Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C14872g8.850ON49649624030.0
TBLA0B029008.850ON52045917510.0
CAGL0I02684g8.850ON49343317400.0
Suva_13.4758.850ON51546017420.0
NCAS0C003108.850ON55643517310.0
YMR285C (NGL2)8.850ON51546017190.0
SAKL0D01166g8.850ON50545717120.0
Smik_13.5018.850ON51546017040.0
TDEL0B001908.850ON49245816940.0
NDAI0K003708.850ON56842817010.0
Kpol_237.18.850ON50345816910.0
Skud_13.4588.850ON51446016750.0
KAFR0L019608.850ON51145916740.0
TPHA0I003208.850ON52943316650.0
KLTH0C03608g8.850ON49545716480.0
Kwal_27.102048.850ON49445516140.0
KLLA0C06248g8.850ON51646215670.0
KNAG0K006508.850ON48243915630.0
ABL118W8.850ON50442314540.0
Ecym_46198.850ON48742214410.0
NDAI0E002608.850ON49844712561e-169
TBLA0D033008.850ON48044511611e-155
NCAS0B002708.850ON47646511551e-154
Smik_13.168.850ON5024479561e-124
CAGL0B02387g8.850ON4714439531e-124
KAFR0A028608.850ON4784319471e-123
Suva_13.258.850ON5024579331e-120
Skud_13.238.850ON4984729241e-119
YML118W (NGL3)8.850ON5054469191e-118
KNAG0G034708.850ON4664338701e-111
Ecym_73547.78ON7852351991e-15
ACR288W7.78ON7362371947e-15
KNAG0D048407.78ON7792221867e-14
SAKL0B10032g7.78ON7312241777e-13
KLLA0F15884g7.78ON7902491761e-12
KLTH0D02310g7.78ON7392291751e-12
Suva_1.457.78ON8312521723e-12
Kwal_26.71127.78ON7422241698e-12
Skud_1.407.78ON8692331699e-12
ZYRO0D05302g7.78ON8572281662e-11
CAGL0H06149g7.78ON8732601634e-11
YAL021C (CCR4)7.78ON8372381625e-11
TPHA0H026807.78ON8722521591e-10
KAFR0K006707.78ON7952231581e-10
NDAI0H025207.78ON8982511572e-10
Kpol_1040.147.78ON7842341562e-10
Smik_1.457.78ON8392231545e-10
TBLA0A046607.78ON8962471529e-10
TDEL0H037307.78ON7972401511e-09
ACR277C7.90ON3782611472e-09
KLLA0F07733g7.90ON3712381472e-09
NCAS0F016407.78ON8552561402e-08
TBLA0E022607.90ON3882411349e-08
Kpol_1044.67.90ON3722391331e-07
KAFR0D012507.90ON3562341321e-07
NDAI0A085307.90ON3652491312e-07
KLTH0D02574g7.90ON3682661312e-07
NCAS0I005007.90ON3892611312e-07
Kwal_26.71707.90ON3722501302e-07
SAKL0B09768g7.90ON3682361293e-07
KNAG0L005507.90ON3812541293e-07
TDEL0H036007.90ON3662351266e-07
Smik_15.1257.90ON3632381267e-07
ZYRO0D05588g7.90ON3562371268e-07
TPHA0L005307.90ON3912401222e-06
CAGL0F01001g7.90ON3592351222e-06
Suva_15.1277.90ON3632351196e-06
Skud_15.1157.90ON3632381178e-06
Ecym_26367.90ON3672631161e-05
YOL042W (NGL1)7.90ON3632381161e-05
Skud_4.5685.327ON47869770.76
TBLA0C006908.87ON60449732.7
KAFR0D011208.87ON61047723.0
Suva_9.189na 1ON10753656.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C14872g
         (496 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]...   930   0.0  
TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {O...   679   0.0  
CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {...   674   0.0  
Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {...   675   0.0  
NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850      671   0.0  
YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON} ...   666   0.0  
SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar ...   664   0.0  
Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {...   660   0.0  
TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}...   657   0.0  
NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON...   659   0.0  
Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON} com...   655   0.0  
Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {...   649   0.0  
KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {...   649   0.0  
TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}...   645   0.0  
KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {...   639   0.0  
Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {...   626   0.0  
KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {...   608   0.0  
KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {...   606   0.0  
ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic ho...   564   0.0  
Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar...   559   0.0  
NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850...   488   e-169
TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {O...   451   e-155
NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850      449   e-154
Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W (...   372   e-124
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...   371   e-124
KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {O...   369   e-123
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...   363   e-120
Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W (...   360   e-119
YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...   358   e-118
KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {O...   339   e-111
Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar t...    81   1e-15
ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic ho...    79   7e-15
KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.7...    76   7e-14
SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} simila...    73   7e-13
KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]...    72   1e-12
KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {...    72   1e-12
Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON} Y...    71   3e-12
Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {O...    70   8e-12
Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON} Y...    70   9e-12
ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {...    69   2e-11
CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {...    67   4e-11
YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}  ...    67   5e-11
TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.7...    66   1e-10
KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {...    65   1e-10
NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78      65   2e-10
Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {O...    65   2e-10
Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON} Y...    64   5e-10
TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa] ...    63   9e-10
TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.7...    63   1e-09
ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON} S...    61   2e-09
KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} simila...    61   2e-09
NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78      59   2e-08
TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {O...    56   9e-08
Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119...    56   1e-07
KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.9...    55   1e-07
NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa] ...    55   2e-07
KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} simila...    55   2e-07
NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90 ...    55   2e-07
Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W...    55   2e-07
SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {...    54   3e-07
KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90...    54   3e-07
TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {O...    53   6e-07
Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042...    53   7e-07
ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} simila...    53   8e-07
TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90...    52   2e-06
CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly...    52   2e-06
Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042...    50   6e-06
Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042...    50   8e-06
Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {O...    49   1e-05
YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putat...    49   1e-05
Skud_4.568 Chr4 complement(1016158..1017594) [1437 bp, 478 aa] {...    34   0.76 
TBLA0C00690 Chr3 complement(136694..138508) [1815 bp, 604 aa] {O...    33   2.7  
KAFR0D01120 Chr4 complement(222704..224536) [1833 bp, 610 aa] {O...    32   3.0  
Suva_9.189 Chr9 complement(313656..313979) [324 bp, 107 aa] {ON}...    30   6.2  

>ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]
           {ON} similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 496

 Score =  930 bits (2403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/496 (90%), Positives = 449/496 (90%)

Query: 1   MQLKGRPKNINMSDNKITNAPAXXXXXXXXXXXXXXAPVSPEHIXXXXXXXXXXXXXXXX 60
           MQLKGRPKNINMSDNKITNAPA              APVSPEHI                
Sbjct: 1   MQLKGRPKNINMSDNKITNAPAGGSKTEPKGKKGKKAPVSPEHIAKVRAEREAARAAKKE 60

Query: 61  XXXXQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFPTSGDA 120
               QGIDPDFPPELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFPTSGDA
Sbjct: 61  AMMAQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFPTSGDA 120

Query: 121 LKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVA 180
           LKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVA
Sbjct: 121 LKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVA 180

Query: 181 IVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKVAQEHNLKKTGIIV 240
           IVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKVAQEHNLKKTGIIV
Sbjct: 181 IVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKVAQEHNLKKTGIIV 240

Query: 241 GTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPF 300
           GTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPF
Sbjct: 241 GTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPF 300

Query: 301 DSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRXXXXXXXXXXXXXNIEKFGTDQPDHP 360
           DSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMR             NIEKFGTDQPDHP
Sbjct: 301 DSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRDGEEDDAEEEEGGNIEKFGTDQPDHP 360

Query: 361 VPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEISNWA 420
           VPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEISNWA
Sbjct: 361 VPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEISNWA 420

Query: 421 HTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTEHGQPHTGE 480
           HTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTEHGQPHTGE
Sbjct: 421 HTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTEHGQPHTGE 480

Query: 481 YPSDHLCMLCELELVN 496
           YPSDHLCMLCELELVN
Sbjct: 481 YPSDHLCMLCELELVN 496

>TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {ON}
           Anc_8.850 YMR285C
          Length = 520

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/459 (68%), Positives = 365/459 (79%), Gaps = 4/459 (0%)

Query: 39  VSPEHIXXXXXXXXXXXXXXXXXXXXQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKL 98
           +SPEHI                    QGIDPD P ELQFIKRPIL +H+ E V+GFKF L
Sbjct: 63  ISPEHIAQVRAKREAARKAKRDALLAQGIDPDCPKELQFIKRPILQMHENEPVKGFKFSL 122

Query: 99  MTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKD 158
           MTYNCLAQALIRRKLFP  GDALKW+RRSKVLLNEFK+YN D+ICLQEID++QYQSFWK+
Sbjct: 123 MTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKE 182

Query: 159 ELAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLI 218
           E +KLGY+ QF+++ SKNHGV++VWK+E F MTD+ML+D+D+E SGDI PRTTTNN  L+
Sbjct: 183 EFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALL 242

Query: 219 LSLKFSDKVAQE--HNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVL 276
           LSLKFS KV +    N+ KTGI++GTTHLFWHPFGT+ERTRQCY++LNK+KEF  RVN+L
Sbjct: 243 LSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNIL 302

Query: 277 QNGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRXX 336
           QN  D D SHWYPFFCGDFNSQPFDSPYLSMT KPI+YS R+KTVIECSTS+ FSK R  
Sbjct: 303 QNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKR-- 360

Query: 337 XXXXXXXXXXXNIEKFGTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVA 396
                      NIEKFG DQP HPVP  Y+A D ++ LV +MQ LHNSLDMRA+SLYS  
Sbjct: 361 DGEEGDDEEGGNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAG 420

Query: 397 YRKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSL 456
           Y KVHPEN+G+DNER EPEISNWAH WRGLLDYLF+I+ WDF+  KEIDSLE FEREN +
Sbjct: 421 YSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDI 480

Query: 457 KIRGLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCELELV 495
           KIRG LR+PP KE+  HGQP  GEYPSDHLCMLCE+EL 
Sbjct: 481 KIRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVELC 519

>CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285c
          Length = 493

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/433 (73%), Positives = 360/433 (83%), Gaps = 4/433 (0%)

Query: 65  QGIDPDFPPELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFPTSGDALKWY 124
           +G+DPD PPELQFI+R +L LH+ E VEG K K+M+YNCLAQALIRRKLFP SG+ALKWY
Sbjct: 61  RGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGEALKWY 120

Query: 125 RRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVAIVWK 184
           RRS+VLLNEFK+Y+ DV+CLQEIDYIQYQSFWK+E  KLGY SQFHR+ SKNHGV I+WK
Sbjct: 121 RRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNHGVCIIWK 180

Query: 185 REYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKV---AQEHNLKKTGIIVG 241
            E F M+D+MLIDFD E SGDI PRTTTNNA LIL+LKF+ KV    ++    K+GI+VG
Sbjct: 181 HEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSGILVG 240

Query: 242 TTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPFD 301
           TTHLFWHPFGT+ERTRQCYVVLNK+KEF HRVNVLQN NDGD SHWYPFFCGDFNSQPFD
Sbjct: 241 TTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQPFD 300

Query: 302 SPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRXXXXXXXXXXXXXNIEKFGTDQPDHPV 361
           SPYLSMT KPI+Y  RAKTVIECSTS+ FSK R             NIEKFG DQP  PV
Sbjct: 301 SPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKR-ESGEDAEDEEGGNIEKFGKDQPQTPV 359

Query: 362 PQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEISNWAH 421
           P+ + A D + +LV QM+ LHNSLDMRAVSLYSVAY KVHPEN+GLDNERGEPEISNWAH
Sbjct: 360 PEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPEISNWAH 419

Query: 422 TWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTEHGQPHTGEY 481
           TWRGLLDY+F IR+W+F D  EID+LE FE  N++KIRGLLR+PPG EM+ HGQPH GEY
Sbjct: 420 TWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQPHVGEY 479

Query: 482 PSDHLCMLCELEL 494
           PSDHLC+L E+EL
Sbjct: 480 PSDHLCLLSEVEL 492

>Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/460 (67%), Positives = 373/460 (81%), Gaps = 5/460 (1%)

Query: 39  VSPEHIXXXXXXXXXXXXXXXXXXXXQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKL 98
           V+PEHI                    QGIDPD PPEL FIKRP L LH+ E V GF+FKL
Sbjct: 55  VTPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKL 114

Query: 99  MTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKD 158
           MTYNCLAQALIRRKLFP SGDALKWYRRS+VLLNEF++YNADVICLQEID+IQ+QSFWK+
Sbjct: 115 MTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKE 174

Query: 159 ELAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLI 218
           E +KLGY+ Q+HR ++KNHGVAI+W+R+ F   DKMLIDFD+E SG+IP RTTTNN GL+
Sbjct: 175 EFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLV 234

Query: 219 LSLKFSDKVAQ---EHNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNV 275
           L+LKFS+KV     + + KK+GI++GT+HLFWHPFGT+ERTRQCY+VL K++EF HRVNV
Sbjct: 235 LALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNV 294

Query: 276 LQNGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRX 335
           LQN NDGD SHW+PFFCGDFNSQPFD+PYLSMT KP+ Y KRAKTVIECSTS+ FSK+R 
Sbjct: 295 LQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVR- 353

Query: 336 XXXXXXXXXXXXNIEKFGTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSV 395
                       NIEKFG DQP+ PVP+ + A + + ELV++M  LHNSLDMRAVSLYSV
Sbjct: 354 DGEEGADEEEGGNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSV 413

Query: 396 AYRKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWDF-SDCKEIDSLESFEREN 454
           AY+ VHPENAGLDN+RGEPEISNWA+TWRGLLDYLF+I+ WD  S+C+E+DSL+ FE++N
Sbjct: 414 AYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDN 473

Query: 455 SLKIRGLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCELEL 494
            +K RG LR+PPG EMT+HGQPH GEY SDHL M+C++EL
Sbjct: 474 EIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIEL 513

>NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850
          Length = 556

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/435 (71%), Positives = 361/435 (82%), Gaps = 5/435 (1%)

Query: 65  QGIDPDFPPELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFPTSGDALKWY 124
           QG+DP+  P+LQFI+RPIL LH+ E V GFK  +MTYNCLAQALIRRKLFP SGDALKW+
Sbjct: 123 QGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGDALKWF 182

Query: 125 RRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVAIVWK 184
           +RSKVL NEFK+YN DVICLQEID++QYQSFWK E  K+GY+SQFHR+ SKNHGVAI+W+
Sbjct: 183 KRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRKQSKNHGVAIIWR 242

Query: 185 REYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKVAQE--HNLKKTGIIVGT 242
           +E F +TDKMLIDFD+E SG+IPPRTTTNNAGL LSLKF++K   +  +   + GIIVGT
Sbjct: 243 KELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGT 302

Query: 243 THLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPFDS 302
           THLFWHPFGT+ERTRQCYVVLNK+KEF HR+NVLQN NDGD SHWYPFFCGDFNSQPFD+
Sbjct: 303 THLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQPFDT 362

Query: 303 PYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRXXXXXXXXXXXXXNIEKFGTDQPDHPVP 362
           PYLSMT KPI Y  RAKTVIECSTSY FSK R             NIEKFG DQP  PVP
Sbjct: 363 PYLSMTSKPIHYKGRAKTVIECSTSYKFSKKR-DGEEDADEEEGGNIEKFGKDQPQTPVP 421

Query: 363 QHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEISNWAHT 422
            H+ A + +++LV+ M+ LHNSLDMRA+SLY V YRKVHPENAGLDN+ GEPEISNWAHT
Sbjct: 422 DHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHPENAGLDNDCGEPEISNWAHT 481

Query: 423 WRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTE--HGQPHTGE 480
           W GLLDY+ FI+HW F DC+ +D+LE FE+ENS+K+RG LR+PP  EM++  HGQPHTGE
Sbjct: 482 WNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGYLRMPPSTEMSKHGHGQPHTGE 541

Query: 481 YPSDHLCMLCELELV 495
           YPSDHL M+CELEL+
Sbjct: 542 YPSDHLSMICELELI 556

>YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON}
           NGL2Protein involved in 5.8S rRNA processing; Ccr4p-like
           RNase required for correct 3'-end formation of 5.8S rRNA
           at site E; similar to Ngl1p and Ngl3p
          Length = 515

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/460 (67%), Positives = 366/460 (79%), Gaps = 5/460 (1%)

Query: 39  VSPEHIXXXXXXXXXXXXXXXXXXXXQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKL 98
           V+PEHI                    QG+DPD PPEL FI+RP L LH+ E V GF+FKL
Sbjct: 55  VTPEHIAKVRAEREVMRKAKRDAMLAQGVDPDCPPELHFIRRPFLSLHEAEPVTGFRFKL 114

Query: 99  MTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKD 158
           MTYNCLAQALIRRKLFP SGDALKWYRRSKVLLNEFKYYN+DVICLQEID+IQ+QSFWKD
Sbjct: 115 MTYNCLAQALIRRKLFPDSGDALKWYRRSKVLLNEFKYYNSDVICLQEIDHIQFQSFWKD 174

Query: 159 ELAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLI 218
           E +KLGYD Q++R A+KNHGVAI+W+RE F   DKMLID+D+ESS  I  RTTTNN GL+
Sbjct: 175 EFSKLGYDGQYYRNATKNHGVAIMWRRELFHQVDKMLIDYDKESSESISTRTTTNNVGLV 234

Query: 219 LSLKFSDKVAQ---EHNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNV 275
           L+LKFS+KV     + + KK GI++GTTHLFWHPFGT+ERTRQCY+VL K+KEF HRVNV
Sbjct: 235 LALKFSEKVLSNLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYIVLKKMKEFMHRVNV 294

Query: 276 LQNGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRX 335
           LQN NDGD SHW+PFFCGDFNSQPFD+PYLSMT KP+ Y  RAKTVI CSTSY FSK+R 
Sbjct: 295 LQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYRNRAKTVIGCSTSYKFSKVR- 353

Query: 336 XXXXXXXXXXXXNIEKFGTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSV 395
                       NIEK+G DQP+ PVP+ + A + + ELV++M  LHNSLDMRA+SLYSV
Sbjct: 354 DGEEGADDEEGGNIEKYGKDQPESPVPEKFHANEEQSELVDKMAQLHNSLDMRAISLYSV 413

Query: 396 AYRKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWD-FSDCKEIDSLESFEREN 454
            Y+ VHPENAGLDN+RGEPEISNWA+TWRGLLDYLF+++ WD  S+C+E+++L  FE+EN
Sbjct: 414 GYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDPQSNCQEVETLGDFEKEN 473

Query: 455 SLKIRGLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCELEL 494
            +K RG LR+PPG EMT+HGQPH GEY SDHL M+C+LEL
Sbjct: 474 KVKCRGFLRMPPGNEMTKHGQPHVGEYASDHLSMVCDLEL 513

>SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar to
           uniprot|Q03264 Saccharomyces cerevisiae YMR285C
          Length = 505

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/457 (66%), Positives = 367/457 (80%), Gaps = 3/457 (0%)

Query: 39  VSPEHIXXXXXXXXXXXXXXXXXXXXQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKL 98
           +SPEHI                     G+DP+ PP+LQFIKRP+L LH+ E V+GFKFK+
Sbjct: 49  ISPEHIAEKRAQREAARAAKREAMLAHGLDPNVPPDLQFIKRPLLCLHEEEPVKGFKFKI 108

Query: 99  MTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKD 158
           MTYN LAQALIRRKLFP+SG+A+KW++RSKVLLNEFK+Y+ADV CLQEID+IQYQ+FWK+
Sbjct: 109 MTYNALAQALIRRKLFPSSGNAVKWFKRSKVLLNEFKHYDADVHCLQEIDHIQYQAFWKE 168

Query: 159 ELAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLI 218
           E  KLGY SQFHR  +KNHGVAIVW+   F M D ML+D+D+E SGDIPPRTTT NAGLI
Sbjct: 169 EFQKLGYASQFHRIGTKNHGVAIVWRCSLFTMVDTMLVDYDKEPSGDIPPRTTTKNAGLI 228

Query: 219 LSLKFSDKVAQEH-NLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQ 277
           L+LKF+DKV  +    KK+GI++GTTHLFWHPFGTFERTRQCYVVLNK+KE  HRVNVLQ
Sbjct: 229 LALKFTDKVLNQFPGTKKSGILIGTTHLFWHPFGTFERTRQCYVVLNKMKELIHRVNVLQ 288

Query: 278 NGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRXXX 337
           N  D D+SHWYPF CGDFNSQPFD+PYLSMT KP+ Y  RAKTVIECSTS+TFSK+R   
Sbjct: 289 NNQDRDYSHWYPFICGDFNSQPFDTPYLSMTSKPVTYRGRAKTVIECSTSFTFSKLR--D 346

Query: 338 XXXXXXXXXXNIEKFGTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAY 397
                     NIEKFG  QP+HPVP+ + A + +  LV+QM+SLHNSLDMRA+SLY+V Y
Sbjct: 347 GEEGEDEEGGNIEKFGKGQPEHPVPKEFHATEEQTALVKQMESLHNSLDMRAISLYAVGY 406

Query: 398 RKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLK 457
           + VHPENAGLDN+ GEPEISNWA TWRGLLDY+FF+++W+ +D   +D ++ FEREN +K
Sbjct: 407 KHVHPENAGLDNDSGEPEISNWAETWRGLLDYIFFVKNWNGTDRSSVDKIDVFERENGIK 466

Query: 458 IRGLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCELEL 494
           IRGLLR+PPG+EMT+HGQPH GEYPSDHL M+CE+EL
Sbjct: 467 IRGLLRMPPGEEMTKHGQPHEGEYPSDHLSMMCEIEL 503

>Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/460 (67%), Positives = 365/460 (79%), Gaps = 5/460 (1%)

Query: 39  VSPEHIXXXXXXXXXXXXXXXXXXXXQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKL 98
           V+PEHI                    QG+DPD PPEL FIKRP L LH+ E V GF+FKL
Sbjct: 55  VTPEHIAKIRAERDAMRKAKRDAMLAQGVDPDCPPELHFIKRPFLVLHEKEPVTGFRFKL 114

Query: 99  MTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKD 158
           MTYNCLAQALIRRKLFP SGDALKWYRRS+VLLNEFKYY ADVICLQEID+IQ+QSFWKD
Sbjct: 115 MTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFKYYKADVICLQEIDHIQFQSFWKD 174

Query: 159 ELAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLI 218
           E  KLGYD Q++R ++KNHGVAI+W+RE F   DKMLID+D+E+S +I  RTTTNN GL+
Sbjct: 175 EFNKLGYDGQYYRNSTKNHGVAIMWRREMFQQVDKMLIDYDKETSENISTRTTTNNVGLV 234

Query: 219 LSLKFSDKVAQE---HNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNV 275
           L+LKFS+KV       + KK GI++GTTHLFWHPFGT+ERTRQCYVVL K+KEF HRVNV
Sbjct: 235 LALKFSEKVLSNLSKSSSKKCGILIGTTHLFWHPFGTYERTRQCYVVLKKMKEFMHRVNV 294

Query: 276 LQNGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRX 335
           LQN NDGD SHW+PFFCGDFNSQPFD+PYLSMT KP+ Y  RAKTVIECSTS+ FSK R 
Sbjct: 295 LQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKNRAKTVIECSTSFKFSKAR- 353

Query: 336 XXXXXXXXXXXXNIEKFGTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSV 395
                       NIEK+G DQP+ PVP++Y A + + ELV++M  LHNSLDMRA+SLYSV
Sbjct: 354 DGDESADDEEGGNIEKYGKDQPESPVPENYHANEEQIELVDKMAQLHNSLDMRAISLYSV 413

Query: 396 AYRKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWDF-SDCKEIDSLESFEREN 454
            YR VHPENAGLDN+RGEPEISNWA+TWRGLLDYLF+++ WD  S+C+E+++L  FE+ N
Sbjct: 414 GYRNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDLRSNCQEVENLGDFEKVN 473

Query: 455 SLKIRGLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCELEL 494
            +K RG LR+PPGKEMT+HGQPH GEY SDHL M+C+LEL
Sbjct: 474 EMKCRGFLRMPPGKEMTKHGQPHVGEYASDHLSMVCDLEL 513

>TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}
           Anc_8.850 YMR285C
          Length = 492

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/458 (65%), Positives = 366/458 (79%), Gaps = 2/458 (0%)

Query: 39  VSPEHIXXXXXXXXXXXXXXXXXXXXQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKL 98
           +SPEH+                    +G+DPD PPELQFIKRP+L LH+ E +EG  FKL
Sbjct: 35  MSPEHVAKVRAEREAARKAKREEMLAKGMDPDHPPELQFIKRPLLTLHEDEPIEGLSFKL 94

Query: 99  MTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKD 158
           +TYNCLAQALIRRKLFP SGD+LKW+RRSKVL  EFK+YNADV+CLQEIDYIQYQ FWKD
Sbjct: 95  LTYNCLAQALIRRKLFPDSGDSLKWFRRSKVLQYEFKHYNADVLCLQEIDYIQYQQFWKD 154

Query: 159 ELAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLI 218
           EL KLGYD+QF++Q  KNHGV+I WKR  F +TD+MLID+D+ESSG I  RT T+N+GLI
Sbjct: 155 ELDKLGYDTQFYKQPCKNHGVSIAWKRHLFQLTDRMLIDYDKESSGKIEKRTLTHNSGLI 214

Query: 219 LSLKFSDKVAQE-HNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQ 277
           L+LKF+D   Q   +++K+GI+VGT+HLFWHPFGT+ERTRQCYVVL K+KEF  RVNVLQ
Sbjct: 215 LALKFTDAAKQSCPHIRKSGILVGTSHLFWHPFGTYERTRQCYVVLKKMKEFMKRVNVLQ 274

Query: 278 NGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRXXX 337
           N NDG+ SHW PFFCGDFNSQPFD+PYLSMT KP+EY+ RAKTV+ECSTSYTFSK+R   
Sbjct: 275 NNNDGNLSHWVPFFCGDFNSQPFDTPYLSMTSKPVEYTGRAKTVVECSTSYTFSKLR-NG 333

Query: 338 XXXXXXXXXXNIEKFGTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAY 397
                     NIEKFG DQP  PVP+ ++A   +++LVE+MQ LHNS+DMRA+SLY+V Y
Sbjct: 334 EEDAEDEEGGNIEKFGKDQPQTPVPETFDATPEQQKLVEEMQELHNSIDMRAISLYAVGY 393

Query: 398 RKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLK 457
            +VHPEN+G+DN+RGEPE+SNWA+TWRGLLDY+  I  WD SD K++DSLE+FE+ENSLK
Sbjct: 394 GEVHPENSGIDNDRGEPEMSNWANTWRGLLDYILLITQWDSSDRKKVDSLETFEKENSLK 453

Query: 458 IRGLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCELELV 495
           +RGLLR+PP  EM+ HGQPH GEY SDHL M+C +EL 
Sbjct: 454 LRGLLRMPPASEMSHHGQPHEGEYASDHLSMMCTIELT 491

>NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON}
           Anc_8.850 YML118W
          Length = 568

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/428 (71%), Positives = 350/428 (81%), Gaps = 4/428 (0%)

Query: 71  FPPELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFPTSGDALKWYRRSKVL 130
            PPELQFIKRPIL LH+ E V+GFKF +MTYNCLAQALIRRKLFP SGDALKWYRRSKVL
Sbjct: 142 IPPELQFIKRPILYLHEEEPVQGFKFSMMTYNCLAQALIRRKLFPDSGDALKWYRRSKVL 201

Query: 131 LNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVAIVWKREYFVM 190
           LNEF YY+ D+ICLQE+D+IQYQSFWK E  KLGY SQ+HR+  KNHGV+I+W+R  F M
Sbjct: 202 LNEFTYYSPDIICLQEVDHIQYQSFWKTEFEKLGYQSQYHRKGVKNHGVSIIWRRSLFTM 261

Query: 191 TDKMLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKV-AQEHNLK--KTGIIVGTTHLFW 247
           TDKMLI+FD+ESSG++PPRTTTNN GLILSLKF+ +  AQ  N++  KTGII+GTTHLFW
Sbjct: 262 TDKMLIEFDKESSGNVPPRTTTNNVGLILSLKFTPEAKAQFKNVETTKTGIIIGTTHLFW 321

Query: 248 HPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPFDSPYLSM 307
           HPFGT+ERTRQCYVVLNK+KEF HRVNVLQN ND D SHWYPFFCGDFNSQPFDSPYLSM
Sbjct: 322 HPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDRDLSHWYPFFCGDFNSQPFDSPYLSM 381

Query: 308 TRKPIEYSKRAKTVIECSTSYTFSKMRXXXXXXXXXXXXXNIEKFGTDQPDHPVPQHYEA 367
            RKP+EYS RAKTVIECSTSY FSK R             NIEKFG DQP  PVP+ + A
Sbjct: 382 VRKPVEYSGRAKTVIECSTSYKFSKKR-DGEEDVDDEEGGNIEKFGIDQPQTPVPEEFIA 440

Query: 368 KDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEISNWAHTWRGLL 427
              +  LV+ M+ LHNSL+MRA+SLY V Y+ VHPENA +DNE GEPEISNWAHTW GLL
Sbjct: 441 NGEQTILVKDMEKLHNSLNMRAISLYGVGYKNVHPENASIDNECGEPEISNWAHTWNGLL 500

Query: 428 DYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTEHGQPHTGEYPSDHLC 487
           DYL F++ W FSDC + ++L+ FE  NS++IRG LR+PP  EMT+HGQPH GEYPSDHL 
Sbjct: 501 DYLLFVKEWTFSDCTKTETLKQFEESNSMRIRGFLRMPPANEMTKHGQPHVGEYPSDHLS 560

Query: 488 MLCELELV 495
           MLC +EL+
Sbjct: 561 MLCSIELL 568

>Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON}
           complement(188..1699) [1512 nt, 504 aa]
          Length = 503

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/458 (67%), Positives = 358/458 (78%), Gaps = 3/458 (0%)

Query: 40  SPEHIXXXXXXXXXXXXXXXXXXXXQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKLM 99
           SPE I                    +G+DPD+PPELQFIKRP+L LH+ E V GF F LM
Sbjct: 46  SPEEIERKRAERAAAKEQKRKELLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLM 105

Query: 100 TYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDE 159
           TYNCLAQALIRRKLFP SG+A+KW+RRSKVLL EF++YN+DVICLQEID+IQYQ+FWK E
Sbjct: 106 TYNCLAQALIRRKLFPDSGEAVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVE 165

Query: 160 LAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLIL 219
             KLGY+SQFHR ASKNHGVAIVWKRE F MTD+MLIDFD+E+S DIPPRT TNN GLIL
Sbjct: 166 FEKLGYESQFHRIASKNHGVAIVWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLIL 225

Query: 220 SLKFSDKVAQE--HNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQ 277
           SLKFSDK+      N K TGII+GTTHLFWHPFGT+ERTRQCYV+LNK+KEF HRVNVLQ
Sbjct: 226 SLKFSDKILSTLPKNTKTTGIIIGTTHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQ 285

Query: 278 NGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRXXX 337
           NGNDGD SHW PFFCGDFNSQPFDSPYLSMT KPIEY++RAKTVI+CSTSY FSK+R   
Sbjct: 286 NGNDGDLSHWVPFFCGDFNSQPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLR-NG 344

Query: 338 XXXXXXXXXXNIEKFGTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAY 397
                     NIEKFG DQP  PVP+ + A + +  LVE+M  +HN L MRA SLYSV Y
Sbjct: 345 EEDVDDEEGGNIEKFGKDQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGY 404

Query: 398 RKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLK 457
           + VH ENAG+DN RGEP ISNWA+TWRGLLDY+F +  WDF + + +DSLE FE ENS++
Sbjct: 405 KHVHAENAGIDNTRGEPIISNWANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIR 464

Query: 458 IRGLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCELELV 495
           +RG LR+P   EM +HGQPH GEY SDHL M+C +EL+
Sbjct: 465 LRGFLRMPLDSEMPKHGQPHEGEYASDHLSMICNIELL 502

>Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {ON}
           YMR285C (REAL)
          Length = 514

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/460 (66%), Positives = 362/460 (78%), Gaps = 5/460 (1%)

Query: 39  VSPEHIXXXXXXXXXXXXXXXXXXXXQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKL 98
           V+PEHI                     G+DPD PPEL FI+RP+L L +GE V GF+FKL
Sbjct: 54  VTPEHIAKVRAEREAMRKAKRDAMLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKL 113

Query: 99  MTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKD 158
           MTYNCLAQALIRRKLFP SGDALKW+RRSKVLLNEFKYYNADVICLQE+D+IQ+QSFWK 
Sbjct: 114 MTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKG 173

Query: 159 ELAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLI 218
           +  K+GYD Q+HR  +KNHGVAI+W+R  F   DKMLID+D+E+SG I  RTTTNN GL+
Sbjct: 174 KFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLV 233

Query: 219 LSLKFSDKV---AQEHNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNV 275
           L+LKFS +V     + + KK GI++GTTHLFWHPFGT+ERTRQCYVVL K+KEF HRVNV
Sbjct: 234 LALKFSKEVLSKLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNV 293

Query: 276 LQNGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRX 335
           LQN NDGD SHW+PFFCGDFNSQPFD+PYLSMT KP+ Y  RAKTVIECSTS+ FSK+R 
Sbjct: 294 LQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVR- 352

Query: 336 XXXXXXXXXXXXNIEKFGTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSV 395
                       NIEKFG DQP+ PVP+++ A D + E+V+ M  LHNSLDMRA+SLYSV
Sbjct: 353 DGEEGADDEEGGNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSV 412

Query: 396 AYRKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWDF-SDCKEIDSLESFEREN 454
            Y+ VHPENAGLDN+RGEPEISNWA+TWRGLLDYLF+I+ WD  S+ +E+++L  FE++N
Sbjct: 413 GYKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKN 472

Query: 455 SLKIRGLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCELEL 494
            +K RG LR+PP  EMT+HGQPH GEYPSDHL M+C+LEL
Sbjct: 473 EIKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLEL 512

>KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {ON}
           Anc_8.850 YMR285C
          Length = 511

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/459 (66%), Positives = 354/459 (77%), Gaps = 4/459 (0%)

Query: 39  VSPEHIXXXXXXXXXXXXXXXXXXXXQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKL 98
           + PEHI                    QG+DPD PPELQFI+RP+L L K E+  GF+FK+
Sbjct: 52  LDPEHIAKVRAEREAMRKSKQEAMLAQGLDPDLPPELQFIRRPLLALSKAESTAGFEFKI 111

Query: 99  MTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKD 158
           MTYNCLAQALIRRKLFP SG+A+KW+RRSKVLLNEFKYY++DVICLQE+D IQ+Q+FWK+
Sbjct: 112 MTYNCLAQALIRRKLFPDSGEAVKWFRRSKVLLNEFKYYDSDVICLQEVDRIQFQTFWKE 171

Query: 159 ELAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLI 218
           E  KLGYDSQFH + SKNHG++I+WKR  F MTDKMLID+D+E SG+IPPRTTTNN GL+
Sbjct: 172 EFDKLGYDSQFHAKPSKNHGISILWKRSLFTMTDKMLIDYDKEISGNIPPRTTTNNVGLV 231

Query: 219 LSLKFSDKVAQEH-NLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQ 277
           L+LKFS KV +   N +K+GIIVGTTHLFWHPFGT+ERTRQCY+VLNK KEF HRVNVLQ
Sbjct: 232 LALKFSPKVLERFPNTRKSGIIVGTTHLFWHPFGTYERTRQCYIVLNKTKEFMHRVNVLQ 291

Query: 278 NGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRXXX 337
           N ND    HWY FF GDFNSQPFD+PYLSMT KP++YS RAKTVIECSTSYTFSK R   
Sbjct: 292 NNNDEIKDHWYTFFGGDFNSQPFDTPYLSMTSKPVKYSNRAKTVIECSTSYTFSKSR-DG 350

Query: 338 XXXXXXXXXXNIEKFGTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAY 397
                     NIEKFG DQP  PVP  ++A   ++ LV  M+ LHNSLDMRA+SLYSV Y
Sbjct: 351 EEDAEDEEGGNIEKFGKDQPATPVPSFFDASSEQQSLVANMEKLHNSLDMRAISLYSVGY 410

Query: 398 RKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLK 457
             VH ENAGLDN RGEPEISNWAH W GLLDYLF I+ WDFSD  ++DSL+ FE EN LK
Sbjct: 411 GTVHIENAGLDNTRGEPEISNWAHAWNGLLDYLFVIKSWDFSDKIQVDSLKKFEDENELK 470

Query: 458 IRGLLRVPPGKEMTE--HGQPHTGEYPSDHLCMLCELEL 494
           ++  L++P   EM +  HGQPH GEYPSDHL M+C+LEL
Sbjct: 471 VKAFLKMPTKAEMGKFGHGQPHVGEYPSDHLSMICKLEL 509

>TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}
           Anc_8.850 YMR285C
          Length = 529

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/433 (67%), Positives = 353/433 (81%), Gaps = 4/433 (0%)

Query: 66  GIDPDFPPELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFPTSGDALKWYR 125
           G+DPD PPELQFI+RP+L LH  E  + F F LMTYNCLAQALIRRKLFP SG+A+KWYR
Sbjct: 95  GLDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGEAVKWYR 154

Query: 126 RSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVAIVWKR 185
           RS+VLLNEFKYYN D+ICLQEID+IQ+QSFW++E  K+GY SQFHR  SKNHGVAIVWK 
Sbjct: 155 RSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAIVWKN 214

Query: 186 EYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKVAQEH----NLKKTGIIVG 241
             F +TD+MLIDFD+E SGDI PRT TNN GLILSLK+SD V  ++    N  K+GII+G
Sbjct: 215 NLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIG 274

Query: 242 TTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPFD 301
           TTHLFWHPFGT+ERTRQC+V+LNKVKEF  RVNVLQN NDG+  HW  FFCGDFNSQPFD
Sbjct: 275 TTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFD 334

Query: 302 SPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRXXXXXXXXXXXXXNIEKFGTDQPDHPV 361
           +PYLS+T KP+EY +RAK VIECSTSYT+SK+R             NIEKFG DQP  PV
Sbjct: 335 TPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNGDDDEAEDEEGGNIEKFGKDQPQTPV 394

Query: 362 PQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEISNWAH 421
           P  Y     + +LV +M+SLHNSL+M+A SLY+V Y+KVHPEN+GLDN++GEPEISNWAH
Sbjct: 395 PDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGEPEISNWAH 454

Query: 422 TWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTEHGQPHTGEY 481
           +WRGLLDY+F++ HWDFSDCKE++  E FE++N +K+RG LR+PP  EM+++GQPH GEY
Sbjct: 455 SWRGLLDYIFYVDHWDFSDCKEVEDFEKFEKKNHMKLRGYLRMPPATEMSKYGQPHQGEY 514

Query: 482 PSDHLCMLCELEL 494
           PSDHL M+C++EL
Sbjct: 515 PSDHLSMMCKIEL 527

>KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 495

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/457 (65%), Positives = 350/457 (76%), Gaps = 3/457 (0%)

Query: 39  VSPEHIXXXXXXXXXXXXXXXXXXXXQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKL 98
           VSPEHI                    +G+DPDFPP+LQFI RP+L L+  EN  GF FKL
Sbjct: 39  VSPEHIAEVRAQREAAKKKKREDMIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKL 98

Query: 99  MTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKD 158
           MTYNCLAQALIRRKLFPTSG+ALKW++RS+VLLNEF +YN+DV+CLQE+DYIQYQSFWK+
Sbjct: 99  MTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKE 158

Query: 159 ELAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLI 218
           E  KLGY+SQFHR  +KNHG+AIVWKR+ F M DKMLID+D+E SG + PRTTT N GL 
Sbjct: 159 EFEKLGYESQFHRHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLA 218

Query: 219 LSLKFSDKV-AQEHNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQ 277
           ++L F+ KV A+     K GIIVGTTHLFWHPFGTFERTRQCYV+LNK+KEF HR+NVLQ
Sbjct: 219 IALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQ 278

Query: 278 NGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRXXX 337
           +      + WYPFFCGDFNSQPFD+PYLS++ KP+ Y  RAKTVIECSTSYTFSK R   
Sbjct: 279 DKGATQENLWYPFFCGDFNSQPFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKAR--D 336

Query: 338 XXXXXXXXXXNIEKFGTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAY 397
                     NIEKFG  QP+HPVP+ + A + ++ LVE M SLHNSLDMR +S+YSV Y
Sbjct: 337 GEECDDEEGGNIEKFGDGQPEHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGY 396

Query: 398 RKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLK 457
           + VH ENAGLDN   EPEISNWA TWRGLLDY+FFI+ WDFSD    + LE+F+ EN +K
Sbjct: 397 KHVHAENAGLDNNFNEPEISNWAETWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIK 456

Query: 458 IRGLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCELEL 494
           IRGLLR+PP KEM  HGQPH GEY SDHL M+CELEL
Sbjct: 457 IRGLLRMPPAKEMPNHGQPHEGEYGSDHLSMMCELEL 493

>Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {ON}
           YMR285C (NGL2) - DNase/RNase (putative); CCR4 C-terminal
           homolog; displays homology to drosophila Angelgene;
           homolog to ngl1 and ngl3  [contig 39] FULL
          Length = 494

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/455 (64%), Positives = 350/455 (76%), Gaps = 4/455 (0%)

Query: 41  PEHIXXXXXXXXXXXXXXXXXXXXQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKLMT 100
           PEHI                    +G+DP+FPP+LQFI RP+LPL    + EGF FK+MT
Sbjct: 41  PEHIAEVRAKREAAKKAKREEMLARGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMT 100

Query: 101 YNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDEL 160
           YNCLAQALIRRKLFPTSG+ALKW++RS+VLLNEF +Y ADV CLQEIDYIQYQSFWK+E 
Sbjct: 101 YNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEF 160

Query: 161 AKLGYDSQFHRQASKNHGVAIVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILS 220
            KLGYDSQFHR  +KNHG+AIVWKR+ F M DKML+D+D+E SG + PRTTT N GL+L+
Sbjct: 161 GKLGYDSQFHRHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLA 220

Query: 221 LKFSDKVAQEH-NLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNG 279
           L FS KV  ++    K GI+VGTTHLFWHPFGTFERTRQCYV+LNK+K+F HRVNVLQ+G
Sbjct: 221 LAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDG 280

Query: 280 NDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRXXXXX 339
           +  +   WYPFFCGDFN+QPFD+PYLSM+ KP+ Y  RAKTVIECSTSYTFSK R     
Sbjct: 281 SSPE-KKWYPFFCGDFNAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKAR--DGE 337

Query: 340 XXXXXXXXNIEKFGTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRK 399
                   NIEKFG  QP+HPVP  YEA   ++ELV+ M  LHNSLDMRA+S+YSVAY+ 
Sbjct: 338 ECDDEEGGNIEKFGDGQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKH 397

Query: 400 VHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIR 459
           VHPENAG DN   EPEISNWA TWRGLLDY+FFI+ W+F+D K  + L++FE+EN +KI 
Sbjct: 398 VHPENAGRDNTHNEPEISNWAETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKIL 457

Query: 460 GLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCELEL 494
            LLR+PP +EM  HGQPH GEY SDHL ++CE+EL
Sbjct: 458 SLLRMPPSEEMPNHGQPHEGEYGSDHLSLMCEIEL 492

>KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 516

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/462 (59%), Positives = 349/462 (75%), Gaps = 7/462 (1%)

Query: 39  VSPEHIXXXXXXXXXXXXXXXXXXXXQGIDPDFPPELQFIKRPILPLHKGENVEGFK--- 95
           ++PE+I                    QGIDP  P +L+FIKRP+L + +  + +  +   
Sbjct: 56  ITPEYIAEMRAKREAAKIAKKEALIAQGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVC 115

Query: 96  -FKLMTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQS 154
              +MTYNCLAQALIRR LFPTSG+A+KW++RS+VLLNEFKYYN DV+CLQEID +QY+S
Sbjct: 116 PISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKS 175

Query: 155 FWKDELAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNN 214
           FWK E  KLGY  QFH   +KNHGV I WK + F MTDKMLID+D+E++G I PRTTT N
Sbjct: 176 FWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKN 235

Query: 215 AGLILSLKFSDKVAQEH-NLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRV 273
            G++LSLKF  KV +++ + K +GII+GTTHLFWHPFGT+ERTRQCY+VL KVKEF +R+
Sbjct: 236 VGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRI 295

Query: 274 NVLQNGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKM 333
           NVLQN  DGD+SHW  FFCGDFNSQPFD+PYLS+T KP+EY+ RAKTVIECSTS+TFSK+
Sbjct: 296 NVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKL 355

Query: 334 RXXXXXXXXXXXXXNIEKFGTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLY 393
           R             NIEKFG  QP+ PVP+ +   + +++L E M++LHN +DMRA+SLY
Sbjct: 356 RDGDEGEGEEGG--NIEKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLY 413

Query: 394 SVAYRKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWDFSDCKEIDSLESFERE 453
           S+AY KVHPEN+GLDN+R EPEISNWAH WRGLLDYL+++  WD  DC +ID L +FE+ 
Sbjct: 414 SIAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQN 473

Query: 454 NSLKIRGLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCELELV 495
             +++  LLR+PP KEMTEHGQPH GEYPSDHLCM+ +L ++
Sbjct: 474 YGVQVLELLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKLGII 515

>KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {ON}
           Anc_8.850 YMR285C
          Length = 482

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/439 (64%), Positives = 342/439 (77%), Gaps = 8/439 (1%)

Query: 65  QGIDPDFPPELQFIKRPILPLHK----GENVEGFKFKLMTYNCLAQALIRRKLFPTSGDA 120
           QG   D P EL+FI+RP+L +H     G         LMTYNCLAQALIRRKLFP SG A
Sbjct: 43  QGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPA 102

Query: 121 LKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVA 180
           LKWYRRS+VLLN+FK+Y  DV+CLQE+D +Q+ SFW+ E  KLGY +QFH++ +KNHGVA
Sbjct: 103 LKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVA 162

Query: 181 IVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKVAQEH-NLKKTGII 239
           +VW+ + F M DKMLIDFD+E SGD+PPRTTTNNAGL+++LKF+++    H +  ++GI+
Sbjct: 163 VVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGIL 222

Query: 240 VGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQP 299
           VGTTHLFWHPFGTFERTRQCYVVLNK+KEF HRVNVLQN NDG++ HW+PFFCGDFNSQP
Sbjct: 223 VGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQP 282

Query: 300 FDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMR-XXXXXXXXXXXXXNIEKFGTDQPD 358
           +D+PYLSMT KP+ YS RA+TVIECSTSYTFSK R              NIE FG DQP 
Sbjct: 283 YDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRDGEDAAADEEEEGGNIEIFGKDQPH 342

Query: 359 HPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEISN 418
           HPVP  +E    +  LV QM++LHNSLDMRAVSLYSV YR VHPENAG DN RGEPEISN
Sbjct: 343 HPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEISN 402

Query: 419 WAHTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTE--HGQP 476
           WAHTW GLLDYLF++ HWDF D   +D+LE FE+++ + ++ LLR+P  +EM +  HGQP
Sbjct: 403 WAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQP 462

Query: 477 HTGEYPSDHLCMLCELELV 495
           HTGEYPSDHL M+C+LEL 
Sbjct: 463 HTGEYPSDHLAMVCDLELA 481

>ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR285C (NGL2) and
           YML118W (NGL3)
          Length = 504

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/423 (60%), Positives = 324/423 (76%), Gaps = 4/423 (0%)

Query: 74  ELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNE 133
           ++ FIKRP+L +  G+  +GF F++MTYNCLAQALIRRKLFPTSG+ALKW++RSKVLL+E
Sbjct: 84  DVGFIKRPLL-VCNGDEAKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142

Query: 134 FKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDK 193
            +YYN DVICLQEID+ QY+SFW D L   GY S+FHR   KNHG+AIVW+R  F   D+
Sbjct: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202

Query: 194 MLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKVAQEH-NLKKTGIIVGTTHLFWHPFGT 252
            LIDFD E SG+I  RTTT N GLI++L+++D++ + +    ++GI+VGT+HLFWHPFGT
Sbjct: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGT 262

Query: 253 FERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPI 312
           +ER RQCY++L+++K F  R+ +L+ G+ G  S W+PFFCGDFNSQPFD+PYLSM  KPI
Sbjct: 263 YERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPI 322

Query: 313 EYSKRAKTVIECSTSYTFSKMRXXXXXXXXXXXXXNIEKFGTDQPDHPVPQHYEAKDHER 372
            Y  RA+TVIECSTSY FS +R             NIEKFG  QP+ PVP  ++    +R
Sbjct: 323 IYEGRARTVIECSTSYKFSSLRDGCAADEEEGG--NIEKFGAGQPETPVPDSFDGTPEQR 380

Query: 373 ELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFF 432
            LV+ MQSLHN+LDMRA+SLYS+AYR VHPENAG+DN RGEPEISNWAH WRGLLDY+ +
Sbjct: 381 ALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIMY 440

Query: 433 IRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCEL 492
           +  WDFSD  E+D +  F++  S+ +R LLRVPP  EM  HGQPH GEYPSDHL ++CEL
Sbjct: 441 VMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCEL 500

Query: 493 ELV 495
           EL+
Sbjct: 501 ELL 503

>Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii ABL118W
          Length = 487

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/422 (61%), Positives = 324/422 (76%), Gaps = 7/422 (1%)

Query: 75  LQFIKRPILPLHKGENV-EGFKFKLMTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNE 133
           L+FI RP+LPL   + V +GF F LMTYNCLAQ+LIRR LFPTSG ALKW +RS VLL E
Sbjct: 69  LEFIARPMLPLKVTQTVHKGFSFSLMTYNCLAQSLIRRSLFPTSGRALKWTKRSMVLLKE 128

Query: 134 FKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDK 193
           FK+YNADV+CLQEIDY QY SFW + L+ LGY S+FHR  +K+HGVAI WK++ F+  D+
Sbjct: 129 FKHYNADVLCLQEIDYTQYYSFWMNRLSNLGYGSRFHRMDNKSHGVAIFWKKDLFIWMDQ 188

Query: 194 MLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKVAQEH-NLKKTGIIVGTTHLFWHPFGT 252
           MLI+FD E SG+I PR TTNN G+IL+L FSDKV Q      K+GIIVGT+HLFWHPFGT
Sbjct: 189 MLINFDNEDSGEIEPRKTTNNVGMILALGFSDKVKQSFPGTVKSGIIVGTSHLFWHPFGT 248

Query: 253 FERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPI 312
           +ERTRQCYV+LNK+KEF HRV++ QN +  D + WYPFFCGDFNSQPFD+PYLS+T KP+
Sbjct: 249 YERTRQCYVILNKMKEFIHRVHLSQNEHHTDLTKWYPFFCGDFNSQPFDAPYLSITSKPV 308

Query: 313 EYSKRAKTVIECSTSYTFSKMRXXXXXXXXXXXXXNIEKFGTDQPDHPVPQHYEAKDHER 372
            YS RAKTVIECS +Y F  +              +    G D+P  PVP+ ++      
Sbjct: 309 LYSGRAKTVIECSAAYKFPDL-----GAGARGANEDGGTVGEDRPVDPVPESFQPTAEVS 363

Query: 373 ELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFF 432
            LV++M+ LHNSLDMRA+SLY+VAY+ VHP+NAGLDNERGEPEISNWA+TWRGLLDY+ +
Sbjct: 364 SLVQKMEKLHNSLDMRAISLYAVAYKHVHPDNAGLDNERGEPEISNWAYTWRGLLDYIMY 423

Query: 433 IRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCEL 492
           I  W  S+  E+DSLESFE+ + + ++ +LR+PP KEM+ HGQPH GEYPSDHL M+C+L
Sbjct: 424 ITPWQASNNVEVDSLESFEKLSHITVQEMLRMPPAKEMSSHGQPHDGEYPSDHLAMMCKL 483

Query: 493 EL 494
           E+
Sbjct: 484 EV 485

>NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850
           YML118W
          Length = 498

 Score =  488 bits (1256), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 231/447 (51%), Positives = 308/447 (68%), Gaps = 27/447 (6%)

Query: 66  GIDPDFPPELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFPTSGDALKWYR 125
           G +PD P ELQFIKRP+L LH  + V+G   K+MTYNCLAQ+LI+R LFP SG ALKW R
Sbjct: 61  GFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWVR 120

Query: 126 RSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVAIVWKR 185
           RSKVLLNE KYY++D++ LQEID++Q++ +WK  LAKLGYD +F+++  K HGV I WKR
Sbjct: 121 RSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKR 180

Query: 186 EYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKVAQEHNLKKTGIIVGTTHL 245
             F     + IDFD   SG I PRT T N GL+++L+F +K   +  +KK G+I+GTTHL
Sbjct: 181 NLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNK--DKSAIKKKGVIIGTTHL 238

Query: 246 FWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPFDSPYL 305
           FWH FGTFERTRQCYV+++++ +F  ++        G    WYPFF GDFNSQP D+PY+
Sbjct: 239 FWHLFGTFERTRQCYVMMDQMDKFMKKL--------GGIEKWYPFFTGDFNSQPKDAPYV 290

Query: 306 SMTRKPIEYSKRAKTVIECSTSYTFSKMRXXXXXXXXXXXXXNIEKFGTD---------- 355
           S+T KP+ +    K VIECS +Y +SK R               E   +D          
Sbjct: 291 SITSKPVSFQNETKIVIECSAAYKYSKKRNGEEEEKNEGKEKQHEIDSSDSSDAETDEEK 350

Query: 356 ------QPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDN 409
                 QP +  P H+     + ELV Q+ +LHNSL++RA+SLYSV YRKV PENA ++N
Sbjct: 351 EEIIPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYINN 410

Query: 410 ERGEPEISNWAHTWRGLLDYLFFIRHWDF-SDCKEIDSLESFERENSLKIRGLLRVPPGK 468
           +RGEPE+S WA  W GLLDY+FF++HWD  ++ +++DSL++FEREN++K+RGLL++P  K
Sbjct: 411 DRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQSK 470

Query: 469 EMTEHGQPHTGEYPSDHLCMLCELELV 495
           EM EH  P+ GEYPSDHLCM+ +LEL+
Sbjct: 471 EMCEHAIPYKGEYPSDHLCMMIQLELL 497

>TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {ON}
           Anc_8.850 YMR285C
          Length = 480

 Score =  451 bits (1161), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 227/445 (51%), Positives = 300/445 (67%), Gaps = 21/445 (4%)

Query: 65  QGIDPDFPPELQFIKRPIL--PLHKGENVEGFKFKLMTYNCLAQALIRRKLFPTSGDALK 122
           QG DPD P EL FIKRPIL  P H   N +GFKF LMTYNCLAQA+IRR++F  SG ALK
Sbjct: 40  QGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNCLAQAMIRREVFSDSGPALK 99

Query: 123 WYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDEL-AKLGYDSQFHRQASKNHGVAI 181
           W+RRSKVL+NE  YYN D++CLQEID  QY++FWKD+L + L  ++ +++Q  K+HGV I
Sbjct: 100 WFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESNLNMNTFYYKQKIKHHGVLI 159

Query: 182 VWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKVAQEH--NL------ 233
            WK+  F   D M++DFD   + +I  RT T N  + ++LKF+D+   ++  NL      
Sbjct: 160 AWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSFDQ 219

Query: 234 KKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCG 293
              G I+ TTHLFWHPFGTFERTRQCY++L K+K+F   +NV     D   +HWYPF CG
Sbjct: 220 NDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNV----KDHLKTHWYPFICG 275

Query: 294 DFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRXXXXXXXXXXXXXNIEKFG 353
           DFNS P D+PYLSMT KPIEY+ R K VIECST+Y FSK R               EK  
Sbjct: 276 DFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRRNGEIGDSDEEE----EKKL 331

Query: 354 TDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNERGE 413
            +QP   VP  +     + +LV Q+QSLHN L +RA SLY +AY+ V P N  ++N+RGE
Sbjct: 332 INQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGLAYKIVDPSNVNINNDRGE 391

Query: 414 PEISNWAHTWRGLLDYLFFIRHWDFSD-CKEI-DSLESFERENSLKIRGLLRVPPGKEMT 471
           PE ++WA +W G+LDY+ ++ +WD ++   EI +SLE FE+ N L I+GLL++P  K+M 
Sbjct: 392 PEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKNNQLLIKGLLKMPLNKDMP 451

Query: 472 EHGQPHTGEYPSDHLCMLCELELVN 496
            H QP   EYPSDH+ +LCE+E+++
Sbjct: 452 FHTQPFEREYPSDHISILCEMEILD 476

>NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850
          Length = 476

 Score =  449 bits (1155), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 225/465 (48%), Positives = 295/465 (63%), Gaps = 17/465 (3%)

Query: 40  SPEHIXXXXXXXXXXXXXXXXXXXXQGIDPDFPPELQFIKRPILPLHKGENVEG---FKF 96
           SPE+I                    QG+DPD PPELQF +RP L LH  E   G    +F
Sbjct: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEF 78

Query: 97  KLMTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFW 156
            ++TYNCLAQ LI R +FP SG+ALKW RRSK ++NE KYYN D++CLQEID+   + FW
Sbjct: 79  SILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFW 138

Query: 157 KDELAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAG 216
             +   LGY  +F ++  K HGV I W+   F   D+  +DFD   +GDIPPRT T N G
Sbjct: 139 SVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIG 198

Query: 217 LILSLKFSDKVAQEHNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVL 276
           LI++L+F D      + +  GI+V TTHLFWHPFGTFERTRQCY++L+++ +F   +N  
Sbjct: 199 LIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFLN-- 256

Query: 277 QNGNDGDHS---HWYPFFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKM 333
                 +HS   +WYPF  GDFNSQP D+PY+SMT KPI+Y    +TVIECSTSYT+SK 
Sbjct: 257 ------EHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKK 310

Query: 334 RX--XXXXXXXXXXXXNIEKFGTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVS 391
           R                 E+F   QP  P P  ++    +  LV  +Q LHNSL  RA+S
Sbjct: 311 RNGDMDVNEKEQSDSEEDEEFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAIS 370

Query: 392 LYSVAYRKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWDFSDCK-EIDSLESF 450
           LYSV YR VHPEN+ ++N RGEPE S+W   W GLLDY+F+I+ W+  D   ++++LE+F
Sbjct: 371 LYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETF 430

Query: 451 ERENSLKIRGLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCELELV 495
           E+ N+LKI G L++P  KEM  H QP+ GEYPSDHL ++C+L+L 
Sbjct: 431 EKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQLT 475

>Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  372 bits (956), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 190/447 (42%), Positives = 269/447 (60%), Gaps = 34/447 (7%)

Query: 65  QGIDPDFP-PELQFIKRPILPLHKGENVEGFK------------FKLMTYNCLAQALIRR 111
           QG DPDFP P+LQFI+RP+L +   +N   FK             K+MTYN LAQ LIRR
Sbjct: 66  QGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTLIRR 125

Query: 112 KLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHR 171
             FP SG ALKW++RSKVL++E K Y  D++ LQE+DY + + FW++   KLG+D  F R
Sbjct: 126 DFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDLSFRR 184

Query: 172 QASKNHGVAIVWKREYFVMTDKMLIDFDRESSGD-IPPRTTTNNAGLILSLKFSDKVAQE 230
              K HG+ + W  E F + ++ ++D+D+  +G+ I  RT T N  LI+SL+F D     
Sbjct: 185 NGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDT---- 240

Query: 231 HNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSH-WYP 289
            N    GI+V  THLFWHPFG FER RQ Y+VL K++E            D    H W+ 
Sbjct: 241 RNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEIK----------DFPKYHGWHS 290

Query: 290 FFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRXXXXXXXXXXXXXNI 349
              GDFN++P + PYL++T KP+  +   + ++ECS +Y +SK R               
Sbjct: 291 LLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGEESDQDDEDYDEN 350

Query: 350 EKF--GTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGL 407
            +     +QP +P P+H+ A   E++LV Q+ +LHNSL ++ +SLY + Y KVHPENA  
Sbjct: 351 SRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPENA-- 408

Query: 408 DNERGEPEISNWAHTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPG 467
           +   GEPE+SNWA+TW GLLDY+F+I   D +  ++  SL  FE  N + + G LR+P  
Sbjct: 409 NEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGYLRMPCK 468

Query: 468 KEMTEHGQPHTGEYPSDHLCMLCELEL 494
           +EM +H QP  GEY SDH+ ++C++ L
Sbjct: 469 QEMPKHSQPFEGEYASDHISLMCQIRL 495

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score =  371 bits (953), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 192/443 (43%), Positives = 269/443 (60%), Gaps = 33/443 (7%)

Query: 65  QGIDPDFPPELQFIKRPILPLHKGENVE-GFKFKLMTYNCLAQALIRRKLFPTSGDALKW 123
           +G+DPDFP E QFI+RPIL +  G+N E G    +MTYNCLAQ LIRR++FP SG ALKW
Sbjct: 48  RGLDPDFPAECQFIERPILLVPHGDNYERGLPLSIMTYNCLAQTLIRREMFPESGPALKW 107

Query: 124 YRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVAIVW 183
           + RSKVLL+E K+YNAD+ CLQEID +QY  FW +EL K GY + +  Q SK+HGV I W
Sbjct: 108 FVRSKVLLHEIKHYNADICCLQEIDDVQYDLFWSEELPKFGYKTIYFHQDSKSHGVMIAW 167

Query: 184 KREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKVAQEHN---LKKTGIIV 240
           K E F +   M I+FD+E+   I PRT TNN GL+++L F+D     +N     ++G+I+
Sbjct: 168 KEELFQLESHMNIEFDKEAPAGIQPRTRTNNVGLLVALAFTDAFRARNNRIRTSRSGVII 227

Query: 241 GTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPF 300
           GT HLFWHPFGT++RTRQC V+  K+ EF+  V        GD+      F GDFNSQP 
Sbjct: 228 GTFHLFWHPFGTYDRTRQCLVIKKKILEFAGTVK-------GDYCK---MFTGDFNSQPN 277

Query: 301 DSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRXXXXXXXXXXXXXNIEKF-------- 352
             PYL +T+   + + + +T IE ST+Y +S+ R               E+         
Sbjct: 278 SVPYLVLTQPRAQLNTQQRTSIEASTAYRYSERRNLGKEYSMEEEEEEEEEEEKREYEYD 337

Query: 353 -GTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNER 411
            GTD  + P P  +++ + +R+LV  +    N + + A SLYS+ Y  V P +     + 
Sbjct: 338 QGTDPWNTPRPDEFDSTEEQRQLVNNLIDRCNDVPLCATSLYSIGYHTVDPTHIA---DH 394

Query: 412 GEPEISNWAHTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMT 471
            EPE+S+W+  W GLLDY+F++        +   +  +FE  N++ I G L++P   +M 
Sbjct: 395 HEPELSSWSTKWAGLLDYIFYVN-------QRPSTPATFETANNIAIAGYLQMPTHAQMH 447

Query: 472 EHGQPHTGEYPSDHLCMLCELEL 494
            H QP+TGEYPSDH+ M+C LE+
Sbjct: 448 NHSQPYTGEYPSDHISMMCALEI 470

>KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {ON}
           Anc_8.850 YMR285C
          Length = 478

 Score =  369 bits (947), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 189/431 (43%), Positives = 275/431 (63%), Gaps = 20/431 (4%)

Query: 77  FIKRPILPLHKGENVE-GFKFKLMTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFK 135
           FIKR IL L   E ++     K+MTYN L+Q+LIRR+++P + DA+KW+ RSKV+LNE K
Sbjct: 53  FIKRAILQLPNVEELDNSVDLKIMTYNTLSQSLIRREIYPDAHDAIKWHVRSKVILNEIK 112

Query: 136 YYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHR--QASKNHGVAIVWKREYFVMTDK 193
           YYN D++C QE+D IQ+  FW  EL+KLGY+ +F++  +  K HGVAI W+   F   D 
Sbjct: 113 YYNCDIMCFQEVDVIQWDKFWLPELSKLGYEGEFYKDFRGPKVHGVAIFWRSNLFEQFDV 172

Query: 194 MLIDFDRESSGDIPPRTT-TNNAGLILSLKFSDKVAQEHNLKKTGIIVGTTHLFWHPFGT 252
           + I+FD   +G+   +TT T N GLI++LKF    A+     ++GI++GTTHLFWHPFGT
Sbjct: 173 IKINFDDIVAGNAISKTTRTWNVGLIVALKFKSSNAK----FRSGIVIGTTHLFWHPFGT 228

Query: 253 FERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPI 312
           FERTRQ  ++L K ++    +N      +   + W P   GDFNSQP D PYLS+T KP+
Sbjct: 229 FERTRQLAILLKKFRKLIDNLNTECGHINEMSNRWLPILTGDFNSQPCDMPYLSITSKPV 288

Query: 313 EYSKRAKTVIECSTSYTFSKMRXXXXXX---------XXXXXXXNIEKFGTDQPDHPVPQ 363
             S  AKTVIECST+Y FS+ R                        E+     P  P P 
Sbjct: 289 SASGEAKTVIECSTAYKFSRRRSGSINSSEEVDHNEETQSEKEVEEEEDEESNPIDPRPS 348

Query: 364 HYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEISNWAHTW 423
           H+EA   +++L+ +++ +HNS++++A SL+ +AY+KVH  + GL N + EPE+S+ +  W
Sbjct: 349 HFEATSEQKDLIAKLEKVHNSINLKATSLFGIAYKKVH--SIGL-NCKNEPELSHTSIFW 405

Query: 424 RGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTEHGQPHTGEYPS 483
            GLLDY+F +  W+  +  +  SLE FE+  SL+++GLL++P  KE+ ++ QPH G+YPS
Sbjct: 406 TGLLDYIFILEPWNEVEKTDWGSLEDFEKRMSLRVKGLLKMPEMKELPKNVQPHQGQYPS 465

Query: 484 DHLCMLCELEL 494
           DHL M+C+L +
Sbjct: 466 DHLSMICDLNV 476

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  363 bits (933), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 194/457 (42%), Positives = 272/457 (59%), Gaps = 55/457 (12%)

Query: 65  QGIDPDFP-PELQFIKRPILPLHKGENVEG--------FKFKLMTYNCLAQALIRRKLFP 115
           QG DPDFP P+LQFIKRP L LH  E  +G           K+MTYN LAQ LIRR  FP
Sbjct: 68  QGKDPDFPTPDLQFIKRPFLHLHH-EIAQGSTESTPNSLDVKIMTYNTLAQTLIRRNFFP 126

Query: 116 TSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASK 175
            SG ALKW++RSKVL++E K Y  D++ LQE+DY + + FW++   KLG+D  F R   K
Sbjct: 127 QSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDYNELK-FWQENFRKLGFDLTFKRHDGK 185

Query: 176 NHGVAIVWKREYFVMTDKMLIDFDRESSGD-IPPRTTTNNAGLILSLKFSDKVAQEHNLK 234
            HG+ I W    F + ++ ++D+D   +G+ IP RT T N  LI SL+  +      +  
Sbjct: 186 THGLLIAWNSGKFQLENEWMLDYDNILAGNAIPARTRTKNIALIASLRLKNIS----DPS 241

Query: 235 KTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGD 294
             G+IV  THLFWHPFG FER RQ Y+VL K++E   +     NG       W+    GD
Sbjct: 242 TDGVIVANTHLFWHPFGVFERLRQSYLVLAKIQEI--KACPKYNG-------WHSVLMGD 292

Query: 295 FNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRXXXXXXXXXXXXXNIEKFGT 354
           FN++P + PYL++TRKP+  +  A+ + ECS +Y +SK R             N E+ G 
Sbjct: 293 FNTEPEEPPYLAITRKPVALTGSARVMAECSLAYRYSKKR-------------NGEEGGQ 339

Query: 355 D---------------QPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRK 399
           D               QP +P P+ + A   ++ LV+Q+ +LHNSL +R VSLY + Y K
Sbjct: 340 DDEECDEQSRGEGRFNQPQNPKPKSFTATSEQKALVDQLVALHNSLHVRGVSLYGLGYGK 399

Query: 400 VHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIR 459
           V PEN+   N  GEPE+SNWA++W GLLDY+F+I H D     + + ++ FE +N+L++ 
Sbjct: 400 VQPENSHESN--GEPELSNWANSWCGLLDYIFYIEHSDEHSAHDQNPVDDFENKNNLRVM 457

Query: 460 GLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCELELVN 496
           G L++P  KEM +H QP  GEY SDH+ ++C+L  ++
Sbjct: 458 GYLKMPRAKEMPKHSQPFEGEYASDHVSLMCQLRFLS 494

>Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W
           (REAL)
          Length = 498

 Score =  360 bits (924), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 187/472 (39%), Positives = 275/472 (58%), Gaps = 30/472 (6%)

Query: 37  APVSPEHIXXXXXXXXXXXXXXXXXXXXQGIDPDFP-PELQFIKRPILPLHK-------- 87
            P++ +HI                    QG DPDFP P+LQFI+RP L +++        
Sbjct: 40  CPLADDHIKKIREERAQRRQSRRNSLISQGKDPDFPTPDLQFIERPFLHVYREVSQDSKT 99

Query: 88  -GENV--EGFKFKLMTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICL 144
            G  V       ++MTYN LAQ LIRR  FP SG ALKW++RSKVL++E K Y  D++ L
Sbjct: 100 SGMQVPPSSLDVQIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYKPDIVSL 159

Query: 145 QEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDKMLIDFDRESSG 204
           QE+DY +   FW +   KLG+ S F R   K HG+ + W  E F   ++ ++D+D   +G
Sbjct: 160 QEVDYNEL-GFWHENFHKLGFGSTFRRHEGKTHGLMVAWNNEKFQQDNEWMLDYDTILAG 218

Query: 205 D-IPPRTTTNNAGLILSLKFSDKVAQEHNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVL 263
           + I  RT T N  LI+SL   +      NL  +G+IV  THLFWHPFG FER RQ ++VL
Sbjct: 219 NAISARTRTKNIALIVSLSVKNMT----NLSTSGVIVANTHLFWHPFGVFERLRQSFLVL 274

Query: 264 NKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIE 323
            K++E               +  W+    GDFN++P + PY+++TR+P+  +  A+ + E
Sbjct: 275 KKIEEIK---------TCPKYYGWHSLLMGDFNTEPEEPPYMAITRRPLTLTGSARAMTE 325

Query: 324 CSTSYTFSKMRXXXXXXXXXXXXXNIEKFGT-DQPDHPVPQHYEAKDHERELVEQMQSLH 382
           CS +Y +SKMR                  G  DQP +P P+++ A   ++ LV Q+ +LH
Sbjct: 326 CSLAYRYSKMRNGEESDQDEECDEESTGEGQHDQPQNPKPKYFVATKEQKNLVNQLVALH 385

Query: 383 NSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWDFSDCK 442
           NSL ++ +SLY ++Y KVHP+N+  ++  GEPE+SNWA+TW GLLDY+F+I   D     
Sbjct: 386 NSLHVKGISLYGLSYGKVHPDNSKENH--GEPELSNWANTWCGLLDYIFYIERNDNVSSS 443

Query: 443 EIDSLESFERENSLKIRGLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCELEL 494
           + + +++FE +N++KI G LR+P  +EM +H QP  GEY SDH+ ++C+L L
Sbjct: 444 KDEPVKNFEDQNNVKIIGYLRMPRAEEMPKHSQPFEGEYASDHISLMCQLRL 495

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score =  358 bits (919), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 189/446 (42%), Positives = 267/446 (59%), Gaps = 33/446 (7%)

Query: 65  QGIDPDFP-PELQFIKRPILPLHKGENVEGFK------------FKLMTYNCLAQALIRR 111
           QG DPDFP P+LQFI+RP LP++  +N +G               K+MTYN LAQ LIRR
Sbjct: 66  QGKDPDFPTPDLQFIERPFLPINH-DNSKGLTPATIQVTQDSLDVKIMTYNTLAQTLIRR 124

Query: 112 KLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHR 171
             FP SG ALKW++RSKVL++E K Y  DV+ LQE+DY +  +FW++   KLG+D  F R
Sbjct: 125 DFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVIFKR 183

Query: 172 QASKNHGVAIVWKREYFVMTDKMLIDFDRESSGD-IPPRTTTNNAGLILSLKFSDKVAQE 230
              K HG+ + W  + F + +  ++D+D   +G+ I  RT T N  LI+SL F       
Sbjct: 184 HEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYFKGIT--- 240

Query: 231 HNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPF 290
            +    GIIV  THLFWHPFG FER RQ Y+VL K++E   +     NG       W+  
Sbjct: 241 -DSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEI--KACSKYNG-------WHSL 290

Query: 291 FCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRXXXXXXXXXXXXXNIE 350
             GDFN++P + PYL++T++P+      + ++ECS +Y +SK R                
Sbjct: 291 LMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRNGEESDQDDEECDEKS 350

Query: 351 KFG--TDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLD 408
           +    +DQP +P P+ + A   E+ LV Q+ +LHNSL ++ VSLY + Y KVHPENA  +
Sbjct: 351 RGEGHSDQPQNPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYGKVHPENA--N 408

Query: 409 NERGEPEISNWAHTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGK 468
              GEP +SNWA+TW GLLDY+F+I      D ++ + L +FE  N++KI G LR+P  +
Sbjct: 409 GSHGEPGLSNWANTWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKIIGYLRMPCAQ 468

Query: 469 EMTEHGQPHTGEYPSDHLCMLCELEL 494
           EM +H QP  GEY SDH+ ++C++ L
Sbjct: 469 EMPKHSQPFEGEYASDHISLMCQIRL 494

>KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {ON}
           Anc_8.850 YMR285C
          Length = 466

 Score =  339 bits (870), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 186/433 (42%), Positives = 259/433 (59%), Gaps = 26/433 (6%)

Query: 77  FIKRPILPLHKGENV---EGF-KFKLMTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLN 132
           FIKRP+L +     V   +G+ + K+MTYN LAQ LIRR  FP + DA+KW+RRS+VL+ 
Sbjct: 43  FIKRPLLEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQ 102

Query: 133 EFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVAIVWKREYFVMT- 191
           E +YY+ADV+CLQE D IQ+  FW +E  +LGY   F     K HGVAIVWK   F  T 
Sbjct: 103 ELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTP 162

Query: 192 -DKMLIDFDRESSG-DIPPRTTTNNAGLILSLKFSDKVAQEHNLKKTGIIVGTTHLFWHP 249
            DK+ +  D   +G DI   T T    L ++L+       +H+     II  TTHLFWH 
Sbjct: 163 LDKLPLCLDDYVAGDDIAATTGTRTVALAVALRL------KHHKTSRPIIFSTTHLFWHL 216

Query: 250 FGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTR 309
           FGTFERTRQ +V+L+++ +F  +V    + +       Y FF GDFNSQP D+PYLS+T 
Sbjct: 217 FGTFERTRQLFVILSELNKFIKKVT---DAHCPRGQRCYTFFTGDFNSQPCDAPYLSLTD 273

Query: 310 KPIEYSKRAKTVIECSTSYTFSKMRXXX------XXXXXXXXXXNIEKFGTDQPDHPVPQ 363
           KP++   RAK++IECS SY +SK R                   ++E   T++P  P P 
Sbjct: 274 KPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVED-ETNRPQDPRPY 332

Query: 364 HYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAG--LDNERGEPEISNWAH 421
            Y+A   + E V+ +Q+LHN + ++ VSLY + Y  VHPEN+     +   EP++S+ A 
Sbjct: 333 TYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRAL 392

Query: 422 TWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTEHGQPHTGEY 481
            W GLLDY+F I  W   +  +I  L++ ER+  +KI G LR+P  +EM +H +PH  EY
Sbjct: 393 HWSGLLDYIFLITEWS-ENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEPHENEY 451

Query: 482 PSDHLCMLCELEL 494
           PSDHL M+C++ L
Sbjct: 452 PSDHLAMMCDISL 464

>Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar to
           Ashbya gossypii ACR288W
          Length = 785

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 98/235 (41%), Gaps = 34/235 (14%)

Query: 86  HKGENVEGFKFKLMTYNCLAQALIRRKLFP-TSGDALKW-YRRSKVLLNEFKYYNADVIC 143
           H  ++     F L++YN L Q     K++      AL W YRR K L  E   Y  DVIC
Sbjct: 435 HVNQDTLKRSFTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREK-LKEEVLSYQTDVIC 493

Query: 144 LQEIDYIQYQSFWKDELAKLGYDSQFH----------RQASKNHGVAIVWKREYFVMTDK 193
           LQE++   Y+ FW   L K GY   FH          + A K  G  I +K   F    K
Sbjct: 494 LQEVESKTYEEFWLPLLEKQGYSGVFHAKTRARTMQVKDAKKVDGCCIFYKNSEFSCIFK 553

Query: 194 MLIDFDR--------ESSGDIPPRTTT-NNAGLILSLKFSDKVAQEHNLKKTGIIVGTTH 244
             IDF          + + D   R    +N  LI+ LK        H L    + V TTH
Sbjct: 554 DAIDFSSVWMKHKKFQRTEDYLNRAMNKDNIALIVKLK--------HELSGEHVWVVTTH 605

Query: 245 LFWHPFGTFERTRQCYVVLNKV-KEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQ 298
           L W P     +T Q  V+L+ + K    + N+   GN  +        CGDFNSQ
Sbjct: 606 LHWDPHFNDVKTFQVGVLLDYIEKLLKQQSNI---GNPQEKKKVPLIICGDFNSQ 657

>ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL021C (CCR4)
          Length = 736

 Score = 79.3 bits (194), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 73/237 (30%), Positives = 99/237 (41%), Gaps = 38/237 (16%)

Query: 86  HKGENVEGFKFKLMTYNCLAQALIRRKLFP-TSGDALKW-YRRSKVLLNEFKYYNADVIC 143
           H  E +    F L++YN L Q     K++      AL W YRR K L +E   Y  D+IC
Sbjct: 388 HLNEELLKKSFTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREK-LKDEVLAYQTDIIC 446

Query: 144 LQEIDYIQYQSFWKDELAKLGYDSQFH----------RQASKNHGVAIVWKREYFVMTDK 193
           LQE++   Y+ FW   L K GY   FH          + A K  G  I +K   F    K
Sbjct: 447 LQEVESKTYEEFWLPILEKQGYSGIFHAKTRARTMQSKDAKKVDGCCIFYKNSEFTAVFK 506

Query: 194 MLIDFDR--------ESSGDIPPRTTT-NNAGLILSLKFSDKVAQEHNLKKTGIIVGTTH 244
             IDF          + + D   R    +N  LI+ L+        H      + V TTH
Sbjct: 507 DAIDFSSVWMKHKKFQRTEDYLNRAMNKDNVALIIKLR--------HERTGEHVWVVTTH 558

Query: 245 LFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDG---DHSHWYPFFCGDFNSQ 298
           L W P     +T Q  V+L+ +++      + Q+G  G   D        CGDFNSQ
Sbjct: 559 LHWDPHFNDVKTFQVAVMLDYIEKL-----LKQHGGVGSPQDKKKIPLVICGDFNSQ 610

>KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.78
           YAL021C
          Length = 779

 Score = 76.3 bits (186), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 66/222 (29%), Positives = 96/222 (43%), Gaps = 33/222 (14%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGDALKW-YRRSKVLLNEFKYYNADVICLQEIDYIQYQ 153
           F +++YN L Q     K++  T   AL W YRR+K L ++   Y+ D++CLQE++   ++
Sbjct: 435 FTVLSYNTLCQHYATPKMYRYTPSWALSWEYRRAK-LRDQILSYSCDIMCLQEVEARTFE 493

Query: 154 SFWKDELAKLGYDSQF----------HRQASKNHGVAIVWKREYFVMTDKMLIDFDR--- 200
            FW   L K GY   F          HR + K  G  + +KR  F +  K  +DF     
Sbjct: 494 DFWLPLLEKHGYSGSFHAKTRAKLLQHRDSKKVDGCCVFFKRTKFRLIKKEEVDFSSTWM 553

Query: 201 -----ESSGDIPPRTTTNNAGLILSLKFSDKVAQEHNLKKTGIIVGTTHLFWHPFGTFER 255
                + + D   R   N   + L  K     + EH      I V TTHL W P     +
Sbjct: 554 KHEKFQRTEDFLNR-AMNKDNIALYFKLQHIASGEH------IWVATTHLHWDPKFNDVK 606

Query: 256 TRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNS 297
           T Q  V+L+ ++    + N  Q     D        CGDFNS
Sbjct: 607 TFQVGVLLDHLQTLIRQDNPRQ-----DVKKAPVIICGDFNS 643

>SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} similar
           to uniprot|P31384 Saccharomyces cerevisiae YAL021C CCR4
           Component of the CCR4-NOT transcriptional complex which
           is involved in regulation of gene expression component
           of the major cytoplasmic deadenylase which is involved
           in mRNA poly(A) tail shortening
          Length = 731

 Score = 72.8 bits (177), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 97/224 (43%), Gaps = 32/224 (14%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGDALKW-YRRSKVLLNEFKYYNADVICLQEIDYIQYQ 153
           F L++YN L Q     K++  T   AL W YRR K L  +   + ADV+CLQE++   ++
Sbjct: 399 FTLLSYNTLCQHYATPKMYRYTPSWALSWDYRRDK-LKEQIISFQADVVCLQEVECKTFE 457

Query: 154 SFWKDELAKLGYDSQFH----------RQASKNHGVAIVWKREYFVMTDKMLIDFDR--- 200
            FW   L K GY   FH          + + K  G  + +K   F +  K  +DF     
Sbjct: 458 DFWAPFLQKHGYTGVFHAKTRARTMQSKDSKKVDGCCVFYKNSEFKLVFKDAVDFSSVWM 517

Query: 201 -----ESSGDIPPRTTT-NNAGLILSLKFSDKVAQEHNLKKTGIIVGTTHLFWHPFGTFE 254
                + + D   R    +N  L + L        +H      I V TTHL W P     
Sbjct: 518 KHKKFQRTEDYLNRAMNKDNVALFVKL--------QHLKTNEQIWVTTTHLHWDPQFNDV 569

Query: 255 RTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQ 298
           +T Q  V+L+ +++     N +  GN+ +        CGDFNSQ
Sbjct: 570 KTFQVGVLLDYMEKLLRDQNGV--GNNQEMKKVPLVICGDFNSQ 611

>KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]
           {ON} similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 790

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 72/249 (28%), Positives = 106/249 (42%), Gaps = 45/249 (18%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGDALKW-YRRSKVLLNEFKYYNADVICLQEIDYIQYQ 153
           F L++YN L       K++  T   AL W YRR K L  +   ++ DVICLQE++ + Y+
Sbjct: 454 FTLLSYNTLCHHYATPKMYRFTPSWALSWDYRREK-LKEQLLDFDTDVICLQEVETLTYE 512

Query: 154 SFWKDELAKLGYDSQFH----------RQASKNHGVAIVWKREYFVMTDKMLIDFDRE-- 201
            +W   + K  Y   FH          + + K  G AI +K++ F +  +  IDF     
Sbjct: 513 EYWVPLMEKYNYSCLFHAKTRAKTMHAKDSKKVDGCAIFYKKDQFQLVFQDSIDFSSAWR 572

Query: 202 ------SSGDIPPRTTT-NNAGLILSLKFSDKVAQEHNLKKTGIIVGTTHLFWHPFGTFE 254
                  + D   R    +N  LI  LK        H      + V TTHL W P     
Sbjct: 573 SHKKFHRTEDYLNRAMNKDNVALIAELK--------HLNTNENVWVVTTHLHWDPQFNDV 624

Query: 255 RTRQCYVVLNKVKEF---SHRVNVLQNGNDGDHSHWYPFFCGDFNSQ-------PFDSPY 304
           +T Q  V+L+ ++      H VN     N+ D        CGDFNSQ        F+S +
Sbjct: 625 KTFQVGVMLDYLETLIKQHHHVN-----NNNDIKKIPMVICGDFNSQLDSAVVELFNSGH 679

Query: 305 LSMTRKPIE 313
           ++   K I+
Sbjct: 680 VTANHKDID 688

>KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 739

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 95/229 (41%), Gaps = 30/229 (13%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQS 154
           F +++YN L Q     K++  T   AL W  R + L  +   YN D++CLQE++   Y+ 
Sbjct: 408 FTILSYNTLCQHYATPKMYRFTPSWALSWEYRREKLKEQILSYNTDIVCLQEVECKTYED 467

Query: 155 FWKDELAKLGYDSQFH----------RQASKNHGVAIVWKREYFVMTDKMLIDFDR---- 200
           FW   L + GY   FH          + + K  G    +K   F +  K  +DF      
Sbjct: 468 FWAPLLREKGYSGIFHTKTRARTMHSKDSKKVDGCCFFYKDSEFKLMFKEAVDFSSVWMK 527

Query: 201 ----ESSGDIPPRTTTNNAGLILSLKFSDKVAQEHNLKKTGIIVGTTHLFWHPFGTFERT 256
               + + D   R   N   + L +K     + EH      +   TTHL W P     +T
Sbjct: 528 HKKFQRTEDYLNR-AMNKDNVALVVKLQHIKSGEH------VWAATTHLHWDPQFNDVKT 580

Query: 257 RQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYP-FFCGDFNSQPFDSPY 304
            Q  V+L+ +++     N   N N+       P   CGDFNSQ   + Y
Sbjct: 581 FQVGVLLDYMEKVIKEQN---NCNNTQELKKVPVVICGDFNSQTNSAVY 626

>Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON}
           YAL021C (REAL)
          Length = 831

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 70/252 (27%), Positives = 107/252 (42%), Gaps = 32/252 (12%)

Query: 67  IDPDFPPELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFP-TSGDALKW-Y 124
           I+ D  P+ ++        H   ++    F +++YN L Q     K++  T   AL W Y
Sbjct: 470 INTDGEPQREYDSLQQSTEHLTADLAKRSFTVLSYNTLCQHYATPKMYRYTPSWALSWDY 529

Query: 125 RRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQA----------S 174
           RR+K L  +   Y++DV+CLQE++   ++ +W   L K GY   FH +A           
Sbjct: 530 RRNK-LKEQILSYSSDVLCLQEVESKTFEDYWVPLLEKHGYTGVFHAKARAKTMHSKDSK 588

Query: 175 KNHGVAIVWKREYFVMTDKMLIDFDR--------ESSGDIPPRTTT-NNAGLILSLKFSD 225
           K  G  I +KR+ F M ++  +DF          + + D   R    +N  L L L    
Sbjct: 589 KVDGCCIFFKRDQFKMVNRDSMDFSGAWMKHKKFQRTEDYLNRAMNKDNVALFLKL---- 644

Query: 226 KVAQEHNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHS 285
               +H      I V TTHL W P     +T Q  V+L+ ++          +  D   S
Sbjct: 645 ----QHVSSGDTIWVVTTHLHWDPKFNDVKTFQVGVLLDHLETLLKEDTTHNSRQDIKKS 700

Query: 286 HWYPFFCGDFNS 297
                 CGDFNS
Sbjct: 701 PV--LICGDFNS 710

>Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {ON}
           YAL021C (CCR4) - 95 kDa containng leucine rich tandem
           repeats [contig 47] FULL
          Length = 742

 Score = 69.7 bits (169), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 96/224 (42%), Gaps = 32/224 (14%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGDALKW-YRRSKVLLNEFKYYNADVICLQEIDYIQYQ 153
           F L++YN L Q     K++  T   AL W YRR K L  +  YY+ D+ICLQE++   Y+
Sbjct: 410 FTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREK-LKEQILYYSTDIICLQEVECKTYE 468

Query: 154 SFWKDELAKLGYDSQFH----------RQASKNHGVAIVWKREYFVMTDKMLIDFDR--- 200
            FW   L + GY   FH          + + K  G  + ++   F +  K  +DF     
Sbjct: 469 DFWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWM 528

Query: 201 -----ESSGDIPPRTTTNNAGLILSLKFSDKVAQEHNLKKTGIIVGTTHLFWHPFGTFER 255
                + + D   R   N   + L +K     + EH      +   TTHL W P     +
Sbjct: 529 KHKKFQRTEDYLNR-AMNKDNVALLVKLQHLKSGEH------VWAATTHLHWDPQFNDVK 581

Query: 256 TRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYP-FFCGDFNSQ 298
           T Q  V+L+ +++    +      N+       P   CGDFNSQ
Sbjct: 582 TFQVGVLLDHMEKV---IKEHSGYNNSQELKKVPVIICGDFNSQ 622

>Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON}
           YAL021C (REAL)
          Length = 869

 Score = 69.7 bits (169), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 67/233 (28%), Positives = 99/233 (42%), Gaps = 32/233 (13%)

Query: 86  HKGENVEGFKFKLMTYNCLAQALIRRKLFP-TSGDALKW-YRRSKVLLNEFKYYNADVIC 143
           H   ++    F +++YN L Q     K++  T   AL W YRRSK L  +   Y++DV+C
Sbjct: 527 HLSADLAKKTFSVLSYNTLCQHYATPKMYRYTPSWALTWDYRRSK-LKEQILSYDSDVLC 585

Query: 144 LQEIDYIQYQSFWKDELAKLGYDSQFHRQA----------SKNHGVAIVWKREYFVMTDK 193
           LQE++   ++ +W   L K GY   F+ +A           K  G  I +KR+ F +  K
Sbjct: 586 LQEVESKTFEDYWVPLLDKHGYTGIFYAKARAKTMHSKDSKKVDGCCIFFKRDQFKLVTK 645

Query: 194 MLIDFDR--------ESSGDIPPRTTT-NNAGLILSLKFSDKVAQEHNLKKTGIIVGTTH 244
             +DF          + + D   R    +N  L L L        +H      I V TTH
Sbjct: 646 DAMDFSGAWMKHKKFQRTEDYLNRAMNKDNVALFLKL--------QHVSSGDTIWVVTTH 697

Query: 245 LFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNS 297
           L W P     +T Q  V+L+ ++          +  D   S      CGDFNS
Sbjct: 698 LHWDPKFNDVKTFQVGVLLDHLESLLKEDTTHNSRQDIKKSPV--LICGDFNS 748

>ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 857

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 94/228 (41%), Gaps = 28/228 (12%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQS 154
           F +M+YN L Q     K++  T   AL W  R + L  E   Y  D++CLQE++   Y+ 
Sbjct: 524 FTIMSYNILCQHYATPKMYRYTPSWALSWDHRRQRLTEEVMSYMTDIVCLQEVEAKTYEE 583

Query: 155 FWKDELAKLGYDSQFH----------RQASKNHGVAIVWKREYFVMTDKMLIDFDR---- 200
            W   + K GY   FH          + + K  G  + +K   F +  K  +DF      
Sbjct: 584 HWAPLMLKQGYSGVFHAKTRAKTMHSKDSKKVDGCCVFYKESEFKLQFKDEVDFSSTWMK 643

Query: 201 ----ESSGDIPPRTTTNNAGLILSLKFSDKVAQEHNLKKTGIIVGTTHLFWHPFGTFERT 256
               + + D   R   N   +++ +K +   + E       + + TTHL W P     +T
Sbjct: 644 HKKFQRTEDYLNR-AMNKDNVVIYIKLNHLKSGE------SVWIATTHLHWDPQFNDVKT 696

Query: 257 RQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPFDSPY 304
            Q  ++++ ++E         +  D   S      CGDFNSQ   + Y
Sbjct: 697 FQVGILMDHLEELIKEHGSPSSRQDPKKSPV--IICGDFNSQKDSAVY 742

>CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021c CCR4
          Length = 873

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 69/260 (26%), Positives = 107/260 (41%), Gaps = 37/260 (14%)

Query: 67  IDPDFPPELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFP-TSGDALKW-Y 124
           I+ D  PE ++        +   +++   F +++YN L Q     K++  T   AL W Y
Sbjct: 509 INADGEPEKEYDTVQEAERNLSSDMQKKSFTMLSYNTLCQHYATPKMYRYTPSWALSWDY 568

Query: 125 RRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFH----------RQAS 174
           RR K L  +   +N D+ICLQE++   ++ FW+  L K GY   FH          + + 
Sbjct: 569 RREK-LKEQILNFNTDIICLQEVEAKTFEDFWQPLLEKHGYTGLFHAKTRAKTMQSKDSK 627

Query: 175 KNHGVAIVWKREYFVMTDKMLIDFDR--------ESSGDIPPRTTT-NNAGLILSLKFSD 225
           K  G    +K   F M  K  +DF          + + D   R    +N  +++ L    
Sbjct: 628 KVDGCCAFYKTSKFKMLFKECVDFSGLWMKHKKFQRTEDYLNRAMNKDNVAIVMKL---- 683

Query: 226 KVAQEHNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHS 285
               +H      + + TTHL W P     +T Q  V+L+      H   +L+  N     
Sbjct: 684 ----QHIQSGEIMWLVTTHLHWDPKFNDVKTFQVGVLLD------HMETLLKEQNPKQDV 733

Query: 286 HWYPF-FCGDFNSQPFDSPY 304
             YP   CGD NS    S Y
Sbjct: 734 KKYPLVICGDLNSYLSSSVY 753

>YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}
           CCR4Component of the CCR4-NOT transcriptional complex,
           which is involved in regulation of gene expression;
           component of the major cytoplasmic deadenylase, which is
           involved in mRNA poly(A) tail shortening
          Length = 837

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 69/238 (28%), Positives = 102/238 (42%), Gaps = 42/238 (17%)

Query: 86  HKGENVEGFKFKLMTYNCLAQALIRRKLFP-TSGDALKW-YRRSKVLLNEFKYYNADVIC 143
           H   ++    F +++YN L Q     K++  T   AL W YRR+K L  +   Y++D++C
Sbjct: 495 HLATDLAKRTFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNK-LKEQILSYDSDLLC 553

Query: 144 LQEIDYIQYQSFWKDELAKLGYDSQFHRQA----------SKNHGVAIVWKREYFVMTDK 193
           LQE++   ++ +W   L K GY   FH +A           K  G  I +KR+ F +  K
Sbjct: 554 LQEVESKTFEEYWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKLITK 613

Query: 194 MLIDFDR--------ESSGDIPPRTTT-NNAGLILSLKFSDKVAQEHNLKKTGIIVGTTH 244
             +DF          + + D   R    +N  L L L        +H      I   TTH
Sbjct: 614 DAMDFSGAWMKHKKFQRTEDYLNRAMNKDNVALFLKL--------QHIPSGDTIWAVTTH 665

Query: 245 LFWHPFGTFERTRQCYVVLNKV-----KEFSHRVNVLQNGNDGDHSHWYPFFCGDFNS 297
           L W P     +T Q  V+L+ +     +E SH  N  Q     D   +    CGDFNS
Sbjct: 666 LHWDPKFNDVKTFQVGVLLDHLETLLKEETSH--NFRQ-----DIKKFPVLICGDFNS 716

>TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.78
           YAL021C
          Length = 872

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 99/252 (39%), Gaps = 32/252 (12%)

Query: 67  IDPDFPPELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFP-TSGDALKWYR 125
           I+ D  P+ +F    +   H    +    F +++YN L Q     K++  T    L W  
Sbjct: 511 INADEEPQEEFDTMALSDSHISTEMLKKSFTVLSYNTLCQHYATPKMYRYTPSWVLSWDT 570

Query: 126 RSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFH----------RQASK 175
           R + L N+     +DVICLQE++   Y+ FW   L K GY   FH          + + K
Sbjct: 571 RREQLKNQILGIQSDVICLQEVEAQTYEDFWLPLLQKRGYLGIFHAKTRAKTMQSKDSKK 630

Query: 176 NHGVAIVWKREYFVMTDKMLIDFDR--------ESSGDIPPRTTT-NNAGLILSLKFSDK 226
             G  I +K   F +  +  +DF          + + D   R    +N  L + L     
Sbjct: 631 VDGCCIFYKESEFKLQHQESVDFSGVWMKHKKFQRTEDYLNRAMNKDNVALFVKL----- 685

Query: 227 VAQEHNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSH 286
              EH      + V TTHL W P     +T Q  V+L+ ++      N   N +      
Sbjct: 686 ---EHINSGESVWVVTTHLHWDPQFNDVKTFQVGVLLDHLESLLKDYN---NASSKQEIR 739

Query: 287 WYP-FFCGDFNS 297
             P   CGD NS
Sbjct: 740 KCPVIICGDLNS 751

>KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {ON}
           Anc_7.78 YAL021C
          Length = 795

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 96/223 (43%), Gaps = 35/223 (15%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGDALKW-YRRSKVLLNEFKYYNADVICLQEIDYIQYQ 153
           F +++YN L Q     K++  T   AL+W YRR K L  +   Y  D++CLQE++   Y+
Sbjct: 466 FTILSYNTLCQHYATPKMYRYTPSWALRWDYRREK-LKEQILSYGCDILCLQEVESKTYE 524

Query: 154 SFWKDELAKLGYDSQFH----------RQASKNHGVAIVWKREYFVMTDKMLIDFDR--- 200
            FW   L K GY   FH          + + K  G  + +K+  F +  K  +DF     
Sbjct: 525 DFWAPLLEKNGYTGYFHCKTRAKTMQAKDSKKVDGCCVFYKKSKFKLITKEALDFSGAWQ 584

Query: 201 -----ESSGDIPPRTTTNNAGLILSLKFSDKVAQEHNLKKTGIIVGTTHLFWHPFGTFER 255
                + + D   R   N   + + +K     + E+      + V TTHL W P     +
Sbjct: 585 KHKRFQRTEDYLNR-AMNKDNVAIYMKLQHVQSGEY------LWVVTTHLHWDPKFNDVK 637

Query: 256 TRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYP-FFCGDFNS 297
           T Q  V+L+      H  ++++  N       +P    GDFNS
Sbjct: 638 TFQVGVLLD------HMESIIKEENPKQDVKKFPIIITGDFNS 674

>NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78
          Length = 898

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 103/251 (41%), Gaps = 33/251 (13%)

Query: 67  IDPDFPPELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFP-TSGDALKW-Y 124
           I+ D  P  ++    +   +   ++E   F +++YN L Q     K++  T   AL W Y
Sbjct: 540 INADGEPTRKYDSLQLASANINPDLEKKSFTILSYNTLCQHYATPKMYRYTPSWALSWDY 599

Query: 125 RRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFH----------RQAS 174
           RR K L  +   Y +D++CLQE++   ++ FW   L K  Y   FH          +++ 
Sbjct: 600 RREK-LKEQILSYQSDILCLQEVESKTFEEFWGPLLEKYDYQGVFHIKTRAKTMQTKESK 658

Query: 175 KNHGVAIVWKREYFVMTDKMLIDFDR--------ESSGDIPPRTTTNNAGLILSLKFSDK 226
           K  G  I +K+  F +  K  +DF          + + D   R   N   + L +K    
Sbjct: 659 KVDGCCIFFKKSKFKLLAKEAMDFSGTWMKHKKFQRTEDYLNR-AMNKDNVALYMKLQSI 717

Query: 227 VAQEHNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSH 286
            + E       + V TTHL W P     +T Q  ++L+ ++      N  Q     D   
Sbjct: 718 TSGE------TVWVVTTHLHWDPKFNDVKTFQVGILLDHMETLLKEENPKQ-----DVKK 766

Query: 287 WYPFFCGDFNS 297
                CGD NS
Sbjct: 767 ANVVICGDLNS 777

>Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {ON}
           complement(42093..44447) [2355 nt, 785 aa]
          Length = 784

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 96/234 (41%), Gaps = 34/234 (14%)

Query: 86  HKGENVEGFKFKLMTYNCLAQALIRRKLFP-TSGDALKW-YRRSKVLLNEFKYYNADVIC 143
           H    ++   F +++YN L Q     K++  T   AL W YRR K L ++   + +DVIC
Sbjct: 442 HLNPELQKKSFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREK-LKDQILSFKSDVIC 500

Query: 144 LQEIDYIQYQSFWKDELAKLGYDSQFH----------RQASKNHGVAIVWKREYFVMTDK 193
           LQE++   Y+ FW   L K GY   F+          + + K  G  I +K   F +  K
Sbjct: 501 LQEVESKSYEEFWLPLLQKNGYAGTFYAKTRAKTMQTKDSKKVDGCCIFYKESEFNVLYK 560

Query: 194 MLIDFD---------RESSGDIPPRTTTNNAGLILSLKFSDKVAQEHNLKKTGIIVGTTH 244
             +DF          + +   +      +N  L + L        EH      + V TTH
Sbjct: 561 DSVDFSGVWMKHKKFQRTEDYLNRAMNKDNVALYMKL--------EHIKSGESVWVVTTH 612

Query: 245 LFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYP-FFCGDFNS 297
           L W P     +T Q  ++L+ ++E     N   N +        P   CGD NS
Sbjct: 613 LHWDPQFNDVKTFQVGILLDHLEELLKDNN---NASSKQEIRKCPVIICGDLNS 663

>Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON}
           YAL021C (REAL)
          Length = 839

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 94/223 (42%), Gaps = 32/223 (14%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGDALKW-YRRSKVLLNEFKYYNADVICLQEIDYIQYQ 153
           F +++YN L Q     K++  T   AL W YRR+K L  +   Y++D++CLQE++   ++
Sbjct: 507 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNK-LKEQILSYDSDLLCLQEVESKTFE 565

Query: 154 SFWKDELAKLGYDSQFHRQA----------SKNHGVAIVWKREYFVMTDKMLIDFDR--- 200
            +W   L K GY   FH +A           K  G  I +K++ F +  K  +DF     
Sbjct: 566 DYWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKKDQFKLITKDAMDFSGAWM 625

Query: 201 -----ESSGDIPPRTTT-NNAGLILSLKFSDKVAQEHNLKKTGIIVGTTHLFWHPFGTFE 254
                + + D   R    +N  L L L        +H      I   TTHL W P     
Sbjct: 626 KHKKFQRTEDYLNRAMNKDNVALFLKL--------QHIPSGDTIWAVTTHLHWDPKFNDV 677

Query: 255 RTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNS 297
           +T Q  V+L+ ++             D   S      CGDFNS
Sbjct: 678 KTFQVGVLLDHLETLLREETTHNFRQDIKKSPV--LICGDFNS 718

>TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa]
           {ON} Anc_7.78 YAL021C
          Length = 896

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 105/247 (42%), Gaps = 22/247 (8%)

Query: 67  IDPDFPPELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFP-TSGDALKW-Y 124
           I+ D  P+ ++        H   ++E   F +++YN L Q     K++  T   AL W Y
Sbjct: 535 INTDGEPQTEYDSIEDATSHLSRDLEKRSFTVLSYNTLCQHYATPKMYRYTPSWALSWEY 594

Query: 125 RRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFH----------RQAS 174
           RR K L ++   + +D++CLQE++   Y  FW+  L K GY   FH          + + 
Sbjct: 595 RRDK-LKDQILSFKSDILCLQEVESRTYDDFWEPLLQKHGYKGIFHAKTRAKTMQTKDSK 653

Query: 175 KNHGVAIVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKVAQEHNLK 234
           K  G  I +K   F +  K  +DF   S   +  +        +      D VA    L+
Sbjct: 654 KVDGCCIFYKESEFKVLFKEAVDF---SGIWMKHKNFQRTEDYLNRAMNKDNVAIYMKLQ 710

Query: 235 --KTGII--VGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPF 290
             K+G +  + TTHL W P     +T Q  V+L+ ++      + + +  D         
Sbjct: 711 HIKSGEVTWIVTTHLHWDPQFNDVKTFQVGVLLDHLESLLKEHSNIHSKQDVKKCPI--I 768

Query: 291 FCGDFNS 297
            CGD NS
Sbjct: 769 ICGDLNS 775

>TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.78
           YAL021C
          Length = 797

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 96/240 (40%), Gaps = 32/240 (13%)

Query: 86  HKGENVEGFKFKLMTYNCLAQALIRRKLFP-TSGDALKW-YRRSKVLLNEFKYYNADVIC 143
           H    +    F +++YN L Q     K++  T   AL W YRR K L  +   Y  DVIC
Sbjct: 454 HLSSELSKRSFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREK-LTEQILSYMTDVIC 512

Query: 144 LQEIDYIQYQSFWKDELAKLGYDSQFH----------RQASKNHGVAIVWKREYFVMTDK 193
           LQE++   ++ +W   + K GY   FH          + + K  G  + ++   F +  K
Sbjct: 513 LQEVEAKTFEEYWAPLMQKHGYSGLFHAKTRAKTMHSKDSKKVDGCCVFYRENEFKLAYK 572

Query: 194 MLIDFDR--------ESSGDIPPRTTT-NNAGLILSLKFSDKVAQEHNLKKTGIIVGTTH 244
             +DF          + + D   R    +N  + L L        +H      + + TTH
Sbjct: 573 DAVDFSGVWQKHKKFQRTEDYLNRAMNKDNVAIYLKL--------QHIKSGESVWIVTTH 624

Query: 245 LFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPFDSPY 304
           L W P     +T Q  V+++ ++      +  Q+  +          CGD NS+   + Y
Sbjct: 625 LHWDPQFNDVKTFQVGVLMDHIENLLKEQSNAQSKQEAKKCPV--ILCGDLNSEIHSAVY 682

>ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL042W
           (NGL1)
          Length = 378

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/261 (23%), Positives = 113/261 (43%), Gaps = 47/261 (18%)

Query: 76  QFIKRPILPLHKGENVEGFK----FKLMTYNCLAQALIRRKLFPTSGDALK-WYRRSKVL 130
           + I R +LP++ G    G +    F L+TYN L+   +  +++    +  K W  R K+L
Sbjct: 18  RMINRQLLPVYSGSASAGCRSERRFNLLTYNMLSPYYMWPQVYTYVPEPFKKWEYRHKLL 77

Query: 131 LNE-FKYYNADVICLQEIDYIQYQSFWKDELA-KLGYDSQF---------HRQASKNHGV 179
             E F  Y+AD++CLQE+    Y+ FW+ ++  ++ ++SQ+          R   +  GV
Sbjct: 78  EYELFHKYHADILCLQELTGKDYEKFWRKQMKRRMNFESQYAQKPPPAYWKRSQEEMDGV 137

Query: 180 AIVWKREYF--VMTDKMLIDFDRESSGDIPPR----------TTTNNAGLILSLKFSDKV 227
              +  + F  V TD   +++  ++ G + P             T+  G ++  +    V
Sbjct: 138 GTFYNADKFEHVATD---LEYLSDTLGVLTPTEKEWMAQTQVEVTDATGHVVEKQSLKTV 194

Query: 228 AQEHNL---------KKTG--IIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVL 276
             + N          K TG   +V  T L+W       +  QC++++ ++K    R   L
Sbjct: 195 LTQRNQVCLFVTLLHKPTGSLFVVVNTQLYWKYDEV--KLAQCFIIMRRLKAIVKR---L 249

Query: 277 QNGNDGDHSHWYPFFCGDFNS 297
               D  +S+      GD NS
Sbjct: 250 LTRKDTSYSNIKVLLSGDLNS 270

>KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 371

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 107/238 (44%), Gaps = 42/238 (17%)

Query: 95  KFKLMTYNCLAQALIRRKLFPTSGDALK-WYRRSKVLLNEFKY-YNADVICLQEIDYIQY 152
           +F ++TYN L+   +  +++    D  K W  R ++L +E  Y Y +D+ICLQE+    Y
Sbjct: 33  RFTMLTYNMLSPYYMWPQVYTYVKDEYKDWDYRHRLLEHELFYKYKSDIICLQELTTNDY 92

Query: 153 QSFWKDELA-KLGYDSQFHRQASKNH---------GVAIVW---KREYFVMTDKMLID-- 197
             FWK ++  ++ Y S F  +    +         GV I +   K EY   +   L D  
Sbjct: 93  NEFWKKQMMNRMNYGSNFTAKTPPKYWTKPLECMDGVGIFYNLDKFEYLFSSSLYLNDLV 152

Query: 198 --FDRESSGDIPPR--TTTNNAGLILSLKFSDKVAQ-----------EHNLKKTGIIVGT 242
             FD++    +     T TN AG ++       VA+            H   K+ I+V  
Sbjct: 153 GTFDQQELHYLTHHNITLTNGAGDVIGEDSLYNVAKARNQVCLFVMLRHRESKSIIVVIN 212

Query: 243 THLFWHPFGTFERTR--QCYVVLNKVKEFSHRVNVLQNGNDG-DHSHWYPFFCGDFNS 297
           THL+W     ++  +  QC +++ K++     +  L  G +G  +S+    F GDFNS
Sbjct: 213 THLYW----KYDEVKLVQCLIIMRKLQRI---IKGLLMGIEGVTYSNVKILFSGDFNS 263

>NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78
          Length = 855

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 106/256 (41%), Gaps = 34/256 (13%)

Query: 67  IDPDFPPELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFP-TSGDALKW-Y 124
           ID +  P  ++    +   +   ++E   F L++YN L Q     K++  T   AL W Y
Sbjct: 497 IDTEGEPVREYDSLKLADANGNPDLEKKSFTLLSYNTLCQHYATPKMYRYTPSWALSWDY 556

Query: 125 RRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFH----------RQAS 174
           RR K L ++   Y +D++CLQE++   ++ FW   L K  Y   FH          + + 
Sbjct: 557 RREK-LKDQILSYQSDILCLQEVESKTFEEFWSPLLEKYDYQGIFHIKTRAKTMQSKDSK 615

Query: 175 KNHGVAIVWKREYFVMTDKMLIDFDR--------ESSGDIPPRTTTNNAGLILSLKFSDK 226
           K  G  I +K+  F +  K  +DF          + + D   R   N   + L LK    
Sbjct: 616 KVDGCCIFFKKSKFKLLFKEAMDFSGTWMKHKKFQRTEDYLNR-AMNKDNVALYLKLQSL 674

Query: 227 VAQEHNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSH 286
            + E       + V TTHL W P     +T Q  ++L+ ++      N  Q     D   
Sbjct: 675 TSGE------SVWVVTTHLHWDPKFNDVKTFQVGILLDHMEALLKEENPKQ-----DVKK 723

Query: 287 WYPFFCGDFNSQPFDS 302
                CGD NS  FDS
Sbjct: 724 ANVVICGDLNSY-FDS 738

>TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {ON}
           Anc_7.90 YOL042W
          Length = 388

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 100/241 (41%), Gaps = 39/241 (16%)

Query: 96  FKLMTYNCLAQALIRRKLFPTSGDALK-WYRRSKVLLNE-FKYYNADVICLQEIDYIQYQ 153
           F  ++YN L+   +  +++       K W  R  +L  E    Y +D++C+QE+  I Y 
Sbjct: 44  FTFLSYNMLSPHYMWPQVYTYVPQEYKDWKYRHNLLEKEILDKYRSDIMCVQELTTIDYY 103

Query: 154 SFWKDELAK-LGYDSQFHRQASKNH---------GVAIVWKREYF-------VMTDKMLI 196
           SFW+D L K   Y S+F  +   N+         GV I +  + F       +  + +  
Sbjct: 104 SFWRDSLRKGFNYGSRFIAKNPPNYWTKSLVEMDGVGIFYNLDMFDYIGSRSINLNDLAS 163

Query: 197 DFDRESSGDIPPR--TTTNNAGLILS------LKFSDK-----VAQEHNLKKTGIIVGTT 243
            FDR+    +  +  T  N  G +        L  S       V  EH + K   ++  T
Sbjct: 164 TFDRKELDYMAAKEITILNGNGDVTGKESLYELALSKNQVCLFVMVEHKISKDVFVIINT 223

Query: 244 HLFWHPFGTFERTR--QCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPFD 301
           HL+W     +E  +  QC +++ K+ +  + +       D +++     F GD N   FD
Sbjct: 224 HLYWK----YEEVKLTQCMIIMRKLAKIVNELLFNAESRDMNYNKVKILFSGDLNDG-FD 278

Query: 302 S 302
           S
Sbjct: 279 S 279

>Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119
           bp, 372 aa] {ON}
           (12595..13362,13366..13545,13548..13718) [1119 nt, 373
           aa]
          Length = 372

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 103/239 (43%), Gaps = 37/239 (15%)

Query: 91  VEGFKFKLMTYNCLAQALIRRKLFPTSGDALK-WYRRSKVLLNEF-KYYNADVICLQEID 148
           + G KF L+TYN L+   +  +++    D  K W  R  +L +E  + Y ADV+CLQE+ 
Sbjct: 32  IPGHKFTLLTYNMLSPYYMWPQVYNYVPDEFKDWKYRHMLLEDELLRTYKADVMCLQELT 91

Query: 149 YIQYQSFWKDELAK-LGYDSQF---------HRQASKNHGVAIVW---KREYFVMTDKML 195
           +  Y S+WK    K L Y S+F          +   +  G  I +   K EY   T   L
Sbjct: 92  WEDYLSYWKPVFGKQLNYGSKFVAKTPPKYWDKTEQQMDGEGIFFNLDKFEYISSTRLFL 151

Query: 196 ID----FDRESSGDIPPRTT--TNNAG-------LILSLKFSDK----VAQEHNLKKTGI 238
            D    F+      +  +    T+ AG       L   LK  ++    V+ +H       
Sbjct: 152 NDVVNTFEEHELNYMKRKIVKLTDGAGNPVGEETLYEILKNRNQVCLFVSLKHKETNNVF 211

Query: 239 IVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNS 297
           +V  THL+W  +   + T QC +++ K+   S  +N L  G D   S    F  GD NS
Sbjct: 212 VVINTHLYWK-YDEVKLT-QCMIIMRKL---SQIINELLIGADPSLSKDVIFITGDLNS 265

>KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.90
           YOL042W
          Length = 356

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 103/234 (44%), Gaps = 39/234 (16%)

Query: 96  FKLMTYNCLAQALIRRKLFPTSGDALK-WYRRSKVLLNE-FKYYNADVICLQEIDYIQYQ 153
           F L+TYN L+Q+ +  +++       K W  R K+L  E  K YNAD+ICLQE+    Y+
Sbjct: 22  FTLLTYNILSQSYMWPQVYKYVPAKYKSWEYRHKLLEYEILKLYNADIICLQELTSRDYE 81

Query: 154 SFWKDELAKLGYDSQF---------HRQASKNHGVAIVWKREYFVMTDK--------MLI 196
            +W+ +L+K    S F          + A    GV I +  + F + D         ++ 
Sbjct: 82  YYWRKKLSKFNKGSDFICKTPPKYWTKAADDLDGVGIFYNLDMFELIDSNGIRLSDFLIS 141

Query: 197 DFDRESSGDIPPRTTTNNAGLILSLKFSD--KVAQEHNL---------KKTGI--IVGTT 243
           DF++     +  R      G    +K S+   V +E N          K+TG   +V TT
Sbjct: 142 DFEQPELDYLASRKLVLTDGEGRQIKVSNILDVLEEKNQVCLFMTLKHKRTGATVVVVTT 201

Query: 244 HLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNS 297
           HL+W  +   + T QC +++ ++ +        Q   DG  S     F GD NS
Sbjct: 202 HLYW-KYDEIKLT-QCMIIMRQLSKIMKD----QLKKDGS-SFVKVLFAGDLNS 248

>NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa]
           {ON} Anc_7.90 YOL042W
          Length = 365

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 109/249 (43%), Gaps = 41/249 (16%)

Query: 81  PILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFPTSGDALK-W-YRRSKVLLNEFKYYN 138
           P +PL +   +   KF +++YN L+ + +  +++    D  K W YR + + L     Y 
Sbjct: 17  PKIPLSR--RIMNDKFTVLSYNMLSPSYMWPQVYTYVPDQYKDWNYRHTLLELELLDKYK 74

Query: 139 ADVICLQEIDYIQYQSFWKDELA-KLGYDSQF---------HRQASKNHGVAIVWKREYF 188
           AD++C+QE+    Y  +W+ +L   +GY S+F          R      GVAI +  + F
Sbjct: 75  ADIMCVQEMTKRDYIDYWQLKLGTTIGYGSKFIAKSPPKYWERHLLDLDGVAIFYNLQKF 134

Query: 189 -------VMTDKMLIDFDRESSGDIPPRT--TTNNAGL---------ILSLK--FSDKVA 228
                  +  ++ L  F+ E    +  +T   T+ AG+         ILS+K   S  V 
Sbjct: 135 DFISSSGIYLNEFLDVFNPEELQYLKEKTLELTDGAGIKIDEKTLFEILSVKNQVSLFVC 194

Query: 229 QEHNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWY 288
            +H       I+  THL+W       +  QC +++   +E S  ++ L    D  HS   
Sbjct: 195 LKHKETGQVFIIINTHLYWKYDEV--KLSQCIIIM---RELSKIIDELL--QDVRHSKVK 247

Query: 289 PFFCGDFNS 297
             F GD NS
Sbjct: 248 IIFAGDLNS 256

>KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 368

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/266 (25%), Positives = 112/266 (42%), Gaps = 46/266 (17%)

Query: 80  RPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFPTSGDALK-WYRRSKVLLNE-FKYY 137
           +P LP  +  +V    F LMTYN L+   +  +++    +  K W  R ++L  E    Y
Sbjct: 15  KPSLPEIRN-SVSRSTFTLMTYNMLSPYYMWPQVYTYVPEKYKDWSYRHRLLEREILNLY 73

Query: 138 NADVICLQEIDYIQYQSFWKDEL-AKLGYDSQF---------HRQASKNHGVAIVWKREY 187
            AD++C+QE+    Y+ FWK+    K+ Y S +          R   +  GV I +    
Sbjct: 74  RADIMCVQELTCKDYEGFWKNHFKTKMNYGSSYIAKTPPKYWKRPEDEMDGVGIFYNLNK 133

Query: 188 F-------VMTDKMLIDFDRESSGDIPPR--TTTNNAG-------LILSL----KFSDKV 227
           F       +  + ++  F+      +     T TN AG       L+  L    + S  V
Sbjct: 134 FEHISTSSIYLNDLIGLFNISELNYLKSTIITLTNGAGEPIDKDSLLNVLHGRNQVSLFV 193

Query: 228 AQEHNLKKTGIIVGTTHLFWHPFGTFERTR--QCYVVLNKVKEFSHRV--NVLQNGNDGD 283
           +  H   +T  +V  THL+W     ++  +  QC  ++ K+    HRV  ++L       
Sbjct: 194 SLLHKETRTLFVVVNTHLYW----KYDEVKLCQCLTIMRKL----HRVIKSLLMGMEGVT 245

Query: 284 HSHWYPFFCGDFNSQPFDSPYLSMTR 309
           +S     F GD NS P DSP +   +
Sbjct: 246 YSKVKILFAGDLNSAP-DSPVIKFLK 270

>NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90
           YOL042W
          Length = 389

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 117/261 (44%), Gaps = 48/261 (18%)

Query: 79  KRPILPLHKGENVEGF----------KFKLMTYNCLAQALIRRKLFPTSGDALK-WYRRS 127
           +R  LP+ +  NV             KF L+TYN L+ + +  +++    D  K W  R 
Sbjct: 3   RRQFLPVARSSNVLSASRNASKLINDKFTLLTYNMLSPSYMWPQVYTYVPDPYKDWQYRH 62

Query: 128 KVLLNEF-KYYNADVICLQEIDYIQYQSFWKDELAK-LGYDSQF---------HRQASKN 176
           K+L +E    Y AD++CLQE+    Y   WK  L   +GY S+F          R+  + 
Sbjct: 63  KLLESELLGSYKADIMCLQEMTSRDYNENWKRLLGSGIGYGSKFIAKSPPLYWEREVDEI 122

Query: 177 HGVAIVW--KREYFVMTDKMLID--FDRESSGDI-----PPRTTTNNAGLILSLK-FSDK 226
            GV I +  K+  F+ +  + ++   +  SS ++          T+ AG+ +  K   D 
Sbjct: 123 DGVGIFYNLKKFDFISSSGIYLNQFLNVFSSTELEYLHSKRLVLTDGAGVPIGEKNLLDV 182

Query: 227 VAQEHNL--------KKTG--IIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVL 276
           ++ ++ +        K+TG   +V  THL+W  +   + T QC +++   +E S  ++ L
Sbjct: 183 ISGKNQVCLFVSLKHKETGEMFVVINTHLYWK-YDEVKLT-QCMIIM---RELSKIIDEL 237

Query: 277 QNGNDGDHSHWYPFFCGDFNS 297
             G D D       F GD NS
Sbjct: 238 VKGVD-DPGKVKILFTGDLNS 257

>Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W
           (NGL1) - DNase/RNase (putative); CCR4 C-terminal
           homolog, homology to drosophila Angel gene [contig 47]
           FULL
          Length = 372

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/250 (26%), Positives = 105/250 (42%), Gaps = 45/250 (18%)

Query: 96  FKLMTYNCLAQALIRRKLFPTSGDALK-WYRRSKVLLNE-FKYYNADVICLQEIDYIQYQ 153
           F  MTYN L+   +  +++    +  K W  R ++L  E    Y AD++C+QE+    Y 
Sbjct: 34  FTFMTYNMLSPYYMWPQVYTYVPEKYKEWSYRHRLLEREILNLYRADIMCVQELTCKDYD 93

Query: 154 SFWKDEL-AKLGYDSQF---------HRQASKNHGVAIVWKREYF-------VMTDKMLI 196
            FWK    +K+ Y S F          R   +  GV I +  + F       +  + ++ 
Sbjct: 94  GFWKGHFKSKMNYGSSFISKTPPKYWQRPPDEMDGVGIFYNLDKFEHISTTSIYLNDLIG 153

Query: 197 DFDRESSGDIPPR--TTTNNAG-------LILSL----KFSDKVAQEHNLKKTGIIVGTT 243
            F+      +     T TN AG       L+  L    + S  V+  H   +T  +V  T
Sbjct: 154 LFNISELNYLKSTIITLTNGAGEPVDKDSLLNVLHGRNQVSLFVSLMHKETRTLFVVINT 213

Query: 244 HLFWHPFGTFERTR--QCYVVLNKVKEFSHRV-NVLQNGNDG-DHSHWYPFFCGDFNSQP 299
           HL+W     ++  +  QC  ++ K+    HRV   L  G +G  +S     F GD NS P
Sbjct: 214 HLYW----KYDEVKLCQCLTIMRKL----HRVIKSLLMGREGVTYSKVKILFAGDLNSAP 265

Query: 300 FDSPYLSMTR 309
            DSP +   +
Sbjct: 266 -DSPVVKFLK 274

>SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {ON}
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042W
          Length = 368

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 102/236 (43%), Gaps = 38/236 (16%)

Query: 95  KFKLMTYNCLAQALIRRKLFPTSGDALK-WYRRSKVLLNE-FKYYNADVICLQEIDYIQY 152
           KF L+TYN L+   +  +++    +  K W  R ++L +E FK Y AD++CLQE+    Y
Sbjct: 29  KFTLLTYNMLSPCYMWPQVYTYVPEKFKEWGYRHRLLEDELFKTYKADIMCLQELTTKDY 88

Query: 153 QSFWKDELAK-LGYDSQF---------HRQASKNHGVAIVWKREYF-------VMTDKML 195
            +FW  ++ + L Y S F          R   +  GV I +  + F       +  + +L
Sbjct: 89  HNFWDKQMKETLNYGSNFISKTPPKYWKRPTDEMDGVGIFYNLDKFEYISSSSIYLNDVL 148

Query: 196 IDFDRESSGDIPPR--TTTNNAG-------LILSLKFSDK----VAQEHNLKKTGIIVGT 242
             F+      +     T TN AG       L+  L+  ++    V+  H    T  +V  
Sbjct: 149 GIFNVRELKYMKETMITLTNGAGEAIGKDNLMNILQGRNQVCLFVSLRHKDTNTVFVVIN 208

Query: 243 THLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDG-DHSHWYPFFCGDFNS 297
           THL+W       +  QC  ++ K++     +  L  G +G  +S     F GD NS
Sbjct: 209 THLYWKYDEV--KLSQCLTIMRKLERI---IKSLLMGVEGVTYSKVKILFSGDLNS 259

>KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90
           YOL042W
          Length = 381

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 71/254 (27%), Positives = 114/254 (44%), Gaps = 45/254 (17%)

Query: 95  KFKLMTYNCLAQALIRRKLFPTSGDALK-WYRRSKVLLNEF-KYYNADVICLQEIDYIQY 152
           +F L+TYN L+ A +  +++    +  K W  R  +L  E    Y AD++C+QE+    Y
Sbjct: 38  RFTLLTYNILSPAYMWPQVYTYVPEQCKQWEFRHDLLEQELLGKYKADIMCIQEMTKRDY 97

Query: 153 QSFWKD-ELAKLGYDSQF---------HRQASKNHGVAIVWKREYF-------VMTDKML 195
           Q FW      K    S+F          R+  +  GVAI + R+ F       +  ++ML
Sbjct: 98  QQFWSPIASGKCDMGSEFISKTAPKYWKREPDELDGVAIFYNRKMFDFVSSKGIYLNQML 157

Query: 196 IDF-DRE-----------SSGDIPPRTTTNNAGLILSLKFSDKVAQEHNL--KKTGI--I 239
             F D E           + G   P   TN   L+  LK  ++V+   +L  K TG+  +
Sbjct: 158 DAFNDHELEYLGQKKLGLTDGAGNPTGETN---LLNFLKLKNQVSLFVSLQHKSTGMYFV 214

Query: 240 VGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRV-NVLQNGNDGDHSHWYPFFCGDFNSQ 298
           V  THL+W  +   + T QC V++   +E S  + ++L++  D         F GD NS 
Sbjct: 215 VINTHLYWK-YDEVKLT-QCMVIM---RELSQIIDDLLKDVPDVTKEKVKIIFTGDLNST 269

Query: 299 PFDSPYLSMTRKPI 312
             +SP ++  R  I
Sbjct: 270 K-NSPVINFLRGNI 282

>TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {ON}
           Anc_7.90 YOL042W
          Length = 366

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 103/235 (43%), Gaps = 36/235 (15%)

Query: 95  KFKLMTYNCLAQALIRRKLFPTSGDALK-WYRRSKVLLNE-FKYYNADVICLQEIDYIQY 152
           KF  MTYN L+   +  +++    D  K W  R K+L  E    Y AD++CLQE+    Y
Sbjct: 28  KFTFMTYNMLSPHYMWPQVYTYVPDEYKDWNYRHKLLEKEILNSYRADIMCLQELTASDY 87

Query: 153 QSFWKDELAK-LGYDSQF---------HRQASKNHGVAIVW---KREYFVMTDKMLID-- 197
             +W++ + +   Y S+F          + A    GV I +   K +Y   T   L D  
Sbjct: 88  HQYWEEVIDRDFHYGSRFIAKPPPQYWQKDAKDVDGVGIFYNLNKFDYISSTSIHLNDLI 147

Query: 198 --FDRESSGDIPPRTT--TNNAG-------LILSLKFSDK----VAQEHNLKKTGIIVGT 242
             FD +    +  +    T+ AG       L+  LK  ++    VA +H    T  +V  
Sbjct: 148 GSFDLDELSYLKSKQVKLTDGAGNPKGEKTLLEILKSRNQVGLFVALKHKDTNTIFVVIN 207

Query: 243 THLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNS 297
           THL+W  +   + T QC +++ K+ +    + V ++G    ++     F GD NS
Sbjct: 208 THLYW-KYDEVKLT-QCLIIMRKLAKIIRDLLVGEHGT--TYNKMKVVFAGDLNS 258

>Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 106/238 (44%), Gaps = 43/238 (18%)

Query: 95  KFKLMTYNCLAQALIRRKLFPTSGDALK-WYRRSKVL----LNEFKYYNADVICLQEIDY 149
           +F L+TYN L+ + +  +++    +  K W  R K+L    LN FK   AD++CLQE+  
Sbjct: 26  RFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHKLLERELLNTFK---ADIMCLQEMTA 82

Query: 150 IQYQSFWKDELA-KLGYDSQFHRQASKNH---------GVAIVWKREYF-------VMTD 192
             Y+ +W+D +   + Y S+F  +    +         GV+I +  E F       +  +
Sbjct: 83  RDYEDYWRDYIGVDINYGSKFIPKTPPKYWKNPVKDMDGVSIFYNLEKFDYISSTGIYLN 142

Query: 193 KMLIDF-DRESSGDIPPRTTTNNAG--------LILSLKFSDK----VAQEHNLKKTGII 239
           ++L  F +RE       + T  +          L+  LK  ++    V+ +H    T  +
Sbjct: 143 QLLNVFNERELKYLFNKKVTLTDGASNIVGEDSLLDVLKGKNQVCLFVSLKHKETGTVFV 202

Query: 240 VGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNS 297
           V  THL+W  +   + T QC +++   +E S  +  L +G+          F GD NS
Sbjct: 203 VLNTHLYWK-YDEVKLT-QCMIIM---RELSKIIKQLLSGDVKSQRKVKILFTGDLNS 255

>ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 356

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 98/237 (41%), Gaps = 40/237 (16%)

Query: 95  KFKLMTYNCLAQALIRRKLFPTSGDALK-WYRRSKVLLNE-FKYYNADVICLQEIDYIQY 152
           K  ++TYN L+   +  +++    D  K W  R K+L  E    Y AD++CLQE+  + Y
Sbjct: 21  KLSVLTYNMLSPYYMWPQVYTYVPDEYKKWNYRHKLLQKEILGLYRADIMCLQELTSLDY 80

Query: 153 QSFWKDELA-KLGYDSQF---------HRQASKNHGVAIVW---KREYFVMTDKMLID-- 197
           Q +W   L  K  Y S++          R  S+  GV + +   K +Y   T   L D  
Sbjct: 81  QQYWNKVLMEKYNYGSKYIAKPPPKYWERSLSEMDGVGVFYDLNKFDYISSTGIYLNDLF 140

Query: 198 --FDRESSGDIPPRT---TTNNAGLILSLKFSDK----------VAQEHNLKKTGIIVGT 242
             FD +    +  +    T      +  +  SD           V+  H    T +IV  
Sbjct: 141 GTFDLKEQNYLEHKMLQLTDGQGNPMEKMTLSDVLKGRNQVCMFVSLRHKATNTFLIVIN 200

Query: 243 THLFWHPFGTFERTR--QCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNS 297
           THL+W     ++  +  QC +++ ++ +     ++L    D  ++     F GD NS
Sbjct: 201 THLYW----KYDEVKLAQCMIIMRRLSKIIK--DLLIGVQDTTYNKVKIIFAGDMNS 251

>TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90
           YOL042W
          Length = 391

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 104/240 (43%), Gaps = 40/240 (16%)

Query: 95  KFKLMTYNCLAQALIRRKLFPTSGDALK-WYRRSKVLLNEF-KYYNADVICLQEIDYIQY 152
           KF ++TYN L+   +  +++    D  K W  R K+L  E  + Y AD++CLQE+ +  Y
Sbjct: 47  KFTMLTYNMLSPHYMWPQVYTYVPDQYKDWKYRHKLLEFELMQKYKADIMCLQELTWEDY 106

Query: 153 QSFWKDEL-AKLGYDSQF---------HRQASKNHGVAIVWKREYF--VMTDKMLID--- 197
            S+WK +   K+ Y S+F          +   +  G  I + +E F  + + K+ ++   
Sbjct: 107 ISYWKPKCNEKMNYGSKFVAKTPPAYWEKTKQEMDGEGIFFNQEKFEYISSTKLFLNDVV 166

Query: 198 --FDRE------------SSGDIPPRTTTNNAGLILSLK--FSDKVAQEHNLKKTGIIVG 241
             F+              + G   P T TNN   + + +      V+  H    T  +V 
Sbjct: 167 GTFEEHEIEYMKKKIVTLTDGAGKP-TGTNNLFTVATTRNQVCLFVSLRHKATNTVFVVI 225

Query: 242 TTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYP----FFCGDFNS 297
            THL+W  +   + T QC +++ K+    + + +  N    D+S         F GD NS
Sbjct: 226 NTHLYWK-YDEVKLT-QCMIIMRKLSHIINELLIGSNAKIVDNSTISKDVKIIFSGDLNS 283

>CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042w
          Length = 359

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 102/235 (43%), Gaps = 38/235 (16%)

Query: 96  FKLMTYNCLAQALIRRKLFPTSGDALK-WYRRSKVLLNEF-KYYNADVICLQEIDYIQYQ 153
           F L++YN L+ + +  +++    +  K W  R K+L  E    Y AD++CLQE+    Y 
Sbjct: 22  FTLLSYNLLSPSYMWPQVYTYVPEKYKDWNYRHKLLEQELLDKYRADIMCLQELTSEDYS 81

Query: 154 SFWKDEL-AKLGYDSQF---------HRQASKNHGVAIVWKREYF-------VMTDKMLI 196
           +FWK  L   + Y S +          R   +  GV I +  + F       +  +++L 
Sbjct: 82  NFWKKALQTNMNYGSNYIAKTPPQYWKRPVEQMDGVGIFYNLDKFEFISRSGIYLNQLLG 141

Query: 197 DFDRESSGDI--PPRTTTNNAG-------LILSLKFSDKVAQEHNL--KKTG--IIVGTT 243
            F       +   P T T+ AG       L+  LK  ++VA   +L  K+TG   +V  T
Sbjct: 142 VFSNNELEYLEKKPVTLTDGAGNQVGEQSLLQILKSKNQVALFVSLKHKETGNVFVVINT 201

Query: 244 HLFWHPFGTFERTRQCYVVLNKVKEFSHRVNV-LQNGNDGDHSHWYPFFCGDFNS 297
           HL+W       +  QC +++ ++     +  V L+N  D         F GD NS
Sbjct: 202 HLYWKYDDV--KLTQCMIIMRELARIIEKHLVGLENVTDDKIK---ILFTGDLNS 251

>Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 102/235 (43%), Gaps = 37/235 (15%)

Query: 95  KFKLMTYNCLAQALIRRKLFPTSGDALK-WYRRSKVLLNEF-KYYNADVICLQEIDYIQY 152
           +F L+TYN L+ + +  +++    +  K W  R K+L  E    + AD++CLQE+    Y
Sbjct: 26  RFTLLTYNMLSPSYMWPQVYTYVAERYKNWNYRHKLLEKELLTTFKADIMCLQEMTTRDY 85

Query: 153 QSFWKDELA-KLGYDSQFHRQASKNH---------GVAIVWKREYF-------VMTDKML 195
           +++W + +   + Y S+F  +    +         GV+I +  E F       +  +++L
Sbjct: 86  ENYWHNSIGVDINYGSKFISKTPPKYWEKPVKDMDGVSIFYNLEKFDYISSSGIYLNQLL 145

Query: 196 IDFDRESSGDIPPRTTTNNAG---------LILSLKFSDK----VAQEHNLKKTGIIVGT 242
             F+      +  +  T   G         L+  LK  ++    V+ +H    T  +V  
Sbjct: 146 NVFNERELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFVSLKHKETNTIFVVLN 205

Query: 243 THLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNS 297
           THL+W  +   + T QC +++   +E S  +  L  G+          F GD NS
Sbjct: 206 THLYW-KYDEVKLT-QCMIIM---RELSKIIKQLLPGDANAQEKVKILFTGDLNS 255

>Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 103/238 (43%), Gaps = 43/238 (18%)

Query: 95  KFKLMTYNCLAQALIRRKLFPTSGDALK-WYRRSKVL----LNEFKYYNADVICLQEIDY 149
           +F L+TYN L+ + +  +++    +  K W  R K+L    LN FK   AD++CLQE+  
Sbjct: 26  RFTLLTYNMLSPSYMWPQVYTYVAERYKSWSYRHKLLEKELLNSFK---ADIMCLQEMTR 82

Query: 150 IQYQSFWKDELA-KLGYDSQFHRQASKNH---------GVAIVWKREYF-------VMTD 192
             Y+ +W D +   + Y S+F  +    +         GV+I +  + F       +  +
Sbjct: 83  RDYEDYWHDSIGVNINYGSKFISKTPPKYWKKPLEDMDGVSIFYNLDKFDFISSSGIYLN 142

Query: 193 KMLIDF-DRESSGDIPPRTTTNNAG--------LILSLKFSDK----VAQEHNLKKTGII 239
           ++L  F +RE       R    +          L+  LK  ++    V+ +H    T  +
Sbjct: 143 QLLNVFNERELKYLYNKRVILTDGASNVVGEDSLLDVLKGKNQVCLFVSLKHKETDTIFV 202

Query: 240 VGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNS 297
           V  THL+W  +   + T QC +++   +E S  +  L  G+          F GD NS
Sbjct: 203 VLNTHLYW-KYDEVKLT-QCMIIM---RELSKIIEQLLPGDAKGRGKVKILFTGDLNS 255

>Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii ACR277C
          Length = 367

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/263 (22%), Positives = 106/263 (40%), Gaps = 46/263 (17%)

Query: 77  FIKRPILPLHKGE---------NVEGFK-FKLMTYNCLAQALIRRKLFPTSGDALK-WYR 125
            I R I+P+ K           NV   K   ++TYN L+   +  +++    D  K W  
Sbjct: 1   MIHRRIVPISKNSHLKLMNGTNNVSSNKTLSVLTYNMLSPYYMWPQVYTYVPDKFKDWNY 60

Query: 126 RSKVLLNEFKY-YNADVICLQEIDYIQYQSFWKDELA-KLGYDSQFHRQASKNHGVA--- 180
           R K+L  E  Y + AD++CLQE+    Y  FW+ ++  +L Y S F  +    +  A   
Sbjct: 61  RHKLLEYELFYKHKADILCLQELTTEDYNQFWRKQMKRRLSYGSNFISKPPPKYWTAGLQ 120

Query: 181 --------------------IVWKREYFVMTDKMLIDF-----DRESSGDIPPRTTTNNA 215
                               +++  ++  M  K  +D+       +++G   P TT +  
Sbjct: 121 EMDGVGTFYNTEKLEFISSTVIYLNDFLSMFSKRELDWMSRRQITQTNGANDPVTTRSLL 180

Query: 216 GLILSL-KFSDKVAQEHNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVN 274
            ++L   +    V       K+ I+V  THL+W       +  QC  ++ K+K+  +++ 
Sbjct: 181 SILLDRNQVCLFVCLREKDTKSLIVVVNTHLYWKYDEV--KLSQCLTIMRKLKQVINKLT 238

Query: 275 VLQNGNDGDHSHWYPFFCGDFNS 297
               G    +S       GD NS
Sbjct: 239 TTLEG--VTYSQIKIILGGDLNS 259

>YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putative
           endonuclease, has a domain similar to a
           magnesium-dependent endonuclease motif in mRNA
           deadenylase Ccr4p; the authentic, non-tagged protein is
           detected in highly purified mitochondria in
           high-throughput studies
          Length = 363

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 105/238 (44%), Gaps = 43/238 (18%)

Query: 95  KFKLMTYNCLAQALIRRKLFPTSGDALK-WYRRSKVL----LNEFKYYNADVICLQEIDY 149
           +F L+TYN L+ + +  +++    +  K W  R ++L    LN FK   AD++CLQE+  
Sbjct: 26  RFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLLEKELLNTFK---ADIMCLQEMTA 82

Query: 150 IQYQSFWKDELA-KLGYDSQFHRQASKNH---------GVAIVWKREYF-------VMTD 192
             Y+ +W D +   + Y S+F  +    +         GV+I +    F       +  +
Sbjct: 83  RDYEDYWHDSIGVDVNYGSKFISKTPPKYWKKPVKDMDGVSIFYNLAKFDFISSSGIYLN 142

Query: 193 KMLIDFDRESSGDIPPRTTTNNAG---------LILSLKFSDKVAQEHNL--KKTGII-- 239
           ++L  F++     +  +  T   G         L+  LK  ++V    +L  K+TG I  
Sbjct: 143 QLLNVFNQRELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFVSLRHKETGTIFV 202

Query: 240 VGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNS 297
           V  THL+W  +   + T QC +++   +E S  +  L  G+          F GD NS
Sbjct: 203 VLNTHLYWK-YDEVKLT-QCMIIM---RELSKIIKQLLPGDVKGQERVKILFTGDLNS 255

>Skud_4.568 Chr4 complement(1016158..1017594) [1437 bp, 478 aa] {ON}
           YDR306C (REAL)
          Length = 478

 Score = 34.3 bits (77), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 35/69 (50%)

Query: 368 KDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEISNWAHTWRGLL 427
           K+ + +++E+ +   NSL  R V  + V YR +H  +   + E G+   S    T   ++
Sbjct: 92  KEEDGQVIEREKKSINSLSSRMVLPWEVQYRIIHYLDVPQEEENGDKVTSGKRITTGIIV 151

Query: 428 DYLFFIRHW 436
           +YL   R+W
Sbjct: 152 NYLLVCRNW 160

>TBLA0C00690 Chr3 complement(136694..138508) [1815 bp, 604 aa] {ON}
           Anc_8.87 YFL002C
          Length = 604

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%)

Query: 425 GLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTEH 473
           G+  Y+ FIR++       I  L+SF+     K+ GL R+P   E+T+H
Sbjct: 425 GIKVYVSFIRNYSKHSAGSIFRLQSFDYAGLCKMLGLFRLPRMPEITKH 473

>KAFR0D01120 Chr4 complement(222704..224536) [1833 bp, 610 aa] {ON}
           Anc_8.87 YFL002C
          Length = 610

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%)

Query: 429 YLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTEHGQ 475
           Y+ FIRH+       I  L++F      K+ GL+R+P   E+T++ Q
Sbjct: 435 YVAFIRHYSNHTASSIFRLQNFSYTGLAKMYGLIRIPRMPEVTKYLQ 481

>Suva_9.189 Chr9 complement(313656..313979) [324 bp, 107 aa] {ON}
           YIL014C-A (REAL)
          Length = 107

 Score = 29.6 bits (65), Expect = 6.2,   Method: Composition-based stats.
 Identities = 12/53 (22%), Positives = 23/53 (43%)

Query: 104 LAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFW 156
           + + L+  KL PT  +A +W        ++F+Y      C +  D   +  +W
Sbjct: 53  IMETLVETKLVPTLENATQWVSDMSAYWSQFEYGEEPTYCPKSFDLNDFYEYW 105

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,439,352
Number of extensions: 2234167
Number of successful extensions: 5139
Number of sequences better than 10.0: 78
Number of HSP's gapped: 5092
Number of HSP's successfully gapped: 79
Length of query: 496
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 382
Effective length of database: 40,409,475
Effective search space: 15436419450
Effective search space used: 15436419450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)