Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D05434gna 1ON42842823040.0
TDEL0H03670na 1ON42642012371e-168
KLTH0F00594gna 1ON4334328701e-113
SAKL0H24838gna 1ON4104328621e-112
Kwal_33.13025na 1ON4234048151e-104
Ecym_1013na 1ON4114367557e-96
AFR741Wna 1ON4074257287e-92
KNAG0H019902.288ON973214741.8
NDAI0I001706.356ON1394117732.0
CAGL0L12936g2.152ON60091696.4
Kpol_1066.497.242ON43783688.0
ABR137W2.147ON955144689.3
TBLA0A037205.426ON1458736810.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D05434g
         (428 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D05434g Chr4 complement(469258..470544) [1287 bp, 428 aa] {...   892   0.0  
TDEL0H03670 Chr8 (607134..608414) [1281 bp, 426 aa] {ON}              481   e-168
KLTH0F00594g Chr6 complement(43649..44950) [1302 bp, 433 aa] {ON...   339   e-113
SAKL0H24838g Chr8 (2160460..2161692) [1233 bp, 410 aa] {ON} cons...   336   e-112
Kwal_33.13025 s33 complement(44353..45624) [1272 bp, 423 aa] {ON...   318   e-104
Ecym_1013 Chr1 complement(22905..24140) [1236 bp, 411 aa] {ON} s...   295   7e-96
AFR741W Chr6 (1798195..1799418) [1224 bp, 407 aa] {ON} NOHBY667;...   285   7e-92
KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {O...    33   1.8  
NDAI0I00170 Chr9 (23321..27505) [4185 bp, 1394 aa] {ON} Anc_6.35...    33   2.0  
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    31   6.4  
Kpol_1066.49 s1066 complement(93804..95117) [1314 bp, 437 aa] {O...    31   8.0  
ABR137W Chr2 (653116..655983) [2868 bp, 955 aa] {ON} Syntenic ho...    31   9.3  
TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {...    31   10.0 

>ZYRO0D05434g Chr4 complement(469258..470544) [1287 bp, 428 aa] {ON}
           conserved hypothetical protein
          Length = 428

 Score =  892 bits (2304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/428 (100%), Positives = 428/428 (100%)

Query: 1   MSTDGLTEKKLEQLSKLYRDIVPASPETESFYLEILVSCEGNLEAAVELINDSLGVQRTS 60
           MSTDGLTEKKLEQLSKLYRDIVPASPETESFYLEILVSCEGNLEAAVELINDSLGVQRTS
Sbjct: 1   MSTDGLTEKKLEQLSKLYRDIVPASPETESFYLEILVSCEGNLEAAVELINDSLGVQRTS 60

Query: 61  ETDILCAKGKHEDEAVSPAPKVQKSLNSFIKDPNNKIKSVSEGSLGKISNRAIELFTKED 120
           ETDILCAKGKHEDEAVSPAPKVQKSLNSFIKDPNNKIKSVSEGSLGKISNRAIELFTKED
Sbjct: 61  ETDILCAKGKHEDEAVSPAPKVQKSLNSFIKDPNNKIKSVSEGSLGKISNRAIELFTKED 120

Query: 121 IETNIKYVSVHKNVLPELLANSLLKKLSQDNDSFTPNQFYLFGKKCTSNHLTKMFSSSEE 180
           IETNIKYVSVHKNVLPELLANSLLKKLSQDNDSFTPNQFYLFGKKCTSNHLTKMFSSSEE
Sbjct: 121 IETNIKYVSVHKNVLPELLANSLLKKLSQDNDSFTPNQFYLFGKKCTSNHLTKMFSSSEE 180

Query: 181 ISAGNIRIYYNSYSLSRIAQYDDDLKMAQLLIEDLVNDCIAQRDLLPYQIRSPNWKGDVV 240
           ISAGNIRIYYNSYSLSRIAQYDDDLKMAQLLIEDLVNDCIAQRDLLPYQIRSPNWKGDVV
Sbjct: 181 ISAGNIRIYYNSYSLSRIAQYDDDLKMAQLLIEDLVNDCIAQRDLLPYQIRSPNWKGDVV 240

Query: 241 LVNRYYKESNLDWHSDKMTSIGPQPIIASLSLGCSREFRVRKNYPSNSQIYIIRPPHNTL 300
           LVNRYYKESNLDWHSDKMTSIGPQPIIASLSLGCSREFRVRKNYPSNSQIYIIRPPHNTL
Sbjct: 241 LVNRYYKESNLDWHSDKMTSIGPQPIIASLSLGCSREFRVRKNYPSNSQIYIIRPPHNTL 300

Query: 301 VIMHAGFQEEYRHCVHGHSKNSPLKPHPISGHVRINLTYRCYLRKFLDRCPKCKKCGSPM 360
           VIMHAGFQEEYRHCVHGHSKNSPLKPHPISGHVRINLTYRCYLRKFLDRCPKCKKCGSPM
Sbjct: 301 VIMHAGFQEEYRHCVHGHSKNSPLKPHPISGHVRINLTYRCYLRKFLDRCPKCKKCGSPM 360

Query: 361 DLRRAFKDPKTRGQYIWQCSKSYTGQECGGVIRAKFDNDSLTVQNFDEEGSRWLAPDDQE 420
           DLRRAFKDPKTRGQYIWQCSKSYTGQECGGVIRAKFDNDSLTVQNFDEEGSRWLAPDDQE
Sbjct: 361 DLRRAFKDPKTRGQYIWQCSKSYTGQECGGVIRAKFDNDSLTVQNFDEEGSRWLAPDDQE 420

Query: 421 AHSAQDLN 428
           AHSAQDLN
Sbjct: 421 AHSAQDLN 428

>TDEL0H03670 Chr8 (607134..608414) [1281 bp, 426 aa] {ON} 
          Length = 426

 Score =  481 bits (1237), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 233/420 (55%), Positives = 303/420 (72%), Gaps = 2/420 (0%)

Query: 6   LTEKKLEQLSKLYRDIVPASPETESFYLEILVSCEGNLEAAVELINDSLGVQRTSETDIL 65
           +TE+K+  L  LY D++P S +TESF LEIL +C+G+++ A  ++N+SLGV R  + +I 
Sbjct: 1   MTEEKIATLISLYEDVIPKSRDTESFLLEILTACDGSVKNASLMLNESLGVARKVDCNI- 59

Query: 66  CAKGKHEDEAVSPAPKVQKSLNSFIKDPNNKIKSVSEGSLGKISNRAIELFTKEDIETNI 125
             + +    + +   KVQKSLN FI+D   K + +S     K SNRAIELF+KED+E+ I
Sbjct: 60  GKRKRDTGNSDNRCYKVQKSLNQFIEDDAKKFRPISSDRRAKTSNRAIELFSKEDVESTI 119

Query: 126 KYVSVHKNVLPELLANSLLKKLSQDNDSFTPNQFYLFGKKCTSNHLTKMFSSSEEISAGN 185
            YV++H+  LPE  ANSLL++L  D + F P +F+LFG KC+SNH +K +SS   I  G 
Sbjct: 120 GYVTMHEKALPEEFANSLLRQLMDDLEGFAPYEFHLFGNKCSSNHTSKKYSSDPAILDGR 179

Query: 186 IRIYYNSYSLSRIAQYDDDLKMAQLLIEDLVNDCIAQRDLLPYQIRSPNWKGDVVLVNRY 245
            +IYYN+     + +Y+D LK  QLLIED+VN+ I +   LP+QI SPNWKGDVVLVN+Y
Sbjct: 180 DKIYYNNRR-GTVYEYNDLLKATQLLIEDIVNETIKKFKPLPFQISSPNWKGDVVLVNKY 238

Query: 246 YKESNLDWHSDKMTSIGPQPIIASLSLGCSREFRVRKNYPSNSQIYIIRPPHNTLVIMHA 305
            K  +L WHSD++TSIGPQPI+ASLSLGC REFR+R+ YPS+SQIY++RPPHN+L+IMHA
Sbjct: 239 GKSDHLMWHSDRLTSIGPQPIVASLSLGCVREFRIRRCYPSDSQIYVVRPPHNSLIIMHA 298

Query: 306 GFQEEYRHCVHGHSKNSPLKPHPISGHVRINLTYRCYLRKFLDRCPKCKKCGSPMDLRRA 365
           GFQEEYRH VH  + N     HPIS  VR NLTYR YL+K+++  P+C KC +PMDLRRA
Sbjct: 299 GFQEEYRHSVHQQTNNRATNLHPISKDVRFNLTYRDYLKKYINNAPRCPKCDNPMDLRRA 358

Query: 366 FKDPKTRGQYIWQCSKSYTGQECGGVIRAKFDNDSLTVQNFDEEGSRWLAPDDQEAHSAQ 425
           FKDP+ RGQYIWQCS  Y+G ECGGV  A F+ +SL V+    EGSRWLA DD EA  AQ
Sbjct: 359 FKDPERRGQYIWQCSSHYSGVECGGVRLADFNCNSLVVEKNAGEGSRWLADDDWEAKEAQ 418

>KLTH0F00594g Chr6 complement(43649..44950) [1302 bp, 433 aa] {ON}
           conserved hypothetical protein
          Length = 433

 Score =  339 bits (870), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/432 (44%), Positives = 259/432 (59%), Gaps = 48/432 (11%)

Query: 7   TEKKLEQLSKLYRDIVPASPETESFYLEILVSCEGNLEAAVELINDSLGVQRTSETDILC 66
           TE+K+ +L  LY D            L++LVSC G+L+ + +L+ D+   + +S+     
Sbjct: 33  TEEKIAELQNLYPDYGVDG------LLDVLVSCGGSLKRSAQLLGDTTTPESSSKRF--- 83

Query: 67  AKGKHEDEAVSPAPKVQKSLNSFIKD---PNNKIKSVSEGSLGKISNRAIELFTKEDIET 123
                         + Q++LN F+     P   IK+      G  ++R IEL +KED+E+
Sbjct: 84  ------------KSRQQQTLNRFLDVRLLPKAAIKTN-----GSKASRPIELHSKEDVES 126

Query: 124 NIKYVSVHKNVLPELLANSLLKKLSQDNDSFTPNQFYLFGKKCTSNHLTKMFSSSEEISA 183
            +KY + H NVLP  LAN LL+ LS+D  SF PN+FYLFG KC SN  +++F     I  
Sbjct: 127 TLKYCTYHPNVLPLELANKLLEALSKDT-SFKPNEFYLFGNKCISNCKSRIFLPENRIEP 185

Query: 184 GNIRIYYNSYSLSRIAQYDDDLKMAQLLIEDLVNDCIAQRDLLPYQIRSPNWKGDVVLVN 243
                YYN   +   + Y D++ MAQ+L+E+LVND ++QR  LP+Q+ +  W+   VL N
Sbjct: 186 ----FYYNGKRVESYSTYSDEIMMAQILVEELVNDVLSQRTALPFQVEAGKWEVQAVLSN 241

Query: 244 RYYKESNLDWHSDKMTSIGPQPIIASLSLGCSREFRVRKNYPSNSQIYIIRPPHNTLVIM 303
            Y ++SNLDWHSD++T+IGP  IIASLSLG +REFRVR+ +PSNS  Y +RP HN+L+IM
Sbjct: 242 SYSRDSNLDWHSDRLTNIGPHAIIASLSLGFTREFRVRRVHPSNSSTYSLRPQHNSLIIM 301

Query: 304 HAGFQEEYRHCVHGHSKNSPLKP---HPISGHVRINLTYRCYLRKFLDRCPKCKKCGSPM 360
           HAGFQEEY+HCV    KN  +     HPIS  VR+NLT+R Y    L     CK CG PM
Sbjct: 302 HAGFQEEYKHCVPFLPKNCNIPAEDVHPISNDVRVNLTFRNYA---LTTKVFCKLCGFPM 358

Query: 361 DLRRAFKDPKTRGQYIWQCSKSYT-------GQECGGVIRAKFDNDSLTVQNFDEEGSRW 413
           DLRR+FKDP  RG YI+QCSKSYT       G+EC G   A F         F+ +GSRW
Sbjct: 359 DLRRSFKDPSKRGLYIFQCSKSYTEENSFKEGRECKGFAFACFKKKP-PFTEFETDGSRW 417

Query: 414 LAPDDQEAHSAQ 425
           +A DD EA  AQ
Sbjct: 418 IADDDLEAKQAQ 429

>SAKL0H24838g Chr8 (2160460..2161692) [1233 bp, 410 aa] {ON}
           conserved hypothetical protein
          Length = 410

 Score =  336 bits (862), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 184/432 (42%), Positives = 265/432 (61%), Gaps = 39/432 (9%)

Query: 4   DGLTEKKLEQLSKLYRDIVPASPETESFYLEILVSCEGNLEAAVELINDSLGVQRTSETD 63
           +  TE+K+++L++L+ D        + F LE+L SC G++  AV LI+ S+    + + D
Sbjct: 7   ESTTEEKIKKLNELFPDA------DDEFLLEVLTSCSGSIRQAVSLIDASV----SQKYD 56

Query: 64  ILCAKGKHEDEAVSPAPKVQKSLNSFIKDPNNKIKSVSEGSLGKISNRAIELFTKEDIET 123
            L +  + +        K Q +L   + D   K   +S G   + +   I L TK+++E+
Sbjct: 57  QLYSTKRLK-------AKTQSTLTKLLSDSLTK-PGISRGP--QKTRTPIALHTKDEVES 106

Query: 124 NIKYVSVHKNVLPELLANSLLKKLSQDNDSFTPNQFYLFGKKCTSNHLTKMFSSSEEISA 183
            + Y + HK++LP  +AN +L+ L  ++ S   N+FYLFG KCTSNH T+++S +E   A
Sbjct: 107 TLAYCTYHKDILPSEVANKILE-LVMNDKSARSNEFYLFGNKCTSNHKTRIYSCAEHRKA 165

Query: 184 GNIRIYYNSYSLSRIAQYDDDLKMAQLLIEDLVNDCIAQRDLLPYQIRSPNWKGDVVLVN 243
               + YN   +  + +Y D++ +A LLIED VN+ +  R  LPYQ++   W   + + N
Sbjct: 166 ----LTYNGRVIDDVGEYTDEMMVAHLLIEDFVNEVLQSRGTLPYQVKPGEWTSQMAVAN 221

Query: 244 RYYKESNLDWHSDKMTSIGPQPIIASLSLGCSREFRVRKNYPSNSQIYIIRPPHNTLVIM 303
            Y  +SNL WHSD++T+IGPQ I+ASLSLG SREFRVR  YPS+SQ+Y I+P HN+L+IM
Sbjct: 222 VYKLDSNLQWHSDRLTNIGPQAIVASLSLGFSREFRVRNIYPSDSQVYSIKPEHNSLLIM 281

Query: 304 HAGFQEEYRHCVHGHSKNSPLKP---HPISGHVRINLTYRCYLRKFLDRCPKCKKCGSPM 360
           HAGFQEEY+HCV    K S +     HPISG  R+N+TYR    + + + P C KCG PM
Sbjct: 282 HAGFQEEYKHCVPPVPKCSRVPKDEFHPISGTTRVNMTYR---NRIMKKTPSCIKCGYPM 338

Query: 361 DLRRAFKDPKTRGQYIWQCSKSYT-------GQECGGVIRAKFDNDSLTVQNFDEEGSRW 413
           +LRR FK P  RG Y+WQCSKSYT       G+EC G+  A F+NDS+ V + +   SRW
Sbjct: 339 ELRRTFKKPDNRGMYMWQCSKSYTEENDFKAGKECKGMRYANFNNDSV-VTDDESNCSRW 397

Query: 414 LAPDDQEAHSAQ 425
           LA DD +A  AQ
Sbjct: 398 LADDDIQAREAQ 409

>Kwal_33.13025 s33 complement(44353..45624) [1272 bp, 423 aa] {ON}
           [contig 123] FULL
          Length = 423

 Score =  318 bits (815), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 178/404 (44%), Positives = 249/404 (61%), Gaps = 33/404 (8%)

Query: 33  LEILVSCEGNLEAAVELINDSLGVQRTSETDILCAKGKHEDEAVSPAPKVQKSLNSFIKD 92
           L++LVSC+G+L+ + + +  S  V +T   D+   + K          K Q+SL+ +++ 
Sbjct: 25  LDVLVSCDGSLKRSADFLGGS--VSQTDTPDLHPKRLK---------TKSQQSLSRYLEV 73

Query: 93  PNNKIKSV-SEGSLGKISNRAIELFTKEDIETNIKYVSVHKNVLPELLANSLLKKLSQDN 151
             N +  + ++    K   R +EL  KE IE NI Y + H +VLP  +A+ LL++L +D 
Sbjct: 74  --NALHPIPNKVPASKSKPRPLELHGKEQIEANIPYCTYHTDVLPSEVADKLLQQLLEDR 131

Query: 152 DSFTPNQFYLFGKKCTSNHLTKMFSSSEEISAGNIRIYYNSYSLSRIAQYDDDLKMAQLL 211
           +   PN+FYLFG  CTSN  +++F       A     +YN   +     Y D++ +AQ++
Sbjct: 132 NH-KPNKFYLFGNLCTSNCASRLFVPE----AREKPFFYNGKEVKNPGNYTDEMMLAQVV 186

Query: 212 IEDLVNDCIAQRDLLPYQIRSPNWKGDVVLVNRYYKESNLDWHSDKMTSIGPQPIIASLS 271
           IE++VN+ I++R  LP+Q+++  W+   VL N Y K+SNLDWHSD++T+IGPQ IIASLS
Sbjct: 187 IENVVNEAISKRPPLPFQVKANEWEAQAVLSNVYKKDSNLDWHSDRLTNIGPQAIIASLS 246

Query: 272 LGCSREFRVRKNYPSNSQIYIIRPPHNTLVIMHAGFQEEYRHCVHGHSKNSPLKP---HP 328
           LG SREFRVRK+YPSNSQ++ + P HN+L+IMHAGFQEEY+HCV    K S +     HP
Sbjct: 247 LGFSREFRVRKSYPSNSQVFSLLPQHNSLIIMHAGFQEEYKHCVPKLGKGSRIPKEDLHP 306

Query: 329 ISGHVRINLTYRCYLRKFLDRCPKCKKCGSPMDLRRAFKDPKTRGQYIWQCSKSYTG--- 385
           ISG  R+NLTYR Y+   +     CK CG PM+LRR FK+P+ RG YI+QCS+SYT    
Sbjct: 307 ISGTTRVNLTYRNYV---MTENVFCKLCGCPMELRRTFKEPRKRGSYIYQCSRSYTAANG 363

Query: 386 ----QECGGVIRAKFDNDSLTVQNFDEEGSRWLAPDDQEAHSAQ 425
               QEC G   A F      V + D EGS WLA DD EA   Q
Sbjct: 364 FHENQECKGFAFANFCKTPPLV-SVDSEGSHWLAEDDTEARELQ 406

>Ecym_1013 Chr1 complement(22905..24140) [1236 bp, 411 aa] {ON}
           similar to Ashbya gossypii AFR741W
          Length = 411

 Score =  295 bits (755), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 178/436 (40%), Positives = 254/436 (58%), Gaps = 46/436 (10%)

Query: 1   MSTDGLTEKKLEQLSKLYRDIVPASPETESFYLEILVSCEGNLEAAVELINDSLGVQRTS 60
           M+ D  T++KL  L  L+    P++       L++LVSC G++  A  L++         
Sbjct: 1   MNVDDTTDEKLAYLQNLF----PSA--NAEVLLDLLVSCNGSVRDATLLLD--------- 45

Query: 61  ETDILCAKGKHEDEAVSPAPKV-----QKSLNSFIKDPNNKIKSVSEGSLGKISNRAIEL 115
               L  +G   +E  SP  KV     Q+SL+SF+      ++S+      + S + I L
Sbjct: 46  ----LSEEGTQLEEQRSPPRKVAKVKGQQSLSSFLP-----LQSLYNRQ-SRPSGKPIIL 95

Query: 116 FTKEDIETNIKYVSVHKNVLPELLANSLLKKLSQDNDSFTPNQFYLFGKKCTSNHLTKMF 175
           + K+DIE  +KY + H +VLPE LAN LLK    + +S  PN+FYLFG KC SN  + ++
Sbjct: 96  YGKKDIELELKYCTYHTDVLPEELANRLLKFTMNEQNS-KPNEFYLFGNKCVSNCRSAIY 154

Query: 176 SSSEEISAGNIRIYYNSYSLSRIAQYDDDLKMAQLLIEDLVNDCIAQRDLLPYQIRSPNW 235
           S+   +SA     YYN   +  + +++DD+ + + +IE LVN+ + +R  LP+Q +  +W
Sbjct: 155 SN---LSAEEDDYYYNGMRVQTVNRFNDDMVITRSIIEKLVNEQLQKRLTLPFQTKPGDW 211

Query: 236 KGDVVLVNRYYKESNLDWHSDKMTSIGPQPIIASLSLGCSREFRVRKNYPSNSQIYIIRP 295
           K  VV+ N Y K+S+L WHSD+MT IGP  +IA+LSLG SR  R R+ YPSNSQIY + P
Sbjct: 212 KSPVVISNIYAKDSDLQWHSDRMTYIGPHSVIATLSLGFSRGVRFRRVYPSNSQIYTVMP 271

Query: 296 PHNTLVIMHAGFQEEYRHCVHGHSKNSPLKP---HPISGHVRINLTYRCYLRKFLDRCPK 352
            HN+++IMHAG QEE++HCV    KN  +     +PIS   R++LT+R Y     +    
Sbjct: 272 EHNSVLIMHAGCQEEFKHCVPPLPKNHQISKSAINPISQTTRVSLTFRDYKVNTYEPV-H 330

Query: 353 CKKCGSPMDLRRAFKDPKTRGQYIWQCSKSYTG-------QECGGVIRAKFDNDSLTVQN 405
           C KCG PMDLRR +K P+ RG YIW C+KSYT        QECGG+  A+F N  L    
Sbjct: 331 CDKCGYPMDLRRIYKTPEKRGHYIWLCTKSYTAGNGLNNKQECGGLKFARF-NHPLPTTT 389

Query: 406 FDEEGSRWLAPDDQEA 421
            + EGS W+A DD EA
Sbjct: 390 TESEGSFWVADDDFEA 405

>AFR741W Chr6 (1798195..1799418) [1224 bp, 407 aa] {ON} NOHBY667; No
           homolog in Saccharomyces cerevisiae
          Length = 407

 Score =  285 bits (728), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 171/425 (40%), Positives = 246/425 (57%), Gaps = 37/425 (8%)

Query: 7   TEKKLEQLSKLYRDIVPASPETESFYLEILVSCEGNLEAAVELINDSLGVQRTSETDILC 66
           +E   E+L+KL + I+P S +TE+  L++LV C GNLE A  L+ +  G+    E D   
Sbjct: 4   SETTDEKLAKL-KAIIP-SADTEAL-LDVLVCCGGNLEEAAALLRN--GIDPADEKDARP 58

Query: 67  AKGKHEDEAVSPAPKVQKSLNSFIKDPNNKIKSVSEGSLGKISNRAIELFTKEDIETNIK 126
            K         P  + Q+SL+ +          + +  +  +  R I L  K DIE  ++
Sbjct: 59  LK--------KPRLQTQQSLSRYF--------GLKKSPVPALGGRPIVLHGKRDIEGALR 102

Query: 127 YVSVHKNVLPELLANSLLKKLSQDNDSFTPNQFYLFGKKCTSNHLTKMFSSSEEISAGNI 186
           Y + H NVLP  LA  LL+ +  D  +  PN+FYLFG +C +N  T ++ + +   AG  
Sbjct: 103 YCTYHTNVLPAALAERLLEVVMTDERA-KPNEFYLFGSRCVTNCRTLLYGNLDPADAG-- 159

Query: 187 RIYYNSYSLSRIAQYDDDLKMAQLLIEDLVNDCIAQRDLLPYQIRSPNWKGDVVLVNRYY 246
           R++YN   +S +  Y+ DL  AQ ++E LVN  +A+R  LP+Q+ + +W+  V + N Y 
Sbjct: 160 RVFYNG-RISTLTSYNADLCEAQRIVEHLVNAELAKRAKLPFQVPAGSWRCPVAVANIYE 218

Query: 247 KESNLDWHSDKMTSIGPQPIIASLSLGCSREFRVRKNYPSNSQIYIIRPPHNTLVIMHAG 306
           K+S+L WHSD++T IGP  I+ASL+LG  REFR+R+ YP++SQIY I   HN+++IMHAG
Sbjct: 219 KDSDLQWHSDRLTYIGPHAIVASLTLGFEREFRLRRVYPADSQIYSIPLAHNSVLIMHAG 278

Query: 307 FQEEYRHCV---HGHSKNSPLKPHPISGHVRINLTYRCYLRKFLDRCPKCKKCGSPMDLR 363
            QEE++HCV       K S  + HPISG VR++LT+R Y   F  R   C +CG PMDLR
Sbjct: 279 CQEEFKHCVPPLGKRKKVSAAELHPISGSVRVSLTFRHYKVDF-PRDALCPECGYPMDLR 337

Query: 364 RAFKDPKTRGQYIWQCSKSYTGQE-------CGGVIRAKFDNDSLTVQNFDEEGSRWLAP 416
           R +K P  RG YIW CS+ Y+          C G+  A  D  S  V + + EG+ WLA 
Sbjct: 338 RTYKTPSKRGHYIWICSRGYSSGNDKSVESFCKGIKYACVDA-SPPVTDIESEGNVWLAD 396

Query: 417 DDQEA 421
           DD EA
Sbjct: 397 DDFEA 401

>KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {ON}
           Anc_2.288 YNL023C
          Length = 973

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 79/214 (36%), Gaps = 26/214 (12%)

Query: 175 FSSSEEISAGNIRIYYNSYSLSRIAQYDDDLKMAQLLIEDLVNDCIAQRDLLPYQIRSP- 233
           FSS +E SA    I Y+      IA  D +        E  V + IA+ DL    I +  
Sbjct: 17  FSSDDEDSATEANITYSEEEEEEIATSDTEEDQDLPYYERAVRE-IAKGDLYTCMICTVE 75

Query: 234 -NWKGDVVLVNRYYKESNLDWHSDKMTSIGPQPIIASLSLGCSREFRVRKNYPSNSQIY- 291
            ++   +    + Y+    D+   +  +I            C   + V K  P+ ++   
Sbjct: 76  MDYTCKMFACRKCYRV--FDYDCVREWAIKSTDKTVDRIWKCPNCYLVNKKVPTKNRPTC 133

Query: 292 ----IIRPPHNTLVIMHAGFQEEYRHCVHGHSKNSPLKPHPISGHVRINLTYRCYLRKFL 347
               ++ P  N L     G   + + C+HG SK   L PHP              LR   
Sbjct: 134 WCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHLGPHPEC------------LRTTS 181

Query: 348 DRCPKCKKCGSPMDLRRAFKDPKTRGQYIWQCSK 381
            +C    +CG        F+    RG+ ++QC++
Sbjct: 182 VKC----RCGKATKEIPCFETKGRRGRNLFQCNE 211

>NDAI0I00170 Chr9 (23321..27505) [4185 bp, 1394 aa] {ON} Anc_6.356
            YCR081W
          Length = 1394

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 60/117 (51%), Gaps = 15/117 (12%)

Query: 121  IETNIKYVSVHKNVLPELLANSLLKKLS--QDNDSFTPNQFYLFGKKCTSNHLTKMFSSS 178
            ++   K  S+H+N +  L+ NSL  ++S  Q+ + F  N F +FGK   +  L  M    
Sbjct: 1192 LDVFFKIFSIHQNPIFRLILNSLGGRISDRQEEEKFIDNMFTVFGKLTFNLRLKLMLY-- 1249

Query: 179  EEISAGNIRIYYNSYSL---SRIAQYDDDLKMAQLLIEDLVNDCIAQRDLLPYQIRS 232
             EI +G     + SYS+   +R  + ++  +   +L +DL+   +++  L P+Q+ S
Sbjct: 1250 -EILSG-----FKSYSIYVSTRSNEENNGEQTLVILDQDLITRKMSK--LPPFQVSS 1298

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 31.2 bits (69), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 7/91 (7%)

Query: 8   EKKLEQLSKLY---RDIVPASPETESFYLEILVSCEGNLEAAVELINDSL---GVQRTSE 61
           E K+ +  KL+   R   P +PE  +FY EIL   +G+++ AV+  N +     +Q+   
Sbjct: 427 ENKMAECEKLFEEARKTFPTAPEVPNFYAEILAD-KGDIDEAVKQYNIAYRLESLQKQIH 485

Query: 62  TDILCAKGKHEDEAVSPAPKVQKSLNSFIKD 92
             I    GK    A  P P+   +++  ++D
Sbjct: 486 VGIAPLVGKATILARQPTPENFATISQLLED 516

>Kpol_1066.49 s1066 complement(93804..95117) [1314 bp, 437 aa] {ON}
           complement(93804..95117) [1314 nt, 438 aa]
          Length = 437

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 37/83 (44%), Gaps = 9/83 (10%)

Query: 106 GKISNRAIELFTKEDIETNIKYVSVHKN--VLPE-----LLANSLLKKLSQDNDSFTPNQ 158
           G  + RAIE+       + IKYV+ H    VL +      + N++ K    DND+   N+
Sbjct: 289 GTGAQRAIEMAIGNSRRSEIKYVNAHATSTVLGDRAESNAIRNAIFK--DTDNDNHIKNE 346

Query: 159 FYLFGKKCTSNHLTKMFSSSEEI 181
            Y+   K +  HL     + E I
Sbjct: 347 IYVSSNKGSMGHLLGAAGAVESI 369

>ABR137W Chr2 (653116..655983) [2868 bp, 955 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR120W (MSH1)
          Length = 955

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 61/144 (42%), Gaps = 27/144 (18%)

Query: 112 AIELFTKEDIETNIKYV---SVHKNVLPELLANSLLKKLSQDNDSFTPNQFYL---FGKK 165
            +E F K+DI  N +Y     V + V P    +   + L +       NQF L   F  +
Sbjct: 155 VVEQFRKDDIADNERYKFNRRVTRVVTPGTFIDEAFENLQE-------NQFLLSVEFPDR 207

Query: 166 CT---SNHLTKMFSSSEEISAGNIRIYYNSYSLSRIAQYDDDLKMAQLLIEDLVNDCIAQ 222
           C    S+   K+  S  +IS G +  +     L  +      +K  ++L+ +        
Sbjct: 208 CMEKLSDPSIKVGLSWCDISTGEL--FVQQVQLKGLISAITKIKPREILLSE-------- 257

Query: 223 RDLLPYQIRSPNWKGDVVLVNRYY 246
            DLL YQI++ NW  ++V   +Y+
Sbjct: 258 -DLLAYQIQNGNWYPELVEFKKYF 280

>TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1458

 Score = 30.8 bits (68), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 8/73 (10%)

Query: 74   EAVSPAPKVQKSLNSFIKDPNNKIK-SVS-EGSLGKISNRAIELFTKEDIETNIKYVSVH 131
            +A++ APK++      + + N+KI+ SV  E S+ KIS  A     KE +E N+ Y   H
Sbjct: 1206 DAIARAPKLKIQFGDVVPESNSKIRISVRPEASVSKISASA-----KEPLENNVFYRMQH 1260

Query: 132  -KNVLPELLANSL 143
             +  LP ++   L
Sbjct: 1261 LRRALPSIVVKGL 1273

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,467,910
Number of extensions: 2278760
Number of successful extensions: 7134
Number of sequences better than 10.0: 52
Number of HSP's gapped: 7375
Number of HSP's successfully gapped: 52
Length of query: 428
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 316
Effective length of database: 40,638,807
Effective search space: 12841863012
Effective search space used: 12841863012
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)