Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D06908g8.273ON77773856e-50
Smik_4.3648.273ON65681225e-10
Skud_4.3808.273ON66681191e-09
YDR119W-A (COX26)8.273ON66681192e-09
Suva_2.2808.273ON66681149e-09
KLLA0F19371g8.273ON8063983e-06
SAKL0H16786g8.273ON7471958e-06
TPHA0A017408.273ON7963941e-05
Kwal_YGOB_YDR119W-A8.273ON7466887e-05
TBLA0F030308.273ON7565889e-05
TDEL0F040008.273ON6267826e-04
Kpol_YGOB_YDR119W-A8.273ON7559780.003
CAGL0B01875g8.273ON7462760.006
NDAI0J012908.273ON7571680.070
KLTH0G13442g8.273ON7470650.23
KLLA0F19382gsingletonON7566640.30
Ecym_42978.273ON7464601.1
NOTE: 4 genes in the same pillar as ZYRO0D06908g were not hit in these BLAST results
LIST: KAFR0B05440 NCAS0B03770 KAFR0B02760 KNAG0H03170

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D06908g
         (77 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON...   152   6e-50
Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A ...    52   5e-10
Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A ...    50   1e-09
YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}  COX26Putat...    50   2e-09
Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A ...    49   9e-09
KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some s...    42   3e-06
SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa] {...    41   8e-06
TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}...    41   1e-05
Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74 a...    39   7e-05
TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}...    39   9e-05
TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273...    36   6e-04
Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON} A...    35   0.003
CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar ...    34   0.006
NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.27...    31   0.070
KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa] {...    30   0.23 
KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some s...    29   0.30 
Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON} s...    28   1.1  

>ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON}
          similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A
          Length = 77

 Score =  152 bits (385), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%)

Query: 1  MFFTQVLRNSAVSATKQAAKQISKSSAGEQWGLLEARRLSRGAVEWAVSLSLILAWPAAI 60
          MFFTQVLRNSAVSATKQAAKQISKSSAGEQWGLLEARRLSRGAVEWAVSLSLILAWPAAI
Sbjct: 1  MFFTQVLRNSAVSATKQAAKQISKSSAGEQWGLLEARRLSRGAVEWAVSLSLILAWPAAI 60

Query: 61 IKFSEHNRWLKAREEYS 77
          IKFSEHNRWLKAREEYS
Sbjct: 61 IKFSEHNRWLKAREEYS 77

>Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A
          (REAL)
          Length = 65

 Score = 51.6 bits (122), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 3/68 (4%)

Query: 1  MFFTQVLRNSAVSATKQAAKQISKSSAGEQWGLLEARRLSRGAVEWAVSLSLILAWPAAI 60
          MFF++VLR+SA +A     K+ +    GE W + E RRL     +W+ +LS+ L WP+A+
Sbjct: 1  MFFSEVLRSSARAA---PIKRYTGGRVGESWVITEGRRLIPEVFQWSATLSICLGWPSAV 57

Query: 61 IKFSEHNR 68
            FS+  +
Sbjct: 58 YFFSKARK 65

>Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 50.4 bits (119), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 40/68 (58%), Gaps = 3/68 (4%)

Query: 1  MFFTQVLRNSAVSATKQAAKQISKSSAGEQWGLLEARRLSRGAVEWAVSLSLILAWPAAI 60
          MFF+QVLR+SA +A     K+ +    GE W + E RRL    ++W+ +LS+ L WP A+
Sbjct: 1  MFFSQVLRSSARAAP---IKRYTGGRVGESWVITEGRRLIPEVLQWSAALSICLGWPGAV 57

Query: 61 IKFSEHNR 68
             S+  +
Sbjct: 58 YFLSKARK 65

>YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}
          COX26Putative protein of unknown function; copurifies
          with respiratory chain supercomplexes composed of
          Complex III (ubiquinol-cytochrome c reductase) and
          Complex IV (cytochrome c oxidase)
          Length = 66

 Score = 50.4 bits (119), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 39/68 (57%), Gaps = 3/68 (4%)

Query: 1  MFFTQVLRNSAVSATKQAAKQISKSSAGEQWGLLEARRLSRGAVEWAVSLSLILAWPAAI 60
          MFF+QVLR+SA +A     K+ +    GE W + E RRL     +W+  LS+ L WP A+
Sbjct: 1  MFFSQVLRSSARAAP---IKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAV 57

Query: 61 IKFSEHNR 68
            FS+  +
Sbjct: 58 YFFSKARK 65

>Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 48.5 bits (114), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1  MFFTQVLRNSAVSATKQAAKQISKSSAGEQWGLLEARRLSRGAVEWAVSLSLILAWPAAI 60
          MFF+QVLR+SA +A     K+ +    GE W + E+RRL     +W   +   L WP A+
Sbjct: 1  MFFSQVLRSSARAAP---IKRYTGGRVGEAWMITESRRLIPEVFQWGAVICTCLGWPGAV 57

Query: 61 IKFSEHNR 68
            FS+  +
Sbjct: 58 YFFSKARK 65

>KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 80

 Score = 42.4 bits (98), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 6/63 (9%)

Query: 1  MFFTQVLRNSAVSATKQAAKQISKSSA------GEQWGLLEARRLSRGAVEWAVSLSLIL 54
          MFFT+ LR++A  A   A +  +K++       GE W + EARRL    + +   +  +L
Sbjct: 1  MFFTKALRSTATIAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIVSVL 60

Query: 55 AWP 57
           WP
Sbjct: 61 GWP 63

>SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa]
          {ON} similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A Pi
          Length = 74

 Score = 41.2 bits (95), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 40/71 (56%), Gaps = 8/71 (11%)

Query: 1  MFFTQVLRNSAV-----SATKQAAKQISKSS---AGEQWGLLEARRLSRGAVEWAVSLSL 52
          MF +QVLR++A       A+K A+K + ++S    GE W + EA+RL      W  S++ 
Sbjct: 1  MFSSQVLRSTAAISRSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAA 60

Query: 53 ILAWPAAIIKF 63
          +L WP A+ K 
Sbjct: 61 VLGWPFAVKKI 71

>TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 79

 Score = 40.8 bits (94), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 5/63 (7%)

Query: 5  QVLRNSAVSATKQAAKQISKSSAGEQWGLLEARRLSRGAVEWAVSLSLILAWPAAIIKFS 64
          Q++R+S+      AAK    S  GE W L EA+R+    + W  +++ +L WP+ I  F 
Sbjct: 17 QIIRHSS-----NAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTVLLWPSFIKYFK 71

Query: 65 EHN 67
          + N
Sbjct: 72 DPN 74

>Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74
          aa] {ON} ANNOTATED BY YGOB -
          Length = 74

 Score = 38.5 bits (88), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 9/66 (13%)

Query: 1  MFFTQVLRN-------SAVSATKQAAKQISK--SSAGEQWGLLEARRLSRGAVEWAVSLS 51
          M  +Q+LR+       +A SA+K  ++ + K  SS   QW ++EA+R+      WA S++
Sbjct: 1  MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQWAVIEAKRIVPTVAMWATSMT 60

Query: 52 LILAWP 57
          ++L WP
Sbjct: 61 IMLGWP 66

>TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 75

 Score = 38.5 bits (88), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%)

Query: 1  MFFTQVLRNSAVSATKQAAKQISKSSAGEQWGLLEARRLSRGAVEWAVSLSLILAWPAAI 60
          M F    R+SA  A  Q  +  ++S   E W + E +R+      WA  LS+ L WP   
Sbjct: 1  MLFQHAARSSASMARMQLRRSFTRSYTQESWAVTEVKRIVPNIAFWATLLSVSLGWPFCF 60

Query: 61 IKFSE 65
          + + +
Sbjct: 61 VWYQD 65

>TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 62

 Score = 36.2 bits (82), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 5/67 (7%)

Query: 1  MFFTQVLRNSAVSATKQAAKQISKSSAGEQWGLLEARRLSRGAVEWAVSLSLILAWPAAI 60
          MF+TQVLR++A +A   +    S+S     W + EA+RL+   + W   L+  L WP AI
Sbjct: 1  MFYTQVLRSAAAAARATSRNHNSQS-----WAVSEAKRLTPAILGWGGFLAGCLGWPFAI 55

Query: 61 IKFSEHN 67
            F   N
Sbjct: 56 KHFMSAN 62

>Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 75

 Score = 34.7 bits (78), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%)

Query: 5  QVLRNSAVSATKQAAKQISKSSAGEQWGLLEARRLSRGAVEWAVSLSLILAWPAAIIKF 63
          +V R  AV     A +  +    GE W + EA+R+    + W  +L+ IL+WP  I  +
Sbjct: 12 RVGRVQAVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTAILSWPFIIYHY 70

>CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar
          to uniprot|Q2V2P9 Saccharomyces cerevisiae YDR119wa
          Length = 74

 Score = 33.9 bits (76), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 30/62 (48%)

Query: 6  VLRNSAVSATKQAAKQISKSSAGEQWGLLEARRLSRGAVEWAVSLSLILAWPAAIIKFSE 65
          V+ +S   +    A+  ++   G  W + E +RL+   + WA  L++ L WP  I  + +
Sbjct: 13 VMNSSMTRSLSSTARTQAQGRIGPSWTIAEIKRLTPTLIGWASFLTVTLGWPFGIYFWKK 72

Query: 66 HN 67
           N
Sbjct: 73 PN 74

>NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 75

 Score = 30.8 bits (68), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 7/71 (9%)

Query: 1  MFFTQVL----RNSAVS--ATKQAAKQISKSSAGEQWGLLEARRLSRGAVEWAVSLSLIL 54
          M F  VL    RN+AV    T  AA  I +   G  W   E +R++   + W+  L ++L
Sbjct: 1  MLFNSVLKRSIRNTAVRQFVTNGAAHTI-RPVRGLPWVSSEIQRVAPTILRWSTFLVVVL 59

Query: 55 AWPAAIIKFSE 65
           WPA    + +
Sbjct: 60 GWPAPFYYYHK 70

>KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa]
          {ON} conserved hypothetical protein
          Length = 74

 Score = 29.6 bits (65), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 11/70 (15%)

Query: 1  MFFTQVLRNSAVSATKQAAKQISKS----------SAGEQWGLLEARRLSRGAVEWAVSL 50
          M  +Q+L++ A +    AA Q+S+S          S   +W ++EA+RL      W   +
Sbjct: 1  MLSSQILKSVA-TLQGVAASQVSRSASRVVLKGPSSRARKWAVIEAKRLVPAIGMWGAFM 59

Query: 51 SLILAWPAAI 60
            +L WP A+
Sbjct: 60 GAVLGWPFAV 69

>KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 75

 Score = 29.3 bits (64), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 5/66 (7%)

Query: 2  FFTQVLRNSAVSATKQAAKQISKSSA---GEQWGLLEARRLSRGAVEWAVSLSLILAWPA 58
           F ++LR     AT   A+++  +S    GE W   E RRL+   + +A+ +  ++ WP 
Sbjct: 1  MFIRLLRAGKEHAT--TARRVVYASGHHVGESWTKSETRRLAPNLITYALFIGTMVTWPY 58

Query: 59 AIIKFS 64
           + ++S
Sbjct: 59 WVKEYS 64

>Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON}
          similar to Saccharomyces cerevisiae YDR119W-A
          Length = 74

 Score = 27.7 bits (60), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 9/64 (14%)

Query: 1  MFFTQVLRNSAVSATKQ-------AAKQISKSSAGEQWGLLEARRLSRGAVEWAVSLSLI 53
          M ++++L+  AVS   +       A +  +    GE W + E +RL    + W  +++ I
Sbjct: 1  MLYSRILK--AVSTIPKSPMSNIGARRAATSKHIGEPWMVTETKRLVPTILIWGGTMTGI 58

Query: 54 LAWP 57
          L WP
Sbjct: 59 LLWP 62

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.124    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,018,348
Number of extensions: 145824
Number of successful extensions: 472
Number of sequences better than 10.0: 18
Number of HSP's gapped: 467
Number of HSP's successfully gapped: 18
Length of query: 77
Length of database: 53,481,399
Length adjustment: 49
Effective length of query: 28
Effective length of database: 47,862,765
Effective search space: 1340157420
Effective search space used: 1340157420
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)