(23020..24723) [1704 bp, 567 aa] {ON}
           complement(23020..24723) [1704 nt, 568 aa]
          Length = 567

 Score = 30.0 bits (66), Expect = 2.9,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query: 9   IYRFDPQQEGDLALHPGDKIEVLEKPSPEWF---RGRCNGRVGMFPSNYV 55
           +Y F P++  +L  + GDKI +    + EWF       +G+  + P ++V
Sbjct: 170 LYDFKPERPDELEANAGDKITIYAHHNDEWFIASHTDSSGKPYLIPIDFV 219

>Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W
          (REAL)
          Length = 985

 Score = 30.0 bits (66), Expect = 2.9,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 7/55 (12%)

Query: 8  AIYRFDPQQEGDLALHPGDKIEVLE---KPSPEWFRGRCNGRV---GMFPSNYVK 56
          A+  +  + E +L + PGDKIEV+    + +  W+ GR N R    G++P+ + K
Sbjct: 20 AVNEYSKRMEDELNMRPGDKIEVITDDGEYNDGWYYGR-NLRTKEEGLYPAVFTK 73

>Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 29.6 bits (65), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 6/54 (11%)

Query: 7   EAIYRFDPQQEGDLALHPG-DKIEVLEKPSPE---WFRGRCNGRVGMFPSNYVK 56
           +A+Y +D   +GD A     ++ E+L+    E   W   R NG  G+ PSNYV+
Sbjct: 307 KALYPYDA--DGDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 358

>NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.344
           YDR162C
          Length = 245

 Score = 29.6 bits (65), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 26/63 (41%), Gaps = 2/63 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGR--VGMFPSNYVKPAFSGGFDR 65
           A+Y F+P+ + +L L   D + +  K    W       R   G+ P  YV    SG  D 
Sbjct: 111 ALYDFEPENDNELGLKENDIVFISYKHGQGWLVAENEKRTQTGLVPEEYVSYLESGEEDV 170

Query: 66  PAA 68
            A 
Sbjct: 171 AAT 173

>AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR088W
           (ABP1)
          Length = 578

 Score = 29.6 bits (65), Expect = 3.2,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCN--GRVGMFPSNYVK 56
           A Y ++  ++ +L    GD I  ++    +W+ G     G+ G+FPSNYV+
Sbjct: 525 AEYDYEAGEDNELTFEEGDVIVNIDFVDDDWWLGELQKTGQKGLFPSNYVE 575

>KAFR0B05860 Chr2 complement(1210822..1211571) [750 bp, 249 aa] {ON}
           Anc_8.344 YDR162C
          Length = 249

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 28/62 (45%), Gaps = 2/62 (3%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGR--VGMFPSNYVKPAFSGGFDR 65
           A+Y F+P+ + +L LH GD + +  +    W       R   G+ P  +V    +   D+
Sbjct: 117 ALYDFEPENDNELGLHEGDIVFISYRHGQGWLVAENQPRTKTGLVPEEFVSFLDNDEEDK 176

Query: 66  PA 67
            A
Sbjct: 177 EA 178

>TPHA0K00720 Chr11 (147285..150320) [3036 bp, 1011 aa] {ON}
           Anc_7.413 YER114C
          Length = 1011

 Score = 29.6 bits (65), Expect = 3.6,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 7/55 (12%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVL---EKPSPEWFRGRCNGRV---GMFPSNYVK 56
           AI  +  + E +L   PGDKI+VL   E+ +  W+ GR N R    G++P+ + +
Sbjct: 80  AINEYSKRMEDELDFRPGDKIQVLLDDEEYNDGWYFGR-NLRTQEEGLYPAVFTQ 133

>Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to
           Ashbya gossypii AGL169C
          Length = 261

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 6   VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGR-CNG-RVGMFPSNYV 55
           V A+Y F P+ + +L L  GD I +  K    W      +G R G+ P  YV
Sbjct: 119 VVALYDFVPENDNELELKEGDVIYISYKHGQGWLVAENIDGTRTGLVPEEYV 170

>TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.344
           YDR162C
          Length = 224

 Score = 28.9 bits (63), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWF--RGRCNGRVGMFPSNYV 55
           A+Y F P+ + +L L  GD I +  K    W   +   N ++G+ P  +V
Sbjct: 105 ALYDFVPENDNELQLVEGDIIFINYKHGQGWLVAQNLNNNKIGLVPEEFV 154

>TBLA0I01050 Chr9 (210595..211710) [1116 bp, 371 aa] {ON} Anc_7.419
           YER118C
          Length = 371

 Score = 29.3 bits (64), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 23/47 (48%)

Query: 10  YRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVK 56
           Y+ +     +++    + +EV +     W   R NG  G+ PSNYV+
Sbjct: 322 YKANENDAYEISFEQNELLEVSDIEGRWWKARRENGTTGIIPSNYVE 368

>NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON}
           Anc_2.159 YHR114W
          Length = 632

 Score = 29.3 bits (64), Expect = 5.1,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 1   MGGEFVEAIYRFDPQQEGDLALHPGDKIEVLE-KPSPEWFRGRCNGRVGMFPSNYVK 56
           M    + A Y +    + +++++ GD I V+       W  G  NG  G+ P++Y K
Sbjct: 576 MPSRTLTAAYSYSAAGDDEISINVGDVITVIRGDDGSGWTYGELNGSKGLVPTSYCK 632

>Kpol_1024.45 s1024 (120171..121835) [1665 bp, 554 aa] {ON}
           (120171..121835) [1665 nt, 555 aa]
          Length = 554

 Score = 29.3 bits (64), Expect = 5.3,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 1   MGGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRV---GMFPSNYV 55
           MG  +   +Y F  ++  +L ++ G+ + +    + EWF  +  GR+   G+ P ++V
Sbjct: 152 MGSLYAIVLYDFQAEKSDELTVYVGENLFICAHHNYEWFIAKPIGRLGGPGLVPVDFV 209

>CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar to
           uniprot|Q12163 Saccharomyces cerevisiae YDR162c NBP2
           NAP1P-binding protein
          Length = 213

 Score = 28.5 bits (62), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWF--RGRCNGRVGMFPSNYV 55
           A+Y F+P+ + +L L  GD I +  +    W   +     + G+ P  +V
Sbjct: 101 ALYDFEPENDNELGLKEGDVIFISYRHCQGWLVAQNDTQTKTGLVPEEFV 150

>KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON}
          similar to uniprot|P04821 Saccharomyces cerevisiae
          YLR310C CDC25 Membrane bound guanine nucleotide
          exchange factor (GEF or GDP-release factor) indirectly
          regulates adenylate cyclase through activation of Ras1p
          and Ras2p by stimulating the exchange of GDP for GTP
          required for progression through G1
          Length = 1537

 Score = 28.9 bits (63), Expect = 6.3,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 5/58 (8%)

Query: 4  EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRG-----RCNGRVGMFPSNYVK 56
          + V A Y F+P ++  L    GD I V+ K    W+ G     +     G FP +Y K
Sbjct: 24 DIVIAQYDFNPLRKSQLRFFAGDIIYVISKSDSGWWDGILYYNKSLVLRGWFPRSYTK 81

>ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 288

 Score = 28.9 bits (63), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 29/73 (39%), Gaps = 11/73 (15%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGR--VGMFPSNYVKPA------- 58
           A+Y F+P+ + +L L  GD + +  +    W       R   G+ P  +V  A       
Sbjct: 133 ALYDFEPENDNELELQEGDVVFISYRHGQGWLVAENQNRTKTGLVPEEFVTYANEDDENW 192

Query: 59  --FSGGFDRPAAP 69
             +  GF   A P
Sbjct: 193 AEYEEGFQDTARP 205

>Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON}
           complement(1407..2084) [678 nt, 226 aa]
          Length = 225

 Score = 28.5 bits (62), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGR--VGMFPSNYV 55
           A+Y F P+ + +L L  GD + +  K    W      GR   G+ P  +V
Sbjct: 107 ALYDFVPENDSELGLEEGDIVFISYKHGQGWLVAENQGRTKTGLVPEEFV 156

>Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}
           YDR162C (REAL)
          Length = 240

 Score = 28.5 bits (62), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGR--VGMFPSNYV 55
           A+Y F+P+ + +L L  GD + +  K    W       R   G+ P  +V
Sbjct: 117 ALYDFEPENDNELKLTEGDLVFISYKHGQGWLVAENESRSKTGLVPEEFV 166

>NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON}
          Anc_5.170
          Length = 939

 Score = 28.9 bits (63), Expect = 6.9,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 6  VEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVK 56
          V+A + +  + E DL       I V      EW+ G    + G+FP ++VK
Sbjct: 10 VQAQFPYKSEYEDDLNFGKDQIITVTNVEDDEWYYGEYADKEGIFPKSFVK 60

>Ecym_7141 Chr7 (283803..286892) [3090 bp, 1029 aa] {ON} similar to
           Ashbya gossypii AGL293C
          Length = 1029

 Score = 28.5 bits (62), Expect = 8.1,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVL---EKPSPEWFRGRC--NGRVGMFPSNYVK 56
           AI  +  + E +L + PGDKIE +   ++ +  W+ GR    G  G++P  + +
Sbjct: 56  AINEYSKRMEDELDMKPGDKIEAITDDQEYNDGWYYGRNLRTGEEGLYPKLFTQ 109

>Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}
           YDR162C (REAL)
          Length = 233

 Score = 28.1 bits (61), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 8   AIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGR--VGMFPSNYV 55
           A+Y F+P+ + +L L  GD + +  K    W       R   G+ P  +V
Sbjct: 117 ALYDFEPENDNELKLTEGDIVFISYKHGQGWLVAENESRSKTGLVPEEFV 166

>YBL085W Chr2 (63876..66818) [2943 bp, 980 aa] {ON}  BOI1Protein
          implicated in polar growth, functionally redundant with
          Boi2p; interacts with bud-emergence protein Bem1p;
          contains an SH3 (src homology 3) domain and a PH
          (pleckstrin homology) domain
          Length = 980

 Score = 28.5 bits (62), Expect = 8.7,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 7/55 (12%)

Query: 8  AIYRFDPQQEGDLALHPGDKIEVLE---KPSPEWFRGRCNGRV---GMFPSNYVK 56
          A+ ++  + E +L + PGDKI+V+    + +  W+ GR N R    G++P+ + K
Sbjct: 20 AVNQYSKRMEDELNMKPGDKIKVITDDGEYNDGWYYGR-NLRTKEEGLYPAVFTK 73

>NCAS0B02220 Chr2 (363992..365656) [1665 bp, 554 aa] {ON} Anc_8.539
          Length = 554

 Score = 28.5 bits (62), Expect = 8.8,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query: 1   MGGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRV---GMFPSNYV 55
           MG  +   +Y F  ++  +L  + G+ + +    + EWF  +  GR+   G+ P  +V
Sbjct: 155 MGSLYAIVLYDFKAEKSDELTAYAGENLFICAHHNYEWFIAKPIGRLGGPGLVPVGFV 212

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.140    0.448 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,553,424
Number of extensions: 522146
Number of successful extensions: 1754
Number of sequences better than 10.0: 261
Number of HSP's gapped: 1656
Number of HSP's successfully gapped: 320
Length of query: 158
Length of database: 53,481,399
Length adjustment: 100
Effective length of query: 58
Effective length of database: 42,014,799
Effective search space: 2436858342
Effective search space used: 2436858342
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)