Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07986g3.485ON1024102451140.0
Skud_7.4363.485ON1036105330140.0
Smik_6.2213.485ON1036105330070.0
Suva_7.4133.485ON1037105830050.0
TDEL0D055303.485ON1031105730020.0
NDAI0G009903.485ON1054108629990.0
NCAS0E009503.485ON1052108429900.0
YGR125W3.485ON1036105429720.0
CAGL0I10626g3.485ON1070103228620.0
KAFR0C019103.485ON1020106828420.0
Kpol_480.183.485ON1057107327430.0
SAKL0F02926g3.485ON105083027010.0
TPHA0D042103.485ON104997526670.0
Kwal_55.212013.485ON1011106326500.0
KLTH0F14674g3.485ON1010106726390.0
KNAG0B008603.485ON108885226340.0
TBLA0C044403.485ON115091026070.0
KLLA0E04731g3.485ON106088524920.0
AFR304W3.485ON1015101023950.0
SAKL0B03124g8.99ON7446731442e-08
Smik_16.2418.99ON7444881292e-06
Skud_16.2868.99ON7452861228e-06
TDEL0C012808.99ON7272871192e-05
Suva_16.3228.99ON7424931183e-05
KLLA0E14059g8.99ON7064981174e-05
TBLA0C052708.99ON7765211103e-04
KNAG0D023908.99ON7165991093e-04
NCAS0B048008.99ON7245651075e-04
ZYRO0F04796g8.99ON7352851010.003
Ecym_7084na 1ON6892711000.003
NDAI0B022108.99ON706521990.004
Kwal_27.110398.99ON726307990.005
AGR213Cna 1ON689291960.010
SAKL0H08800gna 1ON620253950.012
YPR003C8.99ON754501950.014
Kpol_467.118.99ON744283920.034
KLTH0G16764g8.99ON710551880.10
Smik_12.1518.271ON893421870.13
Suva_10.1768.271ON893225762.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C07986g
         (1024 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] ...  1974   0.0  
Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W...  1165   0.0  
Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W...  1162   0.0  
Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W...  1162   0.0  
TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3...  1160   0.0  
NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {...  1159   0.0  
NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {...  1156   0.0  
YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...  1149   0.0  
CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa...  1107   0.0  
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....  1099   0.0  
Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON...  1061   0.0  
SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] ...  1045   0.0  
TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3....  1031   0.0  
Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR12...  1025   0.0  
KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} sim...  1021   0.0  
KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {...  1019   0.0  
TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_...  1008   0.0  
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...   964   0.0  
AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic h...   927   0.0  
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    60   2e-08
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    54   2e-06
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...    52   8e-06
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    50   2e-05
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...    50   3e-05
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...    50   4e-05
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...    47   3e-04
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...    47   3e-04
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...    46   5e-04
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...    44   0.003
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...    43   0.003
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...    43   0.004
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    43   0.005
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    42   0.010
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    41   0.012
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...    41   0.014
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...    40   0.034
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...    39   0.10 
Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092...    38   0.13 
Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092...    34   2.7  

>ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1024

 Score = 1974 bits (5114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 970/1024 (94%), Positives = 970/1024 (94%)

Query: 1    MSNGVDRPSRNRQSISGAISVSLGLNRQVHRNSDGEFTXXXXXXXXXXXXXXXDSSSIEI 60
            MSNGVDRPSRNRQSISGAISVSLGLNRQVHRNSDGEFT               DSSSIEI
Sbjct: 1    MSNGVDRPSRNRQSISGAISVSLGLNRQVHRNSDGEFTNYNNTNNNGGRINQNDSSSIEI 60

Query: 61   VSPPFYNSNNYAGRSYLGGGFLSASPKMNLQQRNDDSSVLPIDRSRSKSIHGSQIIHRQT 120
            VSPPFYNSNNYAGRSYLGGGFLSASPKMNLQQRNDDSSVLPIDRSRSKSIHGSQIIHRQT
Sbjct: 61   VSPPFYNSNNYAGRSYLGGGFLSASPKMNLQQRNDDSSVLPIDRSRSKSIHGSQIIHRQT 120

Query: 121  AELSNNFSDDTTGMEEVRNRYDAMEDENSSLHHYMTHQDYQTLPGGTDEDWTNNNNSQTA 180
            AELSNNFSDDTTGMEEVRNRYDAMEDENSSLHHYMTHQDYQTLPGGTDEDWTNNNNSQTA
Sbjct: 121  AELSNNFSDDTTGMEEVRNRYDAMEDENSSLHHYMTHQDYQTLPGGTDEDWTNNNNSQTA 180

Query: 181  RASGSSIVQFGQDVLHYFPSAVXXXXXXXXXXXXXXMIIFPITEPIFSHLGSTGLSMFYI 240
            RASGSSIVQFGQDVLHYFPSAV              MIIFPITEPIFSHLGSTGLSMFYI
Sbjct: 181  RASGSSIVQFGQDVLHYFPSAVLGLLLNILDGLSYGMIIFPITEPIFSHLGSTGLSMFYI 240

Query: 241  STIISQCLYSGGLSSFTSGIGSEMIEVTPFFHTMAFAIRDAIPGQDDDIITTTIFCYAIS 300
            STIISQCLYSGGLSSFTSGIGSEMIEVTPFFHTMAFAIRDAIPGQDDDIITTTIFCYAIS
Sbjct: 241  STIISQCLYSGGLSSFTSGIGSEMIEVTPFFHTMAFAIRDAIPGQDDDIITTTIFCYAIS 300

Query: 301  SVVTGITFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFL 360
            SVVTGITFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFL
Sbjct: 301  SVVTGITFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFL 360

Query: 361  KKLFLDTDILWKWLLPVVLTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLD 420
            KKLFLDTDILWKWLLPVVLTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLD
Sbjct: 361  KKLFLDTDILWKWLLPVVLTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLD 420

Query: 421  QLRDLGWIFPAATSKDRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPAL 480
            QLRDLGWIFPAATSKDRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPAL
Sbjct: 421  QLRDLGWIFPAATSKDRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPAL 480

Query: 481  AISLHMDKFDVDKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAIL 540
            AISLHMDKFDVDKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAIL
Sbjct: 481  AISLHMDKFDVDKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAIL 540

Query: 541  TFAVMVIGPVIVSFIPICIVGSLIFXXXXXXXXXXXXDTRGKVTNFEYITIVIIVLTMGI 600
            TFAVMVIGPVIVSFIPICIVGSLIF            DTRGKVTNFEYITIVIIVLTMGI
Sbjct: 541  TFAVMVIGPVIVSFIPICIVGSLIFLLGYELLVEALLDTRGKVTNFEYITIVIIVLTMGI 600

Query: 601  YDFVLGVIVGILIACFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYV 660
            YDFVLGVIVGILIACFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYV
Sbjct: 601  YDFVLGVIVGILIACFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYV 660

Query: 661  LKLQNVLFFGTIISIEEKIDKLLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFN 720
            LKLQNVLFFGTIISIEEKIDKLLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFN
Sbjct: 661  LKLQNVLFFGTIISIEEKIDKLLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFN 720

Query: 721  RIKRFTQTKRIKLIISSIKERDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKK 780
            RIKRFTQTKRIKLIISSIKERDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKK
Sbjct: 721  RIKRFTQTKRIKLIISSIKERDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKK 780

Query: 781  LRDRAREKMQHSYNVTSAIEAAAAKKVPTDNNQISKKXXXXXXXXXXXXXPMNTPRNHQM 840
            LRDRAREKMQHSYNVTSAIEAAAAKKVPTDNNQISKK             PMNTPRNHQM
Sbjct: 781  LRDRAREKMQHSYNVTSAIEAAAAKKVPTDNNQISKKNLSLLNFRNLSSLPMNTPRNHQM 840

Query: 841  LSVAQNMFNDEEDVDALEDESCNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLWS 900
            LSVAQNMFNDEEDVDALEDESCNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLWS
Sbjct: 841  LSVAQNMFNDEEDVDALEDESCNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLWS 900

Query: 901  QLVPYFVKRRLTTQSILLHNQDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGSD 960
            QLVPYFVKRRLTTQSILLHNQDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGSD
Sbjct: 901  QLVPYFVKRRLTTQSILLHNQDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGSD 960

Query: 961  YKSSEEHKVTIVTETDTCLWLIDVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYT 1020
            YKSSEEHKVTIVTETDTCLWLIDVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYT
Sbjct: 961  YKSSEEHKVTIVTETDTCLWLIDVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYT 1020

Query: 1021 LVSA 1024
            LVSA
Sbjct: 1021 LVSA 1024

>Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1165 bits (3014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/1053 (57%), Positives = 745/1053 (70%), Gaps = 79/1053 (7%)

Query: 18   AISVSLGLNRQVHRNSDGEFTXXXXXXXXXXXXXXXDSSSIEIVSPPFYNSNNYAGRSYL 77
            AISVSLG+N+   +N                       +S+  +SPP         RSY+
Sbjct: 17   AISVSLGINQDSSKNK-------------------MHRASVSAMSPPL-------CRSYM 50

Query: 78   GGGFLSASPKMNLQQRNDDSSVLPI-DRSRSKSIHGSQIIHRQTAELSNNF--------- 127
             G F   S  M    +N   S LP  ++     IHGS+ +HRQTA+LSN F         
Sbjct: 51   SGFFTGGSSPM---VKNMSDSKLPFSNKQHPTVIHGSENLHRQTAQLSNEFCSSSVEENS 107

Query: 128  -----------SDDTTGMEEVRNRYDAMEDENSSLHHYM------------THQDYQTLP 164
                       SDD    + +R   + +++E S  +  +             ++  Q+ P
Sbjct: 108  PTIKDYMDIIDSDDRKDDQSMRTIVENIDEEYSDEYSRLLLSPASSNVDDERNRALQSGP 167

Query: 165  GGTDED-----WTNNNNSQTARASGSSIVQ----FGQDVLHYFPSAVXXXXXXXXXXXXX 215
                ED     + +   S   R    +I Q    F     HY P+AV             
Sbjct: 168  ISELEDDYGGGYQSLRPSHNLRFRPRNIWQWCTSFPFKFAHYLPAAVLGLLLNILDALSY 227

Query: 216  XMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSGGLSSFTSGIGSEMIEVTPFFHTMA 275
             MIIFPITEP+FSHLG TG+SMFYISTIISQ +YSGG SSF SGIGSEMIE+TPF+HTMA
Sbjct: 228  GMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMA 287

Query: 276  FAIRDAIPGQDDDIITTTIFCYAISSVVTGITFYLLGKLRLGKIVGFFPRHILIGCIGGV 335
             A++DA+ G DD+IITTTIFCY ISS++TG+ FY+LGKLRLGKIVGFFPRHILIGCIGGV
Sbjct: 288  LAVKDALEGNDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGV 347

Query: 336  GYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILWKWLLPVVLTILLVNTQKCFQNSLV 395
            GYFL+ITG+ VTTR+AK EY+W F   LF + D L KWLLPV+LT++L+ TQ+ F+NSLV
Sbjct: 348  GYFLIITGIEVTTRVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLV 407

Query: 396  LPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRWFDHYKLFDWHKVHWNLV 455
            LP+FYI+TL+LFHF+VAI+P++SLD LR+ GWIFP A S  +W+DHYKLF+ HKVHW+LV
Sbjct: 408  LPTFYILTLVLFHFIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLV 467

Query: 456  LAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAHGYSNFISGMVGSIQNYL 515
            L QIPTM+ALTFFGILHVPINVPALA+SL MDK+DVD+ELIAHGYSNF SG++GS+QNYL
Sbjct: 468  LQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYL 527

Query: 516  VYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFIPICIVGSLIFXXXXXXXXXX 575
            VYTNSVLFIRAGADS FAG++L  LT  VM+IGPVI+SFIPICIVGSLIF          
Sbjct: 528  VYTNSVLFIRAGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEA 587

Query: 576  XXDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIACFSFLVDSTKLQTINGEFDGK 635
              DT  K+  FEY+T+VIIV TMG++DFVLG+IVGILIACFSFLVDSTKLQTINGE++G 
Sbjct: 588  LVDTWNKLNRFEYLTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGN 647

Query: 636  VARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIISIEEKIDKLLEITDSKSSSKRR 695
            VA+STV RDYVQ+ FL+G+GEQIYVLKLQNVLFFGTIISIEEKI+KLL+I++ K + KRR
Sbjct: 648  VAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISIEEKIEKLLQISN-KDAKKRR 706

Query: 696  IKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISSIKERDHIYNVFSNVGLLD 755
            IKYLILDFKNINADNIDYSAAEGFNRIKRFT TKRIKLIISSIKERD IYN F+NVGLL+
Sbjct: 707  IKYLILDFKNINADNIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGLLN 766

Query: 756  DVELFNDLNGALEWCENEFLGEYKKLRDRAREKMQH--SYNVTSAIEAAAA-KKVPTDNN 812
            DVELF DLN ALEWCENEFL +YK+LR++A+++++     +V SAI AA   KK+    N
Sbjct: 767  DVELFADLNSALEWCENEFLFQYKQLREKAKKRLEERKQSSVASAIMAATQNKKIDGLGN 826

Query: 813  QISKKXXXXXXXXXXXXXPMNTPRNHQMLSVAQNMF-NDEEDVDALEDESCNDGQQPVLP 871
             +S               P NTPRN+QMLSVAQN+F NDE+ V   + E  ND  +P+LP
Sbjct: 827  GLSTG-ENRDHARNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKND--EPILP 883

Query: 872  LLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRLTTQSILLHNQDFFFVVESGL 931
            +LLFALK YR +I S    +RE+E + W+QL PYF +RRL +QS+LLH  + FF+VE+G+
Sbjct: 884  ILLFALKQYRPDIISEIQTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVETGM 943

Query: 932  LKIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEHKVTIVTETDTCLWLIDVDGLQKLR 991
            LK   +LPQG +YE  SN TC G I+        E K+TI TETD+ LW+ID   L+K++
Sbjct: 944  LKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLKKMK 1003

Query: 992  AENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024
             ENL LY E+ L+ + IK  RF++LLGYTLVSA
Sbjct: 1004 EENLALYVEVTLMVMCIKDTRFKELLGYTLVSA 1036

>Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1162 bits (3007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 599/1053 (56%), Positives = 737/1053 (69%), Gaps = 79/1053 (7%)

Query: 18   AISVSLGLNRQVHRNSDGEFTXXXXXXXXXXXXXXXDSSSIEIVSPPFYNSNNYAGRSYL 77
            AISVSLG+N+    N                       +S+  +SPP         RSY+
Sbjct: 17   AISVSLGINQDSSINK-------------------MHRASVSAMSPPL-------CRSYM 50

Query: 78   GGGFLSA-SPKMNLQQRNDDSSVLPI-DRSRSKSIHGSQIIHRQTAELSNNFSD------ 129
             G F    SP +N    +   S LP+ ++   K IHGS+ +HRQTA+LSN F        
Sbjct: 51   SGFFTGGNSPMIN----SMSDSKLPLSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEEN 106

Query: 130  -----------------DTTGM--------EEVRNRYDAM----------EDENSSLHHY 154
                             D   M        EE  + Y  +          +D N  L + 
Sbjct: 107  SPTIKDYMDIIDSGDRKDDQSMRTIEEDIDEEYSDEYSRLLLSPASSNINDDRNRGLQNG 166

Query: 155  MTHQDYQTLPGGTDEDWTNNNNSQTARASGSSIVQFGQDVLHYFPSAVXXXXXXXXXXXX 214
            +T +      GG     +++N     R        F    +HY P+AV            
Sbjct: 167  LTSELEDDYEGGYQSLRSSHNLRSRPRNFRRLCTSFPSKFIHYLPAAVLGLLLNILDALS 226

Query: 215  XXMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSGGLSSFTSGIGSEMIEVTPFFHTM 274
              MIIFPITEP+FSHLG TG+SMFYISTIISQ +YSGG SSF SGIGSEMIE+TPF+HTM
Sbjct: 227  YGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITPFYHTM 286

Query: 275  AFAIRDAIPGQDDDIITTTIFCYAISSVVTGITFYLLGKLRLGKIVGFFPRHILIGCIGG 334
            A A+++A+ G DD+IITTTIFCY ISS++TG  FY+LGKL+LGKIVGFFPRHILIGCIGG
Sbjct: 287  ALAVKEALAGDDDEIITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGG 346

Query: 335  VGYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILWKWLLPVVLTILLVNTQKCFQNSL 394
            VGYFL+ITG+ VTTR+AK EY+W F   LF + D L KWLLPV+LT++L+ TQ+ F+NSL
Sbjct: 347  VGYFLIITGIEVTTRVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSL 406

Query: 395  VLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRWFDHYKLFDWHKVHWNL 454
            VLPSFYI+TL+LFHF+VAI+P++SLD LR  GWIFP A S  +W+DHYKLF+ HKVHW+L
Sbjct: 407  VLPSFYILTLVLFHFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSL 466

Query: 455  VLAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAHGYSNFISGMVGSIQNY 514
            VL QIPTM+ALTFFGILHVPINVPALA+SL MDK+DVD+ELIAHGYSNF SG++GS+QNY
Sbjct: 467  VLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNY 526

Query: 515  LVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFIPICIVGSLIFXXXXXXXXX 574
            LVYTNSVLFIRAGADS FAG++L  LT  +M+IGPVI+SFIPICIVGSLIF         
Sbjct: 527  LVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVE 586

Query: 575  XXXDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIACFSFLVDSTKLQTINGEFDG 634
               DT  K+  FEY+T+VIIV TMGI+DFVLG+IVGILIACFSFLVDSTKLQTINGE++G
Sbjct: 587  ALIDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNG 646

Query: 635  KVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIISIEEKIDKLLEITDSKSSSKR 694
             VA+STV RDYVQ+ FL+G+GEQIYVLKLQN+LFFGTI+SIEEKI+KLL+I++ K ++KR
Sbjct: 647  NVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQISN-KDATKR 705

Query: 695  RIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISSIKERDHIYNVFSNVGLL 754
            RIKYLILDFKNINADNIDYSAAEGFNRIKRFT+TK+IKLIISSI+ERD IYN F+NVGLL
Sbjct: 706  RIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLL 765

Query: 755  DDVELFNDLNGALEWCENEFLGEYKKLRDRAREKMQHSY--NVTSAIEAAAAKKVPTDNN 812
            +DVELF DLN ALEWCENEFL +YK+LR +A+E+++     N+ SA+ AA   K      
Sbjct: 766  NDVELFADLNSALEWCENEFLFQYKQLRIKAKERLEERKQNNIVSAVMAATQNKNINALG 825

Query: 813  QISKKXXXXXXXXXXXXXPMNTPRNHQMLSVAQNMF-NDEEDVDALEDESCNDGQQPVLP 871
                K             P NTPRN+QMLSVAQN+F NDE+ V   + E  +D  +PVLP
Sbjct: 826  NGLNKGNNIDPVRNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKDD--EPVLP 883

Query: 872  LLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRLTTQSILLHNQDFFFVVESGL 931
            +LLFALK YR +I S    +RE+E + W+QL PYF +RRL +QS+LLH  + FF+VE+G+
Sbjct: 884  ILLFALKQYRPDIISEIQKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGM 943

Query: 932  LKIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEHKVTIVTETDTCLWLIDVDGLQKLR 991
            LK   +LPQG +YE  SN TC G I+        E K+TI TETD+ LW+ID   L+K++
Sbjct: 944  LKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDSSSLKKMK 1003

Query: 992  AENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024
             ENL LY E+ L+ + IK  RF++LLGYTLVSA
Sbjct: 1004 EENLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036

>Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W
            (REAL)
          Length = 1037

 Score = 1162 bits (3005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 611/1058 (57%), Positives = 747/1058 (70%), Gaps = 88/1058 (8%)

Query: 18   AISVSLGLNRQ------VHRNSDGEFTXXXXXXXXXXXXXXXDSSSIEIVSPPFYNSNNY 71
            AI+VSLG+N Q      +HR                        +S   +SPP       
Sbjct: 17   AITVSLGINYQDSSKNKIHR------------------------ASASTMSPPL------ 46

Query: 72   AGRSYLGGGFLSASPKMNLQQRNDDSSVLPI-DRSRSKSIHGSQIIHRQTAELSNNF--- 127
              RSY+ G F   S  MN    N     LP  ++   K IHGS+ +HRQTA+LSN F   
Sbjct: 47   -CRSYMSGFFTGGSSPMNY---NMSDPKLPFSNKQHPKVIHGSENLHRQTAQLSNEFCSS 102

Query: 128  -----------------SDDTTGMEEVRNRYDAMEDENSSLHHYM------------THQ 158
                             SDD    + +R   + +++E +  +  +             ++
Sbjct: 103  SVEENSPTIKDYMDIIDSDDRKDDQSMRTIEENIDEEYADEYSRLLLSPASSNVDDERNR 162

Query: 159  DYQTLPGGTDED-----WTNNNNSQTARASGSSIVQ----FGQDVLHYFPSAVXXXXXXX 209
              Q  P    ED     + + + S   R    S+ Q    F      Y P+AV       
Sbjct: 163  ALQGSPTSDLEDGHGGGYQSVHPSHDLRFGPRSVWQWFTSFPSKFAQYLPAAVLGLLLNI 222

Query: 210  XXXXXXXMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSGGLSSFTSGIGSEMIEVTP 269
                   MIIFPITEP+FSHLG TG+SMFYISTIISQ +YSGG SSF SG+GSEMIE+TP
Sbjct: 223  LDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQSVYSGGWSSFPSGVGSEMIEITP 282

Query: 270  FFHTMAFAIRDAIPGQDDDIITTTIFCYAISSVVTGITFYLLGKLRLGKIVGFFPRHILI 329
            F+HTMA  I++A+ G DD+IITTTIFCY ISS++TG+ FY+LGKLRLGKIVGFFPRHILI
Sbjct: 283  FYHTMALGIKEALVGSDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILI 342

Query: 330  GCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILWKWLLPVVLTILLVNTQKC 389
            GCIGGVGYFL+ITG+ VTTR+AK EY+W F+  LF + D L KWLLPV+LT++L+ TQ+C
Sbjct: 343  GCIGGVGYFLIITGIEVTTRVAKFEYSWPFVSGLFTNYDTLAKWLLPVLLTVVLIGTQRC 402

Query: 390  FQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRWFDHYKLFDWHK 449
            F+NSLVLP+FYI+TL+LFHF+VAI+P++SLD LRD GWIFP A+S  +W+DHYKLF+ HK
Sbjct: 403  FKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHK 462

Query: 450  VHWNLVLAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAHGYSNFISGMVG 509
            VHW LVL QIPTM+ALTFFGILHVPINVPALA+SL MDK+DVDKELIAHGYSNF SG++G
Sbjct: 463  VHWTLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLG 522

Query: 510  SIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFIPICIVGSLIFXXXX 569
            S+QNYLVYTNSVLFIRAGADS FAG++L  LT  +MVIGPVI+SFIPICIVGSLIF    
Sbjct: 523  SVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGY 582

Query: 570  XXXXXXXXDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIACFSFLVDSTKLQTIN 629
                    DT  K+  FEY+T+VIIV TMGI+DFVLG+IVGILIACFSFLVDSTKLQT+N
Sbjct: 583  ELLVEALVDTWSKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTVN 642

Query: 630  GEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIISIEEKIDKLLEITDSK 689
            GE++G VA+STV RDYVQ+ FL+G+GEQIYVLKLQNVLFFGTIISIEEKI++LLEI++ K
Sbjct: 643  GEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISIEEKIERLLEISN-K 701

Query: 690  SSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISSIKERDHIYNVFS 749
             S+KRRIKYLILDFKNINADNIDYSAAEGFNRIKRFT+TKRIKLIISSIKERDHIYN F+
Sbjct: 702  DSTKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDHIYNAFN 761

Query: 750  NVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRAREKMQHSY--NVTSAIEAAAAKKV 807
            NVGLL+DVELF DLNGALEWCENEFL +YK+LR++A+++++     NV SAI AA   K 
Sbjct: 762  NVGLLNDVELFADLNGALEWCENEFLFQYKQLREKAKKRLEERKQNNVVSAIMAATQNKK 821

Query: 808  PTDNNQISKKXXXXXXXXXXXXXPMNTPRNHQMLSVAQNMF-NDEEDVDALEDESCNDGQ 866
               +     K             P NTPRNHQMLSVAQN+F NDE+ V  L+ E   D  
Sbjct: 822  IDRSGIDLNKGGNRDQARHLMSLPTNTPRNHQMLSVAQNVFANDEQAVKNLKKEYKED-- 879

Query: 867  QPVLPLLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRLTTQSILLHNQDFFFV 926
            +PVLP+LLFALK YR +I S    +RE+E + W+QL PYF +RRL +QS+LLH  + FF+
Sbjct: 880  EPVLPILLFALKQYRPDIVSEVQKVREKEIKFWAQLCPYFSRRRLASQSLLLHADNVFFL 939

Query: 927  VESGLLKIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEHKVTIVTETDTCLWLIDVDG 986
            +E+G+LK   +LPQG +YE MSN TC G I+        E K+TI TETD+ LW+ID   
Sbjct: 940  IETGMLKAVYELPQGSLYEIMSNGTCFGKIIAPGNTMPREQKLTIETETDSILWVIDSSS 999

Query: 987  LQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024
            L+K++ ENL LY E+ L+ + IK  RF++LLGYTLVSA
Sbjct: 1000 LKKMKEENLALYVEVTLMIMCIKDTRFKELLGYTLVSA 1037

>TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3.485
            YGR125W
          Length = 1031

 Score = 1160 bits (3002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/1057 (59%), Positives = 755/1057 (71%), Gaps = 78/1057 (7%)

Query: 9    SRNRQSISGAISVSLGL-NRQVHRNS-DGEFTXXXXXXXXXXXXXXXDSSSIEIVSPPFY 66
            +R R SIS AISVSLGL N    R+  DG  +               DS + + +SP   
Sbjct: 12   NRGRHSISEAISVSLGLQNTNTPRDHHDGNHSNPY------------DSQNDQFMSP--- 56

Query: 67   NSNNYAGRSYLGGGFLSASPKMNLQQRNDDSSVLPIDRSRSKSIHGSQIIHRQTAELS-- 124
              NNY GRSY+ G FLS SP       + +S  LPI R R+KSIH ++ +HRQTA+L   
Sbjct: 57   -RNNYLGRSYVSG-FLSCSP---YGSNSLESDRLPIARMRTKSIHAAKNLHRQTAKLCED 111

Query: 125  --------NNFSDDTTGMEEVR-------NRYDAMEDENSSLHHYMT------------- 156
                    NN  D  +  EE R        R    EDE  +  H  T             
Sbjct: 112  FNEPNVEDNNIQDYVSATEEPRPMEISDAERMYDQEDELRNPVHVNTEDRGDDIEDVYES 171

Query: 157  -----HQDYQTLPGGTDEDWTNNNNSQTARASGSSIVQFGQDVLHYFPSAVXXXXXXXXX 211
                 H  Y+ +P         ++ S   R   SS       ++HY P+ +         
Sbjct: 172  LVTGAHGGYRAIPTSPGGGLRTSSRSALWRQFMSS----SSKLVHYLPATILGLLLNVLD 227

Query: 212  XXXXXMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSGGLSSFTSGIGSEMIEVTPFF 271
                 MIIFPITEPIFSHLG +GLSMFY+STIISQ +YS G S+F +G+GSEMIEVTPFF
Sbjct: 228  GLSYGMIIFPITEPIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEVTPFF 287

Query: 272  HTMAFAIRDAIPGQDDDIITTTIFCYAISSVVTGITFYLLGKLRLGKIVGFFPRHILIGC 331
            H+MA AI+DA+PG+DD+I+TTTIFCY ISS+VTG+TFY+LGK++LGKIVGFFPRHILIGC
Sbjct: 288  HSMALAIKDALPGRDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGC 347

Query: 332  IGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILWKWLLPVVLTILLVNTQKCFQ 391
            IGGVGYFL++TGL VTTR+AK+EYTW F+  +F D   L KW+LPV+LT+LL+ TQ+ FQ
Sbjct: 348  IGGVGYFLVVTGLEVTTRVAKLEYTWPFISHMFTDVSTLVKWVLPVLLTVLLIVTQRHFQ 407

Query: 392  NSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRWFDHYKLFDWHKVH 451
            NSLVLP+FYI TL+ FHFVVAI+P++SL +LR++GWIFP A SKD+W+DHYKLF  H+VH
Sbjct: 408  NSLVLPTFYIATLVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQPHRVH 467

Query: 452  WNLVLAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAHGYSNFISGMVGSI 511
            W L+  Q PTMLAL+FFGILHVPINVPALAISL MDK+DVDKELIAHGYSN +SG +GSI
Sbjct: 468  WGLIAKQAPTMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGALGSI 527

Query: 512  QNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFIPICIVGSLIFXXXXXX 571
            QNYLVYTNS+LFIRAGADS  AGY+LA LTF +MVIGPVI+S+IPICIVGSLIF      
Sbjct: 528  QNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLGYEL 587

Query: 572  XXXXXXDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIACFSFLVDSTKLQTINGE 631
                  +TRGKVTNFEYITI IIVLTMGI+DFVLGVIVGILIACFSFLVDSTKLQTINGE
Sbjct: 588  LYEALIETRGKVTNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQTINGE 647

Query: 632  FDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIISIEEKIDKLLEITDSKSS 691
            +DGK+A+STV RDYVQS FL+G+GEQIYVLKLQ++LFFGTIISIEEKI+KLLEI+D + +
Sbjct: 648  YDGKIAKSTVYRDYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKN 707

Query: 692  SKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISSIKERDHIYNVFSNV 751
            SKRRIK LILD KNINADNIDYSAAEGFNRIKRFTQ+K I+LIISSI E DHIY  FS V
Sbjct: 708  SKRRIKCLILDLKNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKV 767

Query: 752  GLLDDVELFNDLNGALEWCENEFLGEYKKLRDRAREKMQHSY---NVTSAIEAAAAKKVP 808
             LLDDVELF DLNGALEWCENE L +YK+LR +AR+++Q+     N+ +  +  A   VP
Sbjct: 768  KLLDDVELFGDLNGALEWCENELLFKYKELRAKARDRLQNKMQMANLAANNDTKAIDGVP 827

Query: 809  TDNNQISKKXXXXXXXXXXXXXPMNTPRNHQMLSVAQNMF-NDEEDVDALEDESCNDGQQ 867
              ++                  P NTPRN QMLSVAQ +F N+++ VD+L+         
Sbjct: 828  KSHHM-----------QNLMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLKVNY--KELP 874

Query: 868  PVLPLLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRLTTQSILLHNQDFFFVV 927
            PVLPLLLFALK YR  I S D +++  E +LWS+L PYF +RRL +QSILLHN D FFV+
Sbjct: 875  PVLPLLLFALKPYRPGILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFVM 934

Query: 928  ESGLLKIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEHKVTIVTETDTCLWLIDVDGL 987
            E+G+LKI  DLPQG+VYE++SNRTC G ++    +   E KVTI TET+  LW+ID   L
Sbjct: 935  ETGILKIVYDLPQGIVYESLSNRTCYGIVLNPGTRPCSESKVTIKTETEVVLWVIDSSIL 994

Query: 988  QKLRAENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024
             +L+ ENL LYTEL+LL   +K +R+ Q+LGYTLVSA
Sbjct: 995  ARLKQENLSLYTELILLIATVKEQRYRQILGYTLVSA 1031

>NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1054

 Score = 1159 bits (2999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/1086 (57%), Positives = 757/1086 (69%), Gaps = 102/1086 (9%)

Query: 7    RPSRNRQSISGAISVSLGLNRQVHRNSDGEFTXXXXXXXXXXXXXXXDSSSIEIVSPPFY 66
            R   NR SIS  ISVSLGL     +N D +                 D+S          
Sbjct: 3    RQKNNRHSISDTISVSLGL-----QNQDPQILQQPNGGPTVTLGNMSDTS---------- 47

Query: 67   NSNNYAGRSYLGGGFLSASPKMNLQQRNDDSSVLPI-DRSRSKSIHGSQIIHRQTAELSN 125
               NY GRSY+ G FLSASP +N    +++++ LPI ++  +KSIH SQ +HRQTA +S 
Sbjct: 48   ---NYLGRSYVSG-FLSASPAIN---HDNNNNTLPIANQHLNKSIHASQNLHRQTAAISE 100

Query: 126  NFSDDTTGMEEVR-----------------NRYDAM------------------------ 144
            +F++D T  +++                   RY A                         
Sbjct: 101  DFNNDPTFEDDINMKEYISNLEDDATGNNGKRYTAYYIDNEDRIDNILTEEAEPVTDFYP 160

Query: 145  EDENSSLHHYMTHQDY-----QTLPGGTDEDWTNNNNSQTA-----RASGSSIVQFGQ-- 192
            +DENS L       D        LP  ++++       +T+     R   S   ++    
Sbjct: 161  QDENSRLLLSPIPSDSLLAGENLLPSISEQEQETAQRRRTSAYQSIRHRNSESTEYSSIP 220

Query: 193  ----------DVLHYFPSAVXXXXXXXXXXXXXXMIIFPITEPIFSHLGSTGLSMFYIST 242
                      +++ Y P+++              MIIFPITEPIFSHLG TG+SMFYIST
Sbjct: 221  TWRKYIATPSEIIQYLPASILGLLLTILDALSYGMIIFPITEPIFSHLGPTGISMFYIST 280

Query: 243  IISQCLYSGGLSSFTSGIGSEMIEVTPFFHTMAFAIRDAIP-GQDDDIITTTIFCYAISS 301
            IISQ ++SGG SSF  GIGSEMIEVTPFFHTMAFAI+DA+P G +DDIITTT+FCY ISS
Sbjct: 281  IISQSIFSGGWSSFPCGIGSEMIEVTPFFHTMAFAIKDALPEGSNDDIITTTLFCYVISS 340

Query: 302  VVTGITFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLK 361
            ++TG+TFY LGKL LGKIVGFFPRHILIGCIGGVGYFL+ITG+ V+TR+AK +YT  F+ 
Sbjct: 341  MLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRVAKFQYTIPFIT 400

Query: 362  KLFLDTDILWKWLLPVVLTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQ 421
             LF D   LW+WLLP +LT++L+  QKC QNSLVLPSFYI+TLILFHF+VAI+PS+SL+Q
Sbjct: 401  HLFTDVVTLWQWLLPTLLTVILIIAQKCAQNSLVLPSFYILTLILFHFMVAIIPSLSLNQ 460

Query: 422  LRDLGWIFPAATSKDRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALA 481
            LRD GWIFP A +  +W+DHYKLF+ HKVHW L+L QIPTMLALTFFGILHVPINVPALA
Sbjct: 461  LRDSGWIFPQAATDSKWYDHYKLFNLHKVHWTLILKQIPTMLALTFFGILHVPINVPALA 520

Query: 482  ISLHMDKFDVDKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILT 541
            +SL MD++DVDKELIAHG SNF+SGM GSIQNYLVYTNSVLFIRAGADS  AG++L +LT
Sbjct: 521  MSLQMDRYDVDKELIAHGVSNFVSGMFGSIQNYLVYTNSVLFIRAGADSALAGHILIVLT 580

Query: 542  FAVMVIGPVIVSFIPICIVGSLIFXXXXXXXXXXXXDTRGKVTNFEYITIVIIVLTMGIY 601
              +M+IGPVI+SFIPICIVGSLIF            D  GK++ FEYITIVIIV TMGI+
Sbjct: 581  IIIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDPLGKISKFEYITIVIIVFTMGIF 640

Query: 602  DFVLGVIVGILIACFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVL 661
            DFVLGVIVGILIACFSFL+DSTKLQTINGEFDG VA+STV RD +Q+ FLNG+GEQIYVL
Sbjct: 641  DFVLGVIVGILIACFSFLIDSTKLQTINGEFDGTVAKSTVYRDLIQTKFLNGIGEQIYVL 700

Query: 662  KLQNVLFFGTIISIEEKIDKLLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNR 721
            KLQN+LFFGTIISIEEKIDKLLEI+D   SSK RIKYLILDFKNINADNIDYSAAEGFNR
Sbjct: 701  KLQNLLFFGTIISIEEKIDKLLEISD-MDSSKHRIKYLILDFKNINADNIDYSAAEGFNR 759

Query: 722  IKRFTQTKRIKLIISSIKERDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKL 781
            IKRFTQTKRI+LIISSI+ERDHIYN F+NVGLL+ VELFNDLN ALEWCENEFL +YK L
Sbjct: 760  IKRFTQTKRIRLIISSIRERDHIYNAFNNVGLLEGVELFNDLNSALEWCENEFLFKYKTL 819

Query: 782  RDRAREKMQHSYNVTSAIEAAAAKKVPTDNNQISKKXXXXXXXXXXXXXPMNTPRNHQML 841
            R++ R+K ++  ++  AI         T+ N   ++             PMNTPRN+QML
Sbjct: 820  REKTRQKRKNKIDINLAI---------TNGNPTEERNMHLEIPRNIMSLPMNTPRNNQML 870

Query: 842  SVAQNMF-NDEEDVDALEDESCNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLWS 900
            SVAQN+F N+E+   AL+ +  N+    VLPLLLF LK YR  I S D  + E+E + WS
Sbjct: 871  SVAQNVFRNEEQAAKALKQQFKNEPS--VLPLLLFVLKQYRPRIVSNDKSIEEKEIKFWS 928

Query: 901  QLVPYFVKRRLTTQSILLHNQDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGSD 960
            QL PY  +R L  QS L HN +FFF+VESG+LK    LP G +YETMSNRTC G I+GS+
Sbjct: 929  QLCPYLSERFLVAQSTLKHNNNFFFIVESGILKATFTLPSGTLYETMSNRTCYGKILGSN 988

Query: 961  YKSS--EEHKVTIVTETDTCLWLIDVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLG 1018
             +++   E  +TI TETD  LW+ID+D L ++RAENL+LY ELVLL + I+  RF++LLG
Sbjct: 989  NETTVLNEQDLTIKTETDCNLWVIDMDALTRMRAENLELYIELVLLIMSIRDTRFKELLG 1048

Query: 1019 YTLVSA 1024
            YTLVSA
Sbjct: 1049 YTLVSA 1054

>NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1052

 Score = 1156 bits (2990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 628/1084 (57%), Positives = 747/1084 (68%), Gaps = 98/1084 (9%)

Query: 3    NGVDRPSRNRQ-SISGAISVSLGLNRQVHRNSDGEFTXXXXXXXXXXXXXXXDSSSIEIV 61
            N +D   +N+Q SISG+ISVSLGL ++     D                   D  ++   
Sbjct: 5    NSIDFKKKNKQQSISGSISVSLGLQQEEEPRDD-----------------YFDDENV--- 44

Query: 62   SPPFYNSNNYAGRSYLGGGFLSASPKMNLQQRNDDSSVLPI-----DRSRSKSIHGSQII 116
                 N+NNY GRSY+ G FLS SP +    + D+ S LP+      R  ++ IH S+ +
Sbjct: 45   -----NNNNYMGRSYVSG-FLSVSPALMGSMKQDEES-LPMAYNGGQRLFNRPIHASEKL 97

Query: 117  HRQTAELS---------NNFSDDTTGMEEVRNRYDAMEDENSSLHHYM-------THQDY 160
            H+QTA +S             D  T  +   N    M D+N SL   +         +D+
Sbjct: 98   HKQTAAISEDFEDDEDDTRIKDYITLFQGEDN--GLMADKNDSLDQRLGLGQDEEAEEDF 155

Query: 161  ------------------------------QTLPGGTDEDWTNNNN---------SQTAR 181
                                            LP  T ED ++  +         S+ + 
Sbjct: 156  IEPVAEAADVDESSRLLISPLSSNINPNIDDLLPTVTGEDVSSYQSIYRTATPSLSRNSE 215

Query: 182  ASGSSIVQFGQDVLHYFPSAVXXXXXXXXXXXXXXMIIFPITEPIFSHLGSTGLSMFYIS 241
                +I  F    +HY P+AV              MIIFPITEPIFSHLG TGLSMFYIS
Sbjct: 216  TIWQNIADFPYQFIHYLPAAVLGLLLNILDALSYGMIIFPITEPIFSHLGPTGLSMFYIS 275

Query: 242  TIISQCLYSGGLSSFTSGIGSEMIEVTPFFHTMAFAIRDAIPGQDDDIITTTIFCYAISS 301
            TIISQ +YS G SSF SGIGSEMIEVTPFFHTMA AI++ +PG+DD+IITTTIFCY ISS
Sbjct: 276  TIISQTIYSSGWSSFPSGIGSEMIEVTPFFHTMALAIKETLPGRDDEIITTTIFCYVISS 335

Query: 302  VVTGITFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLK 361
            ++TG+TFY LGKL LGKIVGFFPRHILIGCIGGVGYFLL+TG+ VTTR+AK EY+  FL 
Sbjct: 336  MLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTRVAKFEYSIPFLA 395

Query: 362  KLFLDTDILWKWLLPVVLTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQ 421
             LF D   LWKWLLPV+LT++L+ TQ+CF+NSLVLPSFYI+TLILFHF+VAI+PS++L+Q
Sbjct: 396  SLFSDWATLWKWLLPVLLTVILIVTQRCFKNSLVLPSFYILTLILFHFIVAIIPSLTLNQ 455

Query: 422  LRDLGWIFPAATSKDRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALA 481
            LRD GWIFP A S  +W+DHYKLFD+ KVHW LV  QIPTMLALTFFGILHVPINVPALA
Sbjct: 456  LRDSGWIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFGILHVPINVPALA 515

Query: 482  ISLHMDKFDVDKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILT 541
            +SLH+DK+DVDKELIAHG SNFISG VGSIQNYLVYTNSVLFIRAGADS  AGY+L ILT
Sbjct: 516  MSLHLDKYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILT 575

Query: 542  FAVMVIGPVIVSFIPICIVGSLIFXXXXXXXXXXXXDTRGKVTNFEYITIVIIVLTMGIY 601
              VM IGPVI+SFIPICIVGSLIF            D  GK++NFEYITIVIIVLTMGI+
Sbjct: 576  AIVMFIGPVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGIF 635

Query: 602  DFVLGVIVGILIACFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVL 661
            DFVLG+IVGILIACFSFL+DSTKLQTINGE+DG VA+STV RD +Q+ FLNG+GEQIYVL
Sbjct: 636  DFVLGIIVGILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTKFLNGIGEQIYVL 695

Query: 662  KLQNVLFFGTIISIEEKIDKLLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNR 721
            KLQN+LFFGTIISIEEKID+LLEI   K SS+ RIKYLILDFKNINADNIDYSAAEGFNR
Sbjct: 696  KLQNLLFFGTIISIEEKIDELLEIC-HKDSSRLRIKYLILDFKNINADNIDYSAAEGFNR 754

Query: 722  IKRFTQTKRIKLIISSIKERDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKL 781
            IKRFTQTK+I+L+ISSIKERDHIY  F NVGLL  VELFNDLN ALEWCENEFL +YK+L
Sbjct: 755  IKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWCENEFLFKYKQL 814

Query: 782  RDRAREKMQHSYNVTSAIEAAAAKKVPTDNNQISKKXXXXXXXXXXXXXPMNTPRNHQML 841
            RD+A+ ++     +       + K   T  N    K             P+NTPRNHQ+L
Sbjct: 815  RDKAKSRLHRKQIIDINASIGSQKYQFTAGND---KKSNLDIPRNLMSLPINTPRNHQIL 871

Query: 842  SVAQNMF-NDEEDVDALEDESCNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLWS 900
            SVAQN+F N+E+ V  L+ E  +  Q P LPLLLF LK YR  I STD  ++E E + WS
Sbjct: 872  SVAQNVFQNEEQTVKNLKTELKD--QAPFLPLLLFTLKQYRPGIISTDKTVKENEIKFWS 929

Query: 901  QLVPYFVKRRLTTQSILLHNQDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGSD 960
            QL PYFVK  L +QS L+HN + FF+VE+G+LK   +LPQG +YETMSNRTC G I G  
Sbjct: 930  QLCPYFVKLPLASQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTCYGKITG-Q 988

Query: 961  YKSSEEHKVTIVTETDTCLWLIDVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYT 1020
            +  S    +TI  E D+ LW+ID   L K+RAEN +L+TEL LL + +K  RF++LLGYT
Sbjct: 989  HNESTLKTLTIRAEIDSILWVIDSGSLIKMRAENAELFTELTLLIMAVKDNRFKELLGYT 1048

Query: 1021 LVSA 1024
            LVSA
Sbjct: 1049 LVSA 1052

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
            protein of unknown function; deletion mutant has
            decreased rapamycin resistance but normal wormannin
            resistance; green fluorescent protein (GFP)-fusion
            protein localizes to the vacuole
          Length = 1036

 Score = 1149 bits (2972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/1054 (57%), Positives = 738/1054 (70%), Gaps = 81/1054 (7%)

Query: 18   AISVSLGLNRQVHRNSDGEFTXXXXXXXXXXXXXXXDSSSIEIVSPPFYNSNNYAGRSYL 77
            AISVSLG+N+    N                       +S+  +SPP         RSY+
Sbjct: 17   AISVSLGINQDSSVNK-------------------MHRASVSAMSPPL-------CRSYM 50

Query: 78   GGGFLSA-SPKMNLQQRNDDSSVLPI-DRSRSKSIHGSQIIHRQTAELSNNFSD------ 129
             G F    SP +N    N   S LPI ++   K IHGS+ +HRQTA+LSN F        
Sbjct: 51   SGFFTGGNSPMIN----NLSDSKLPISNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEEN 106

Query: 130  -----------------DTTGM--------EEVRNRYDAM----------EDENSSLHHY 154
                             D   M        EE  + Y  +          +D N  L + 
Sbjct: 107  SPTIKDYMDIIGNGDRKDDQSMRTIEENIDEEYSDEYSRLLLSPASSNVDDDRNRGLQNS 166

Query: 155  MTHQDYQTLPGGTDEDWTNNNNSQTARASGSSIVQFGQDVLHYFPSAVXXXXXXXXXXXX 214
               +      GG      ++N     R        F     HY P+AV            
Sbjct: 167  SLPELEDGYAGGYQSLRPSHNLRFRPRNLWHMCTSFPSKFAHYLPAAVLGLLLNILDALS 226

Query: 215  XXMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSGGLSSFTSGIGSEMIEVTPFFHTM 274
              MIIFPITEP+FSHLG TG+SMFYISTIISQ +YSGG SSF SGIGSEMIE+TPF+HTM
Sbjct: 227  YGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTM 286

Query: 275  AFAIRDAIPGQDDDIITTTIFCYAISSVVTGITFYLLGKLRLGKIVGFFPRHILIGCIGG 334
            A AI++A+ G DD+IITTTIFCY ISS++TG+ FY LGKLRLGKIVGFFPRHILIGCIGG
Sbjct: 287  ALAIKEALAGNDDEIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGG 346

Query: 335  VGYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILWKWLLPVVLTILLVNTQKCFQNSL 394
            VGYFL+ITG+ VTTR+AK EY+W F   LF D D L KWLLPV+LT++L+ TQ+ F+NSL
Sbjct: 347  VGYFLIITGIEVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSL 406

Query: 395  VLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRWFDHYKLFDWHKVHWNL 454
            VLPSFYI+TL+LFHF+VAI+P++SLD LR  GWIFP A S  +W+DHY+LF+ HKVHW+L
Sbjct: 407  VLPSFYILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSL 466

Query: 455  VLAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAHGYSNFISGMVGSIQNY 514
            VL QIPTM+ALTFFGILHVPINVPALA+SL MDK+DVD+ELIAHGYSNF SG++GS+QNY
Sbjct: 467  VLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNY 526

Query: 515  LVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFIPICIVGSLIFXXXXXXXXX 574
            LVYTNSVLFIRAGADSPFAG++L  LT  +M+IGPVI+SFIPICIVGSLIF         
Sbjct: 527  LVYTNSVLFIRAGADSPFAGFLLIALTICIMIIGPVIISFIPICIVGSLIFLLGYELLVE 586

Query: 575  XXXDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIACFSFLVDSTKLQTINGEFDG 634
               DT  K+  FEY+T+VIIV TMGI+DFVLG+IVGILIACFSFLVDSTKLQTINGE++G
Sbjct: 587  ALVDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNG 646

Query: 635  KVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIISIEEKIDKLLEITDSKSSSKR 694
             VARSTV RDYVQ+ FL+G+GEQIYVLKLQN+LFFGTIISIEEKI++LL+I++ K ++KR
Sbjct: 647  NVARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQISN-KDATKR 705

Query: 695  RIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISSIKERDHIYNVFSNVGLL 754
            RIKYLILDFKNINADNIDYSAAEGFNRIKRFT+TKRIKLIISSIKERD IYN F+NVGLL
Sbjct: 706  RIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLL 765

Query: 755  DDVELFNDLNGALEWCENEFLGEYKKLRDRAREKMQHSY--NVTSAIEAAAA-KKVPTDN 811
            +DVELF DLN ALEWCENEFL +YK+LR +A+E+++     NV SA+ AA   KK+ T  
Sbjct: 766  NDVELFADLNSALEWCENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKNKKIDTIG 825

Query: 812  NQISKKXXXXXXXXXXXXXPMNTPRNHQMLSVAQNMF-NDEEDVDALEDESCNDGQQPVL 870
            N +++              P NTPRN+Q+LSVAQN+F NDE+ V   + E  +D  +PVL
Sbjct: 826  NGLNRG-SNGDTARNLMSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDD--EPVL 882

Query: 871  PLLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRLTTQSILLHNQDFFFVVESG 930
            P+LLFALK YR +I S    +RE+E + W+QL PYF +RRL +QS LLH  + FF+VE+G
Sbjct: 883  PILLFALKQYRPDIISEVQKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLVETG 942

Query: 931  LLKIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEHKVTIVTETDTCLWLIDVDGLQKL 990
            +LK   +LPQG +YE  SN TC G I+        E K+TI TETD+ LW+ID   L KL
Sbjct: 943  MLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLNKL 1002

Query: 991  RAENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024
            + +NL LY E+ L+ + IK  RF++LLGYTLVSA
Sbjct: 1003 KEDNLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036

>CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa]
            {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125w
          Length = 1070

 Score = 1107 bits (2862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/1032 (56%), Positives = 709/1032 (68%), Gaps = 85/1032 (8%)

Query: 61   VSPPFYNSNNYAGRSYLGGGFLSASPKMNLQQRNDDSSVLPI-DRSRSKSIHGSQIIHRQ 119
            V  P  ++N + GRSY+ G   S+ P+        + + LP+ ++  S++IH    +HRQ
Sbjct: 56   VGIPNNDTNTFLGRSYVSGILGSSLPQ------GGERNTLPVSNKFGSRAIHEQNKLHRQ 109

Query: 120  TAELSNNFSDDTTG----------------MEE---VRNRYDAMED-------------- 146
            TA ++  F D T G                 EE   +RNR D   D              
Sbjct: 110  TAAIAEEFDDGTIGESPSSLKEYLNLLDEAQEEELDLRNRRDLDNDLITDNKTPVSINLK 169

Query: 147  -------------------------------EN--SSLHHYMTHQDYQTLPGGTDEDWTN 173
                                           EN  S+  +Y     YQ++       +  
Sbjct: 170  RATDPELEQQTVALLTPSSSNNDNYGSVSPEENFLSATSNYEQESTYQSITVVPSAGFRQ 229

Query: 174  NNNSQTARASGSSIVQFGQDVLHYFPSAVXXXXXXXXXXXXXXMIIFPITEPIFSHLGST 233
               S TA+A  +      + V +Y P+A+              MIIFPITEPIF+ LG T
Sbjct: 230  MPTSTTAKAWMTL-----KRVTNYMPAAILGLLLNILDALSYGMIIFPITEPIFAQLGPT 284

Query: 234  GLSMFYISTIISQCLYSGGLSSFTSGIGSEMIEVTPFFHTMAFAIRDAIPGQDDDIITTT 293
            G+SMFYISTIISQ +YS G SSF SGIGSEMIE+TPF+HTMA AI  A+PG+DD+IITTT
Sbjct: 285  GISMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALPGRDDEIITTT 344

Query: 294  IFCYAISSVVTGITFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKI 353
            IFCY ISSV+TG+TFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFL+ITGL VTTR+AK 
Sbjct: 345  IFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAKF 404

Query: 354  EYTWEFLKKLFLDTDILWKWLLPVVLTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAI 413
            EY+  FL KLFLD+ +L+KWLLP +LTI+L+ TQKCF+NSLVLPSFYI+TLILFHFVVAI
Sbjct: 405  EYSIPFLTKLFLDSSMLFKWLLPTILTIILIVTQKCFKNSLVLPSFYIITLILFHFVVAI 464

Query: 414  VPSISLDQLRDLGWIFPAATSKDRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHV 473
             P++SL QLR  GWIFPA     +W+DHY+ FD  K HW+LV+ QIPTMLALTFFGILHV
Sbjct: 465  APNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTMLALTFFGILHV 524

Query: 474  PINVPALAISLHMDKFDVDKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFA 533
            PINVPALA+SL MDK+DVDKELIAHGYSNF SG+ GS+QNYLVYTNSVLFIRAGADS  A
Sbjct: 525  PINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIA 584

Query: 534  GYMLAILTFAVMVIGPVIVSFIPICIVGSLIFXXXXXXXXXXXXDTRGKVTNFEYITIVI 593
            GY+L +LT  VMVIGPVI+SFIPICIVGSLIF            D  GKVT FEY TI I
Sbjct: 585  GYVLIVLTIMVMVIGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGI 644

Query: 594  IVLTMGIYDFVLGVIVGILIACFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNG 653
            IVLTMGI+DFVLG++VGILIACFSFLVDSTKLQT+NGEFDG VA+STV RD+ Q+ FL+ 
Sbjct: 645  IVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYRDFTQTRFLSQ 704

Query: 654  VGEQIYVLKLQNVLFFGTIISIEEKIDKLLEITDSKSSSKRRIKYLILDFKNINADNIDY 713
            +GEQIYVLKLQN+LFFGTIISIEEKI++LLEI+D+   SK RIK+LILDFKNINADNIDY
Sbjct: 705  IGEQIYVLKLQNILFFGTIISIEEKIERLLEISDN-DVSKHRIKFLILDFKNINADNIDY 763

Query: 714  SAAEGFNRIKRFTQTKRIKLIISSIKERDHIYNVFSNVGLLDDVELFNDLNGALEWCENE 773
            SAAEGFNRIKR+T+ KRIKLIIS+I+E D IY+VF+ VGLL D+ELFNDLN ALEWCENE
Sbjct: 764  SAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLNSALEWCENE 823

Query: 774  FLGEYKKLRDRAREKMQ-HSYNVTSAIEAAAAKKVPTDNNQISKKXXXXXXXXXXXXXPM 832
            FL +YK+LR++AR K+Q  S N+ +AI     +   T+ NQ                   
Sbjct: 824  FLYQYKELREKARNKLQRRSKNINAAIGNQLRRYDQTNKNQGPTSSLMQNLMSLSN---- 879

Query: 833  NTPRNHQMLSVAQNMFNDEEDVDALEDESCNDGQQPVLPLLLFALKSYRKNITSTDPHLR 892
            NTPRN+Q++S AQ  F++E+ +   E ++      P+L +LLFALK YR NI S D   R
Sbjct: 880  NTPRNYQLVSAAQQAFSNEQQIST-EIDTKLKIPDPLLKVLLFALKLYRPNIVSMDTEKR 938

Query: 893  ERETQLWSQLVPYFVKRRLTTQSILLHNQDFFFVVESGLLKIALDLPQGVVYETMSNRTC 952
              E + W QL PYF ++  T  +  LHN +FFF+V++G+LK+  +LP G VYET+SN TC
Sbjct: 939  TDEVEFWKQLCPYFTRKVFTANTTFLHNNNFFFLVDAGILKVIYNLPAGSVYETLSNGTC 998

Query: 953  CGNIVGSDYKSSEEHKVTIVTETDTCLWLIDVDGLQKLRAENLQLYTELVLLCLLIKSRR 1012
             G I+      +    + +  ETDT LW+ID   ++ ++ +N+ LYTELVLL L I+  R
Sbjct: 999  YGKILSKRDNENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTELVLLILAIRDTR 1058

Query: 1013 FEQLLGYTLVSA 1024
            F++LLGYTLVSA
Sbjct: 1059 FKELLGYTLVSA 1070

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
            YGR125W
          Length = 1020

 Score = 1099 bits (2842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/1068 (55%), Positives = 733/1068 (68%), Gaps = 105/1068 (9%)

Query: 6    DRPSRNRQSISGAISVSLGLNRQVHR--NSDGEFTXXXXXXXXXXXXXXXDSSSIEIVSP 63
            D  +  R S+S +IS SLGL  Q      +D E +                         
Sbjct: 9    DARASKRLSLSDSISRSLGLQDQESNIAGTDNELSN------------------------ 44

Query: 64   PFYNSNNYAGRSYLGGGFLSASPKMNLQQRNDDSSVLPIDRS-RSKSIHGSQIIHRQTAE 122
               + +NY  RSY+ G   SA+P   L+     ++ LP+    R+KSIH S+I+H+QTA 
Sbjct: 45   ---SKSNYLSRSYMYGLLPSATPVEELE-----TNTLPLSNDLRNKSIHQSRILHKQTAA 96

Query: 123  LSNNFSDDTTG-----MEEVRNR---------------------YDAMEDENSSLHHYMT 156
            +  +F++   G     ++ + N                       D +E+++ S    +T
Sbjct: 97   ICEDFNESDEGSMKDYLDFIENTDRDNINEHKESLPVTVVLSTPADEVEEQDESSRLLLT 156

Query: 157  ----HQDYQTLPGGTDEDW-----TNNNNSQTARASGSSIVQ----FGQDVLHYFPSAVX 203
                + +  ++  G    +     T +NN        ++I +    F  + L YFP++V 
Sbjct: 157  PSSSNAEVSSIAEGLRHHYSSIESTKDNNMPIEEQQDNTINEKLSTFFYNTLQYFPASVL 216

Query: 204  XXXXXXXXXXXXXMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSGGLSSFTSGIGSE 263
                         MIIFPI+EPIFSHLG TG+SMFYISTII Q +YS G SSF S IGSE
Sbjct: 217  GLLLNILDALSYGMIIFPISEPIFSHLGPTGMSMFYISTIICQFIYSSGWSSFPSCIGSE 276

Query: 264  MIEVTPFFHTMAFAIRDAIPGQD--DDIITTTIFCYAISSVVTGITFYLLGKLRLGKIVG 321
            MIE+TPFFHTMAFAI  ++PG++  D IITTTIFCY ISS+ TG+TF  LGKLRLGKIVG
Sbjct: 277  MIEITPFFHTMAFAIMRSLPGEENQDAIITTTIFCYVISSMFTGLTFLTLGKLRLGKIVG 336

Query: 322  FFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILWKWLLPVVLTI 381
            FFPRHILIGCIGGVGYFLLITG+ VTTR+AK EY+   +K+LF DT +LWKWL P +LT+
Sbjct: 337  FFPRHILIGCIGGVGYFLLITGIEVTTRIAKFEYSLPLIKELFTDTSMLWKWLTPTLLTV 396

Query: 382  LLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRWFDH 441
            +L+ TQKCF+ SLVLPSFYI TLILFHF+VAI+P +SL QLR+ GWIF        W+DH
Sbjct: 397  VLILTQKCFKRSLVLPSFYIATLILFHFIVAIIPRLSLTQLREAGWIFSNTAPNSAWYDH 456

Query: 442  YKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAHGYS 501
            YKLFD+HKVHW LV  QIPTMLALTFFGILHVPINVPALA+S+ MDK+DVDKELIAHG S
Sbjct: 457  YKLFDFHKVHWLLVFKQIPTMLALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGLS 516

Query: 502  NFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFIPICIVG 561
            N +SGM GSIQNYLVYTNSVLFIRAGADSPFAGY+L  LT  VM+IGPVI+SFIPICIVG
Sbjct: 517  NLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVG 576

Query: 562  SLIFXXXXXXXXXXXXDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIACFSFLVD 621
            SLIF            DT  K+T FEY+T+V+IVLTMGI DFVLG+IVGILIACF FL+D
Sbjct: 577  SLIFLLGYELLVEALLDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLID 636

Query: 622  STKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIISIEEKIDK 681
            S+KLQTINGEF GKVA+STVNRD +QS FLNG+G+QIYVLKLQN+LFFGTIISIEEKIDK
Sbjct: 637  SSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQIYVLKLQNLLFFGTIISIEEKIDK 696

Query: 682  LLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISSIKER 741
            LLE++D ++SSKR+IKYLILDF+NINADNIDYSAAEGFNRIKR T++K I+LIISSIK R
Sbjct: 697  LLEMSD-RNSSKRQIKYLILDFRNINADNIDYSAAEGFNRIKRLTESKNIQLIISSIKVR 755

Query: 742  DHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRAREKMQHSYNVTSAIEA 801
            D IYN F+ VGLL  VELFNDLNGALEWCENEFL +YK +R+R + K     NV +A  +
Sbjct: 756  DRIYNSFNKVGLLVGVELFNDLNGALEWCENEFLYQYKMIRERIKIK-----NVKTATHS 810

Query: 802  AAAKKVPTDNNQISKKXXXXXXXXXXXXXPMNTPRNHQMLSVAQNMF-NDEEDVDALEDE 860
            +       D N +SK               +NTPRN+Q+ SVAQN+F N+E+ VD L++ 
Sbjct: 811  S-------DGN-LSKPSAMTLS--------INTPRNYQIYSVAQNIFKNEEQTVDRLKNR 854

Query: 861  SCNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRLTTQSILLHN 920
              +  Q PVLPLLLFALK YR +I S D   + +E + WSQL PYF K+R+ +QSIL H 
Sbjct: 855  FQD--QTPVLPLLLFALKQYRPDIVSVDKVKKGKEIEFWSQLAPYFSKKRIASQSILYHG 912

Query: 921  QDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVG----SDYKSSEEHKVTIVTETD 976
             + FF+VE G+LK+  DLPQG VYETMS R C G I+G    S+  +     + I TE D
Sbjct: 913  NNIFFLVEIGVLKVTFDLPQGKVYETMSKRACYGKIMGKIPVSEADAPSSQAMIIKTEAD 972

Query: 977  TCLWLIDVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024
            T +W+ID   L+K++ EN++LY ELVLL + IK  RF+ LLG+ LVS 
Sbjct: 973  TVIWIIDSSALKKMKDENIELYLELVLLVMTIKDIRFKSLLGHALVST 1020

>Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON}
            complement(36794..39967) [3174 nt, 1058 aa]
          Length = 1057

 Score = 1061 bits (2743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/1073 (53%), Positives = 732/1073 (68%), Gaps = 89/1073 (8%)

Query: 10   RNRQSISGAISVSLGLNRQVHRNSDGEFTXXXXXXXXXXXXXXXDSSSIEIVSPPFYNSN 69
            R R S S A+SVSLGL+ Q                           S++   S   YN N
Sbjct: 16   RVRPSFSEALSVSLGLHEQ-------------------GIGAGRTRSNLAPNSYSGYNDN 56

Query: 70   NYA----------GRSYLGGGFLSASPKMNLQQRNDDSSVLPIDRSRSKSIHGSQIIHRQ 119
              +          GRSY  G   S SP + L     D  +LPI +  SKSI G   +HRQ
Sbjct: 57   TTSSVSNREFGRIGRSY-AGSISSNSPSLYLNTSRTDE-LLPIRKMPSKSILGPDALHRQ 114

Query: 120  TAELSNNFSDDTTGMEEVR-NRYDAMEDENS--------------SLHHYMTHQDYQTLP 164
            TAE+SN+F+D  T M+E +  RY  + +                   H ++  + + +  
Sbjct: 115  TAEISNDFND--TSMDEAKIKRYIELLNRKQIEAEEEGEESAVHLRPHTFIEGKSFLSPI 172

Query: 165  GG-----------------------------TDEDWTNNNNS----QTARASGSSIVQFG 191
            G                              T ++  N+ NS    Q+   + SS    G
Sbjct: 173  GSSASQLDGLEQRALLTPSSSIVGNEFDLESTYDEINNDYNSILRIQSRELTSSSFATKG 232

Query: 192  QDVLHYFPSAVXXXXXXXXXXXXXXMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSG 251
             ++L+Y P+A+              MIIFPITEP+FS LG TG+SMFYISTI+ Q + SG
Sbjct: 233  LELLNYLPAAILGLLLNILDALSYGMIIFPITEPLFSGLGPTGISMFYISTIVCQLVLSG 292

Query: 252  GLSSFTSGIGSEMIEVTPFFHTMAFAIRDAIPGQDDDIITTTIFCYAISSVVTGITFYLL 311
            G SSF  GIGSEMIE+TPF+HTMAFAI+DA+P QD+++ITTTIFCY ISSVVTG+ F++L
Sbjct: 293  GFSSFPCGIGSEMIEITPFYHTMAFAIKDALPNQDNEVITTTIFCYVISSVVTGLVFFML 352

Query: 312  GKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILW 371
            GKL++GKIVGFFPRHILIGCIGGVGYFL+ITG+ V+TR+ K EY WEFL  L  + D L 
Sbjct: 353  GKLKMGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRIGKFEYNWEFLLSLLTNLDTLG 412

Query: 372  KWLLPVVLTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPA 431
            KWLLP +LT+ L+  Q+  QNSLVLPSFYI+T+ILFHF+VAI+P++SLD LR+ GWIFP 
Sbjct: 413  KWLLPTLLTLSLILIQRQVQNSLVLPSFYILTIILFHFIVAILPNLSLDHLRENGWIFPV 472

Query: 432  ATSKDRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLHMDKFDV 491
              SK+ W+DHYK F+ H +HW LVL QIPTMLALTFFGILHVPINVPALA+SLHMDK+DV
Sbjct: 473  TDSKNSWYDHYKYFNLHDIHWGLVLKQIPTMLALTFFGILHVPINVPALAMSLHMDKYDV 532

Query: 492  DKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVI 551
            D+ELIAHGYSN ISG++GS+QNYLVYTNSVLFIRAGADS  AG++L  LT  VMV G VI
Sbjct: 533  DRELIAHGYSNLISGLLGSVQNYLVYTNSVLFIRAGADSSSAGFLLVALTVVVMVAGSVI 592

Query: 552  VSFIPICIVGSLIFXXXXXXXXXXXXDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGI 611
            VSFIP+CIVGSLIF            DT G VT+FEYITI+IIV  MGIYDFVLG+IVGI
Sbjct: 593  VSFIPVCIVGSLIFLLGYELMVEALVDTIGTVTSFEYITILIIVFIMGIYDFVLGIIVGI 652

Query: 612  LIACFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGT 671
            LIAC SF+VD TKL+TINGE+DG+VA+STV RDY+Q+ FLNG+ +QIY+LKLQNVLFFGT
Sbjct: 653  LIACLSFMVDGTKLETINGEYDGQVAKSTVYRDYIQTKFLNGIRQQIYLLKLQNVLFFGT 712

Query: 672  IISIEEKIDKLLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRI 731
            IISIEEKIDKLLEI+D K  SKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQ KRI
Sbjct: 713  IISIEEKIDKLLEISD-KDPSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQGKRI 771

Query: 732  KLIISSIKERDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRAREKMQH 791
            +LIISSIKE+D IY+VF+ V LL+DVELF+DLN ALEWCENEFL +Y +L ++A++++  
Sbjct: 772  QLIISSIKEKDKIYSVFNMVRLLEDVELFDDLNSALEWCENEFLYQYMQLHEKAKDRIHK 831

Query: 792  SYNVTSAIEAAAAKKVPTDNNQISKKXXXXXXXXXXXXXPMNTPRNHQMLSVAQNMFNDE 851
              +++    +    +  +D+                   P+NTPRN+Q+LSVA+ +F +E
Sbjct: 832  RISISKDSGSTYFSRNRSDSG------LSAADQQMLMSLPINTPRNNQVLSVARKVFKNE 885

Query: 852  EDVDALEDESCNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRL 911
                A + ++ N+  +PVL LLL++++ +R ++ S D  +RE+E   W QL PYF +   
Sbjct: 886  AQT-ASKFKTHNETDKPVLSLLLYSIRLFRPDVFSEDVSIREKEINFWGQLSPYFRRSLF 944

Query: 912  TTQSILLHNQDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEHKVTI 971
             T S L+++ +FFFVVESG++++  DLPQG+V ETMSNRTC G +VG     +   K+  
Sbjct: 945  PTGSTLVNSSNFFFVVESGVVRVTHDLPQGIVSETMSNRTCYGKVVGHRGTVTNLPKIIF 1004

Query: 972  VTETDTCLWLIDVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024
             TET++ +W+ID D + +++ ENL LYTEL+LL + I+  R++ L+GYTLVSA
Sbjct: 1005 KTETESIIWMIDDDTMSRIKKENLNLYTELLLLVMTIREYRYKGLIGYTLVSA 1057

>SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1050

 Score = 1045 bits (2701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/830 (63%), Positives = 643/830 (77%), Gaps = 30/830 (3%)

Query: 195  LHYFPSAVXXXXXXXXXXXXXXMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSGGLS 254
            L+Y P+ +              MIIFPITEP+FSHLG TGLSMFY+STI+SQ +YS G S
Sbjct: 251  LNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYVSTILSQLVYSCGFS 310

Query: 255  SFTSGIGSEMIEVTPFFHTMAFAIRDAIPGQDDDIITTTIFCYAISSVVTGITFYLLGKL 314
            +F +GIGSEMIE+TPFFHTMA +I +++PG DD+II+TTI CYA+SS+ TG+ F+LLGKL
Sbjct: 311  AFGNGIGSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCYALSSIFTGLAFFLLGKL 370

Query: 315  RLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILWKWL 374
            RLGKIVGFFPRHILIGC+GGVGYFLLITG+ V TR++K EY+W FL++LF +T++L KW+
Sbjct: 371  RLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPFLRELFYNTEVLGKWM 430

Query: 375  LPVVLTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATS 434
            LP++LT+ L+ TQ  F NSLVLPSFYI+TL LFHFVVAIVP++SL+ LR+ GWIFP A S
Sbjct: 431  LPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSLNSLRESGWIFPMAGS 490

Query: 435  KDRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKE 494
             + W+D YKL+D+  VHW LVL Q+PTMLALTFFGILHVPINVPALA+S+ MDKFDVDKE
Sbjct: 491  SNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPALAMSIGMDKFDVDKE 550

Query: 495  LIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSF 554
            LIAHGYSN +SG  GSIQNYLVYTNS LFIRAG+DS +AG++LA+ TF VM+IGPVI+SF
Sbjct: 551  LIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMIIGPVIISF 610

Query: 555  IPICIVGSLIFXXXXXXXXXXXXDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIA 614
            IPICIVGSLIF            DT GK+  FEYITIVIIV TMG++DFVLG+IVGILIA
Sbjct: 611  IPICIVGSLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGVFDFVLGIIVGILIA 670

Query: 615  CFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIIS 674
            CFSFLVDSTKLQTINGEF+G+VARSTV RDY+Q+ FLN VGEQI+VLKLQN+LFFGTIIS
Sbjct: 671  CFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIHVLKLQNLLFFGTIIS 730

Query: 675  IEEKIDKLLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLI 734
            IEEKID LLEI+D K SS++RIKYLILDFKNINADNIDYSAAEGFNRIKRFT+TKRI+LI
Sbjct: 731  IEEKIDGLLEISD-KDSSRQRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIQLI 789

Query: 735  ISSIKERDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRAREKMQHSYN 794
            ISSI E+D IYN F+ VGLL DVELF DLN ALEWCENEFL +YK++R R + K+Q    
Sbjct: 790  ISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQYKQIRTRTKAKLQ---- 845

Query: 795  VTSAIEAAAAKKVPTDNNQISKKXXXXXXXXXXXXXPMNTPRNHQMLSVAQNMFNDEEDV 854
                    A KK       +SK              P+NTPRN+Q+++VAQ +F DE++V
Sbjct: 846  --------AQKK---QEKHLSKS-----------LLPINTPRNNQIVTVAQKIFPDEQNV 883

Query: 855  DALEDESCNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRLTTQ 914
              L  +     ++PVLPLLL ALK +R  I S D  +++ E   WS+L PYFV++R    
Sbjct: 884  THLRTQY--QKREPVLPLLLVALKKFRPQIMSYDKDVKQAEEDFWSKLCPYFVRKRFAPG 941

Query: 915  SILLHNQDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEHKVTIVTE 974
            S+LLHN + FF+VESG+LKI  DL QG  YETMS++TC G I G+   ++  + V I TE
Sbjct: 942  SLLLHNNNLFFLVESGMLKITYDLHQGQFYETMSSKTCYGRISGNAEFTTNLY-VNIKTE 1000

Query: 975  TDTCLWLIDVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024
            TD  +W+ID   L  L+ +NL LY EL+L+ + I   R ++LLGY+LVS+
Sbjct: 1001 TDCAVWIIDATNLANLKEKNLALYAELLLVVMSINQYRSKELLGYSLVSS 1050

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 72/157 (45%), Gaps = 36/157 (22%)

Query: 10  RNRQSISGAISVSLGLNR-------QVHRNSDGEFTXXXXXXXXXXXXXXXDSSSIEIVS 62
           +NR+SIS AI++SLGL+        Q +R S                             
Sbjct: 5   KNRKSISEAITISLGLHSDNIKQPSQANRRSSMN-------------------------- 38

Query: 63  PPFYNSNNYAGRSYLGGGFLSASPKMNLQQRNDDSSVLPIDRSRSKSIHGSQIIHRQTAE 122
            P  +SN Y GRSY+G    S+   +  +   D   +L + +  SKSIH S  +HRQTA 
Sbjct: 39  -PENSSNYYLGRSYVGS--FSSPSFLQRESSADTGHILSLHKDASKSIHESVKLHRQTAA 95

Query: 123 LSNNFSDDTTGMEEVRNRYDAMEDENSSLHHYMTHQD 159
           LSNNF D + G  +  +   + E +N +L   ++ ++
Sbjct: 96  LSNNFDDSSDGKSDEIDVAASQEFQNEALQRELSLEN 132

>TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3.485
            YGR125W
          Length = 1049

 Score = 1031 bits (2667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/975 (53%), Positives = 685/975 (70%), Gaps = 56/975 (5%)

Query: 95   DDSSVLPIDRSRSKSIHGSQIIHRQTAELSNNFSDDTTGMEEVRNRYDAME--------- 145
            +DS   P +++  KSI  + I+HRQTAELS  F D     ++V++  D ++         
Sbjct: 86   NDSIYPPENKTSMKSITVADILHRQTAELSKTFYDSNFTDKDVKDYIDIIDNDVATSNES 145

Query: 146  DENSSLHHYMTHQ--------DYQTLPGGTDEDWTN------------------------ 173
            D NS+   Y+  +          Q  P   D++ +                         
Sbjct: 146  DSNSTPEPYLGDEYDQHRLAIRTQKSPNIADDEQSRLLTPSSSIIGAELDLEAHYDEFEP 205

Query: 174  --NNNSQTARASGSSIVQFGQDVLHYFPSAVXXXXXXXXXXXXXXMIIFPITEPIFSHLG 231
               + S   R + S ++ F Q +LHYFP+AV              MIIFPITEPIF+++G
Sbjct: 206  VRMDASSINRQNESKLIDFSQ-ILHYFPAAVLGLLLNILDALSYGMIIFPITEPIFANMG 264

Query: 232  STGLSMFYISTIISQCLYSGGLSSFTSGIGSEMIEVTPFFHTMAFAIRDAIPGQDDDIIT 291
            + G+SMFYIS+II Q + SGG SSF +GIGSEMIE+TPF+HTMA AI++++  Q++ II+
Sbjct: 265  TAGISMFYISSIICQYILSGGFSSFPTGIGSEMIEITPFYHTMALAIKNSLDVQEE-IIS 323

Query: 292  TTIFCYAISSVVTGITFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLA 351
            TTIFCY ISS+VTG+ FY LGKL+LGKIV FFPRHILIGCIGGVGYFL++TGL VTTR+A
Sbjct: 324  TTIFCYVISSLVTGLVFYSLGKLKLGKIVAFFPRHILIGCIGGVGYFLVVTGLEVTTRVA 383

Query: 352  KIEYTWEFLKKLFLDTDILWKWLLPVVLTILLVNTQKCFQNSLVLPSFYIVTLILFHFVV 411
            K+EY+WEFL  L  D +I+ KWL P++LT +L+ TQ  FQNSLVLPSFYI+T+ILFHF+V
Sbjct: 384  KVEYSWEFLSYLLSDFNIIGKWLTPILLTTILIFTQHHFQNSLVLPSFYIITIILFHFIV 443

Query: 412  AIVPSISLDQLRDLGWIFPAATSKDRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGIL 471
            A+VP +SL++LRD GWIFP   S D+WFDHYK F+ + V W L+L Q+PTMLALTFFGIL
Sbjct: 444  ALVPMLSLNKLRDSGWIFPLTNSNDKWFDHYKYFNVYNVSWVLILKQMPTMLALTFFGIL 503

Query: 472  HVPINVPALAISLHMDKFDVDKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSP 531
            HVPINVPALA+SL++DKFDVD+E IAHGYSNF+SG+ GS+QNYLVYTNSVLFIRAGADSP
Sbjct: 504  HVPINVPALAMSLNIDKFDVDREFIAHGYSNFLSGLFGSVQNYLVYTNSVLFIRAGADSP 563

Query: 532  FAGYMLAILTFAVMVIGPVIVSFIPICIVGSLIFXXXXXXXXXXXXDTRGKVTNFEYITI 591
             AGY+L +LT  VM+IGPVI+SFIPICIVGSLIF            DT GKVT FEY TI
Sbjct: 564  IAGYLLIVLTAIVMLIGPVIISFIPICIVGSLIFLLGYELLIEALLDTVGKVTFFEYTTI 623

Query: 592  VIIVLTMGIYDFVLGVIVGILIACFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFL 651
            +IIV TMGIYDFVLG+IVGIL+AC  F+VD TKLQTIN E+DG +A+STV RD++QS FL
Sbjct: 624  IIIVFTMGIYDFVLGIIVGILLACIKFMVDGTKLQTINTEYDGTIAKSTVYRDFIQSKFL 683

Query: 652  NGVGEQIYVLKLQNVLFFGTIISIEEKIDKLLEITDSKSSSKRRIKYLILDFKNINADNI 711
            +G+GEQIY++KLQNVLFFGTIISIEEKID LL+++DS  SSK RI+YLILDFKNIN DNI
Sbjct: 684  DGIGEQIYLIKLQNVLFFGTIISIEEKIDTLLQLSDS-DSSKHRIRYLILDFKNINDDNI 742

Query: 712  DYSAAEGFNRIKRFTQTKRIKLIISSIKERDHIYNVFSNVGLLDDVELFNDLNGALEWCE 771
            DYSAAEGFNRIKRFT  + IKLIISSI   D IY  F+ +GLL D+ELF+DLN  LEWCE
Sbjct: 743  DYSAAEGFNRIKRFTHGRHIKLIISSITHTDKIYKAFNKIGLLQDIELFSDLNNGLEWCE 802

Query: 772  NEFLGEYKKLRDRAREKMQHSYNV--TSAIEAAAAKKVPTDNNQISKKXXXXXXXXXXXX 829
            N++L +Y++L ++A++++    ++     I +       +D N+                
Sbjct: 803  NKYLEKYRELHEKAKKRLHSRMSILQDKNISSRQINSTSSDGNEYQSS-------QRLMS 855

Query: 830  XPMNTPRNHQMLSVAQNMFNDEEDVDALEDESCNDGQQPVLPLLLFALKSYRKNITSTDP 889
             P+NTPRNHQ+LSVA+N+F +E    +   ++ ++G+     LLL +++ +R ++ S   
Sbjct: 856  LPLNTPRNHQLLSVARNVFKNETQAVS-RFKNLDNGEDAFTQLLLQSIRRFRPDVFSESK 914

Query: 890  HLRERETQLWSQLVPYFVKRRLTTQSILLHNQDFFFVVESGLLKIALDLPQGVVYETMSN 949
             +R +E + W+QL PYF K  + T S  L+  +FFF+++SG++K+  DL  G + ETM +
Sbjct: 915  DIRAQEIKFWTQLAPYFNKIFVETNSTFLNENNFFFLLDSGVIKVTHDLAPGKLSETMLS 974

Query: 950  RTCCGNIVGSDYKSSEEHKVTIVTETDTCLWLIDVDGLQKLRAENLQLYTELVLLCLLIK 1009
            RT  G +   + ++ + HKVT + ET + +WLID +GL+K+  ENL+LY+EL LL + I 
Sbjct: 975  RTSYGILSSKNNRTYKTHKVTFIPETKSVIWLIDSEGLKKMEKENLKLYSELTLLIMSIS 1034

Query: 1010 SRRFEQLLGYTLVSA 1024
              RF+ LLGYTLV+A
Sbjct: 1035 DYRFKALLGYTLVNA 1049

>Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR125W -
            Hypothetical ORF [contig 295] FULL
          Length = 1011

 Score = 1025 bits (2650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/1063 (52%), Positives = 707/1063 (66%), Gaps = 99/1063 (9%)

Query: 6    DRPSRNRQSISGAISVSLGLNRQVHRNSDGEFTXXXXXXXXXXXXXXXDSSSIEIVSPPF 65
            +RP +N+ SIS AISVSLGL  Q + + D  +                        + PF
Sbjct: 4    NRP-KNKPSISEAISVSLGLQSQSNSDQDSSYIPR---------------------ANPF 41

Query: 66   YNSNN-----YAGRSYLGGGFLSASPKMNLQQRNDDSSVLPIDRSRSKSIHGSQIIHRQT 120
             ++ +     Y GRSY+    LS  P   L         L     +S+SIH S  + RQT
Sbjct: 42   SHTGDGSPHYYLGRSYVAN--LSPPPLARLPGGLPGELPLSYRPEQSQSIHQSVSLRRQT 99

Query: 121  AELSNNFSD----------------DTTGMEE----------VRNRYDAMEDENSSLHHY 154
            A LSN F D                 +T  EE          V +  D   D N   +  
Sbjct: 100  AALSNEFEDTFEFEDQLAGVSEDDGHSTTAEEPSMNGTLISPVSSVPDTPIDINEPSNAL 159

Query: 155  MTHQDYQTLPGGTDEDWTNNNNSQTARASGSSIVQFGQD-------------VLHYFPSA 201
            +       L  G+ + + +   S  +R SG++    G D             +++Y P+ 
Sbjct: 160  LPPNAEHDLEYGSIDGYEHQYVSLQSRRSGANTHNIGPDASLREKMMFTARRMVNYMPAV 219

Query: 202  VXXXXXXXXXXXXXXMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSGGLSSFTSGIG 261
            +              MIIFPITEP+FSHLG TG+SMFY+S+IISQ +YSGG S+F + +G
Sbjct: 220  ILGLLLNILDALSYGMIIFPITEPLFSHLGPTGMSMFYVSSIISQLIYSGGFSAFGNAVG 279

Query: 262  SEMIEVTPFFHTMAFAIRDAIPGQDDDIITTTIFCYAISSVVTGITFYLLGKLRLGKIVG 321
            SEMIE+TPF+H MA +I   +PG+ D +++TTI CYA+SS++TG+ F+LLG+LRLGKIVG
Sbjct: 280  SEMIEITPFYHAMAASIVAGLPGEKDRVLSTTIVCYALSSIITGLVFFLLGRLRLGKIVG 339

Query: 322  FFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILWKWLLPVVLTI 381
            FFPRHILIGCIGGVGYFLLITGL VTTR+AK EY++EFL  LF + ++L KW LP ++ +
Sbjct: 340  FFPRHILIGCIGGVGYFLLITGLEVTTRVAKFEYSFEFLSSLFTNIEVLGKWGLPALMAV 399

Query: 382  LLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRWFDH 441
            LLV  Q  F NSLVLP+FYI  L+LFHF+VA++PS+SLD LRD GWIFPA  S + WFD 
Sbjct: 400  LLVVVQHAFGNSLVLPAFYIAALLLFHFIVALIPSLSLDILRDSGWIFPATDSTEHWFDF 459

Query: 442  YKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAHGYS 501
            Y L+++  V W ++L QIPTMLALTFFGILHVPINVPALA+S+ +DK DVDKELIAHGYS
Sbjct: 460  YTLYNFKLVSWPMILKQIPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYS 519

Query: 502  NFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFIPICIVG 561
            NF+SG++GS+QNYLVYTNSVLFIRAG D   AG MLA  TF +M++GPVIV++IP+CIVG
Sbjct: 520  NFLSGIMGSVQNYLVYTNSVLFIRAGGDDALAGLMLAAATFGIMIVGPVIVAYIPVCIVG 579

Query: 562  SLIFXXXXXXXXXXXXDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIACFSFLVD 621
            SLIF            DT GK+ NFEY T+V IV TMG +DFVLG+IVGILIACFSFLVD
Sbjct: 580  SLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVD 639

Query: 622  STKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIISIEEKIDK 681
            STKLQT+NGEFDG+VARSTV+RDY+Q+ FLN +GEQI+VLKLQN+LFFGTI+SIEEKIDK
Sbjct: 640  STKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQIHVLKLQNLLFFGTILSIEEKIDK 699

Query: 682  LLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISSIKER 741
            LLE++D K SSK+RIKYLILDFKNINADNIDYSAAEGFNRIKRFT +KRI LIISSIK  
Sbjct: 700  LLELSD-KDSSKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTS 758

Query: 742  DHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRAREKMQHSYNVTSAIEA 801
            D IY  F+ VG+L+ VELF+DLN ALEWCENEFL ++K LR++ + K             
Sbjct: 759  DRIYRAFNKVGMLEGVELFDDLNSALEWCENEFLIQFKDLRNKTKLK------------- 805

Query: 802  AAAKKVPTDNNQISKKXXXXXXXXXXXXXPMNTPRNHQMLSVAQNMFNDEEDVDALEDES 861
             A KK    + ++SK              P NTPRN+Q +SVAQ +F DE+ +  L  +S
Sbjct: 806  -AGKK---QDRRMSK-----------VPLPFNTPRNNQFVSVAQKLFTDEQSMTHL--KS 848

Query: 862  CNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRLTTQSILLHNQ 921
                + PVLPLLL AL+ +R  I S+D  ++E E +LWS L  YF K+RL   S+LLH  
Sbjct: 849  SYRERPPVLPLLLSALQRFRPQIMSSDKSVKEGEERLWSDLCKYFYKKRLAAHSLLLHKD 908

Query: 922  DFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEHKVTIVTETDTCLWL 981
            + FFV+E+G++K+  +L QG +YETMS +TC G +   +  ++    V +  ETD  LW+
Sbjct: 909  NIFFVIETGMVKVTYNLRQGQLYETMSGKTCYGRMSIPNNNNNPISCVEVEMETDCSLWI 968

Query: 982  IDVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024
            ID  GL KL+ ENL LYTE++L+ L I   R ++LLG+ LVS+
Sbjct: 969  IDDAGLAKLKRENLNLYTEVLLVTLCINQDRLKELLGHCLVSS 1011

>KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} similar
            to uniprot|P53273 Saccharomyces cerevisiae YGR125W
            Hypothetical ORF
          Length = 1010

 Score = 1021 bits (2639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/1067 (50%), Positives = 701/1067 (65%), Gaps = 104/1067 (9%)

Query: 4    GVDRPSRNRQSISGAISVSLGLNRQVHRNSDGEFTXXXXXXXXXXXXXXXDSSSIEIVSP 63
            G  RP RN+ S+S AISVSLGL  Q    +D                         +  P
Sbjct: 2    GFSRP-RNKHSLSEAISVSLGLQSQPGSETD------------------------TLSVP 36

Query: 64   ---PFYNSNNYAGRSYLGGGFLS--ASPKMNLQQRNDDSSVLPIDRSRSKSIHGSQIIHR 118
               PF N  + +   YLG  +++  + P + +++R            +S+SIH S  + R
Sbjct: 37   RGNPFSNGADGSPHYYLGRSYVANLSPPPLAIKERFSGDPTSSSRPEQSQSIHQSLSLRR 96

Query: 119  QTAELSNNFSDDTTGMEE-----VRNRYDAMEDE---------------------NSSLH 152
            QTA LSN F D T   E+       N   A+ DE                     N+ + 
Sbjct: 97   QTAALSNEF-DGTFEFEDQLEDLAENGNTAVPDESVMAGSAISPTSSGPEPSVLDNTDVS 155

Query: 153  HYMTHQDYQT-LPGGTDEDWTNNNNSQTARASGS--------------SIVQFGQDVLHY 197
            + +   + Q  L  G+ +++ +   S  ++ +GS              ++  F + + +Y
Sbjct: 156  NLLLPPNTQRDLEYGSIDEFDHQYVSLQSQRAGSNSRAIDPNASMRDKTLFTF-RRLGNY 214

Query: 198  FPSAVXXXXXXXXXXXXXXMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSGGLSSFT 257
             P+ +              MIIFPITEP+FSHLG +GLSMFY+S+++SQ +YS G S+F 
Sbjct: 215  VPAVILGLLLNILDALSYGMIIFPITEPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFG 274

Query: 258  SGIGSEMIEVTPFFHTMAFAIRDAIPGQDDDIITTTIFCYAISSVVTGITFYLLGKLRLG 317
            + +GSEMIE+TPF+H+MA +I  ++PG+ D ++TTTI CYA+SS++TG+ F+LLG+L+LG
Sbjct: 275  NAVGSEMIEITPFYHSMAASIMASMPGEKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLG 334

Query: 318  KIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILWKWLLPV 377
            KIVGFFPRHILIGCIGGVGYFL+ITG  VTTR +K EY++EFL  L  D +IL KW LP 
Sbjct: 335  KIVGFFPRHILIGCIGGVGYFLVITGFEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPA 394

Query: 378  VLTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDR 437
            ++ +LLV  Q+  +NSLVLP+FYI  L+LFHF+VA++PS+SL  LRD GW+FPA T+ + 
Sbjct: 395  LMAVLLVVIQRACKNSLVLPTFYIAALLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEH 454

Query: 438  WFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIA 497
            WFD YKL+++  V W LVL Q+PTMLALTFFGILHVPINVPALA+S+ +DK DVDKELIA
Sbjct: 455  WFDFYKLYNFKLVSWPLVLKQVPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIA 514

Query: 498  HGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFIPI 557
            HGYSNF+SGM+GS+QNYLVYTNS+LFI+AGAD   AG MLA  TF +MVIGPVIV++IP+
Sbjct: 515  HGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPV 574

Query: 558  CIVGSLIFXXXXXXXXXXXXDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIACFS 617
            CIVGSLIF            DT GK+ NFEY T+V IV TMG +DFVLG+IVGILIACFS
Sbjct: 575  CIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFS 634

Query: 618  FLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIISIEE 677
            FLVDSTKLQTINGEFDG+VARSTV RDY+Q+ FLN +GEQI+VLKLQN+LFFGTIISIEE
Sbjct: 635  FLVDSTKLQTINGEFDGQVARSTVRRDYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEE 694

Query: 678  KIDKLLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISS 737
            KIDKLLE++D K +SK+RIKYLILDFKNINADNIDYSAAEGFNRIKRFT +KRI LIISS
Sbjct: 695  KIDKLLELSD-KDASKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTFSKRIHLIISS 753

Query: 738  IKERDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRAREKMQHSYNVTS 797
            IK  D IY  F+ VG LD VELF+DLN ALEWCENEFL +++ LR++ +           
Sbjct: 754  IKTTDRIYRAFNKVGTLDGVELFDDLNSALEWCENEFLRQFRDLRNKTK----------- 802

Query: 798  AIEAAAAKKVPTDNNQISKKXXXXXXXXXXXXXPMNTPRNHQMLSVAQNMFNDEEDVDAL 857
                   K V     Q+SK              P NTPRN+  +SVAQ +F DE+ +  L
Sbjct: 803  ------LKAVRKQERQLSKG-----------ALPFNTPRNNHFVSVAQKLFTDEQSMPHL 845

Query: 858  EDESCNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRLTTQSIL 917
            +       + PVL LLL AL+ YR  I S +  ++E E ++WS+L  +F KRRL  QS+L
Sbjct: 846  KTHY--KEKTPVLHLLLSALQRYRPEIMSPEKPVKETEEKMWSELGKFFFKRRLAAQSLL 903

Query: 918  LHNQDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEHKVTIVTETDT 977
             H  + F VVESG++K+  +L QG +YE +S +TC G I   +        V I  ETD 
Sbjct: 904  PHKNNIFLVVESGMVKVTYNLRQGQLYEILSGKTCYGRITAPNSSEVPISSVEIKMETDC 963

Query: 978  CLWLIDVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024
             LW++D   L KL+ ENL LYTEL+L+ L +   R ++LLG+ LVS+
Sbjct: 964  ALWILDEANLAKLKKENLALYTELLLVTLCMNQDRLKELLGHCLVSS 1010

>KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1088

 Score = 1019 bits (2634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/852 (61%), Positives = 639/852 (75%), Gaps = 19/852 (2%)

Query: 187  IVQFGQDVLHYFPSAVXXXXXXXXXXXXXXMIIFPITEPIFSHLGSTGLSMFYISTIISQ 246
            I     D++HY P+++              MIIFPITEPIFS LG +GLSMFYIST+ISQ
Sbjct: 242  ISALSHDIVHYLPASILGLLLNILDALSYGMIIFPITEPIFSQLGPSGLSMFYISTVISQ 301

Query: 247  CLYSGGLSSFTSGIGSEMIEVTPFFHTMAFAIRDAI-PGQDDDIITTTIFCYAISSVVTG 305
              YS G SSF  GIGSEMIEVTPFFHTMA  I   +   + ++IITTTIFCY ISS+ TG
Sbjct: 302  FTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTTIFCYVISSMFTG 361

Query: 306  ITFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFL 365
            +TF+ LGKL+LGK+VGFFPRHILIGCIGGVGYFLLITG+ V TR+AK EY+  FL  LF 
Sbjct: 362  LTFFTLGKLKLGKLVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIPFLLNLFT 421

Query: 366  DTDILWKWLLPVVLTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDL 425
            D   L++WLLP +LTI+L+ TQ  F+NSLVLPSFYI+TLILFHF+VAIVP++SL +LR+ 
Sbjct: 422  DEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLSLTKLRNS 481

Query: 426  GWIFPAATSKDRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLH 485
            GWIFP A S   W+DHYK F++  VHW LV+ QIPTM+ALTFFGILHVPINVPALA+SL 
Sbjct: 482  GWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVPALAMSLQ 541

Query: 486  MDKFDVDKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVM 545
            MDK+DVD+ELIAHGYSNF SG+ GSI+NYLVYTNSVLFIRAGADS  AGY+L +LT  VM
Sbjct: 542  MDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYILIVLTIIVM 601

Query: 546  VIGPVIVSFIPICIVGSLIFXXXXXXXXXXXXDTRGKVTNFEYITIVIIVLTMGIYDFVL 605
            +IGPVI+SFIPICIVGSLIF            DT GK+  FEY+T+ II+LTMGI+DFVL
Sbjct: 602  LIGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFVL 661

Query: 606  GVIVGILIACFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQN 665
            G+IVGILIACF FL+DST LQT+NGEF G+VA+STV RD +Q+ FL+GVGEQIYVLKLQN
Sbjct: 662  GIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIYVLKLQN 721

Query: 666  VLFFGTIISIEEKIDKLLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRF 725
            +LFFGTIISIEEKIDKLLEI+++  SSKRRIKYLILDFKNIN DNIDYSAAEGFNRI+RF
Sbjct: 722  LLFFGTIISIEEKIDKLLEISNN-DSSKRRIKYLILDFKNINTDNIDYSAAEGFNRIRRF 780

Query: 726  TQTKRIKLIISSIKERDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRA 785
            TQTK I+LIISSI+E+D IY  F+NVGLL+DVELF DLN +LEWCENE L  Y +LR +A
Sbjct: 781  TQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNELRTKA 840

Query: 786  REKMQHSYN----VTSAIEAAAAKKVPTDNNQI-SKKXXXXXXXXXXXXXPMNTPRNHQM 840
            + +++   N    V S +  +A+K++  D+  I S               P NTPRNHQM
Sbjct: 841  KARLRKLNNTANSVVSRLPVSASKQM--DSRAITSADQSGRAAISNLMSLPTNTPRNHQM 898

Query: 841  LSVAQNMF-NDEEDVDALEDESCNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLW 899
            L+VAQ++F NDE+ V +L  +     + P+LPLLL  LK YR +I S D   R++E  +W
Sbjct: 899  LTVAQDVFKNDEQTVSSLRKQL--KTKDPLLPLLLLTLKQYRPDIGSNDKLARDKEIAIW 956

Query: 900  SQLVPYFVKRRLTTQSILLHNQDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGS 959
            S+L PYF K+ +  Q+ L H    FF+V++G+LK    LPQG VYETM+NRTC G I+ S
Sbjct: 957  SRLCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGKIIDS 1016

Query: 960  -------DYKSSEEHKVTIVTETDTCLWLIDVDGLQKLRAENLQLYTELVLLCLLIKSRR 1012
                   D  + +  K+ I TETD+ LW+ID   + +L  E+ +L+ +L LL +LIK +R
Sbjct: 1017 GTTVDDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALLVMLIKDKR 1076

Query: 1013 FEQLLGYTLVSA 1024
            F+ LLG+ L+SA
Sbjct: 1077 FKDLLGHALISA 1088

 Score = 58.9 bits (141), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 71/140 (50%), Gaps = 37/140 (26%)

Query: 5   VDRPSRNRQSISGAISVSLGLNRQVHRNSDGEFTXXXXXXXXXXXXXXXDSSSIEIVSPP 64
           + RP+R  QSIS +ISVSLGL     R SD E                   + ++++   
Sbjct: 9   IKRPAR--QSISESISVSLGLQNNDARQSDNE-------------------NPLQVLP-- 45

Query: 65  FYNSNNYAGRSYLGGGFLSASPKMNLQQRNDDSS--VLPI--DRSRSKSIHGSQIIHRQT 120
               ++Y GRSY+ G +   SP     QRN+ S   +LP   +++ SK IH SQ++HRQT
Sbjct: 46  --GESSYLGRSYVSGLW---SPT----QRNNKSGYDLLPTSNEQAYSKPIHKSQMLHRQT 96

Query: 121 AELSNNFSDDTTGMEEVRNR 140
             +  NFS D+ G E   N+
Sbjct: 97  QAIGENFS-DSNGDEGSENK 115

>TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_3.485
            YGR125W
          Length = 1150

 Score = 1008 bits (2607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/910 (56%), Positives = 653/910 (71%), Gaps = 47/910 (5%)

Query: 127  FSDDTTGMEEVRNRYDAMEDENSSLHHYMTHQDYQTLPGGTDEDWTNNNNSQTARASGSS 186
            + D+        N YD+ + EN   ++Y++     ++P  TD          T+ +    
Sbjct: 276  YDDENALFFSSSNNYDSTDLEN---NNYIS----SSIPTTTDV------TQSTSLSFKDM 322

Query: 187  IVQFGQDVLHYFPSAVXXXXXXXXXXXXXXMIIFPITEPIFSHLGSTGLSMFYISTIISQ 246
            + +    +LH  P+ +              MI+FPIT+ +F HLG TGLSMFYISTIISQ
Sbjct: 323  LTKHSLQILHDIPACILGLLLNILDALSYGMILFPITDSVFGHLGPTGLSMFYISTIISQ 382

Query: 247  CLYSGGLSSFTSGIGSEMIEVTPFFHTMAFAIRDAIPGQD-DDIITTTIFCYAISSVVTG 305
             +YSGG S+F SG+G EMIE+ PFFHTMA  ++++IP +D ++IITTTIFCY IS + TG
Sbjct: 383  LVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPSKDQNEIITTTIFCYVISCIFTG 442

Query: 306  ITFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFL 365
            I F+ LGK +LGK+VGFFPRHILIGCIGGVGYFL++TG+ VTTR+ K+EY+ EFL  +  
Sbjct: 443  IVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTGIEVTTRVKKLEYSLEFLLSVIT 502

Query: 366  DTDILWKWLLPVVLTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDL 425
            +   L+K +LP+ L++LL   QK + +SL+LPSFYI+T I FHF+VA+VP++SLD LR  
Sbjct: 503  NMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIITFIAFHFIVALVPNLSLDSLRAT 562

Query: 426  GWIFPAATSKDRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLH 485
            GWIFP A S D W+ HYK F++   HW+LV  QIPTM ALTFFGILHVPINVPALA+S+ 
Sbjct: 563  GWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMFALTFFGILHVPINVPALAMSVQ 622

Query: 486  MDKFDVDKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVM 545
            MDK+DVDKELIAHGYSN ISG+ GS+QNYLVYTNSVLFIRAG ++  AG +LA  T  ++
Sbjct: 623  MDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIIL 682

Query: 546  VIGPVIVSFIPICIVGSLIFXXXXXXXXXXXXDTRGKVTNFEYITIVIIVLTMGIYDFVL 605
             IGPVI+SFIP+CIVGSLIF            DT GKVT FEYITI+IIV TMGIYDFVL
Sbjct: 683  FIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEYITIMIIVFTMGIYDFVL 742

Query: 606  GVIVGILIACFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQN 665
            G++VGILIACFSFLVDSTKLQT+NGEF+G VA+STV RDYVQS FL+G+ EQIYVLKLQN
Sbjct: 743  GILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQSQFLSGIAEQIYVLKLQN 802

Query: 666  VLFFGTIISIEEKIDKLLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRF 725
            VLFFGTIISIEEKID LLEI+D+  SSKRRIKYLILD KN+N+DNIDYSAAEGFNRIKRF
Sbjct: 803  VLFFGTIISIEEKIDMLLEISDND-SSKRRIKYLILDLKNVNSDNIDYSAAEGFNRIKRF 861

Query: 726  TQTKRIKLIISSIKERDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRD-- 783
            TQ+KRI+LIISSIK+ D IY +F+NV LL++VELF+DLNGALEWCENEFL +Y+++++  
Sbjct: 862  TQSKRIQLIISSIKDTDKIYKMFNNVNLLENVELFSDLNGALEWCENEFLYQYRQVKNKA 921

Query: 784  --------RAREKMQHSYNVTSAIEAAAAKKVPTDNNQISKKXXXXXXXXXXXXXPMNTP 835
                     +R+ ++  Y  TS       +K   +                    P+NTP
Sbjct: 922  RARAKRKATSRDVVRTGYLSTSVSNTLNDRKSSGN-------------------LPINTP 962

Query: 836  RNHQMLSVAQNMFNDEEDVDALEDESCNDGQQ-PVLPLLLFALKSYRKNITSTDPHLRER 894
            RNHQM+SVA+N+F + E    +   S N  +  PVL LL+FALK YR +I S D  +R++
Sbjct: 963  RNHQMVSVAKNIFQNIE--QPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKVRDK 1020

Query: 895  ETQLWSQLVPYFVKRRLTTQSILLHNQDFFFVVESGLLKIALDLPQGVVYETMSNRTCCG 954
            E + WSQL PYF K+ L  ++ LLHN + FF+VESG+LK+  +LPQG VYETMSNRTC G
Sbjct: 1021 EVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTCYG 1080

Query: 955  NIVGSDYKSSEEHKVTIVTETDTCLWLIDVDGLQKLRAENLQLYTELVLLCLLIKSRRFE 1014
             I+G  Y       + I  ETD  +WLI+ +GL K++AENL+LYTEL LL + +K  RF 
Sbjct: 1081 RILGKGYLKKSTSPLNIKAETDCIIWLINSEGLDKMKAENLELYTELTLLVMSVKDDRFN 1140

Query: 1015 QLLGYTLVSA 1024
             LLGY L+SA
Sbjct: 1141 NLLGYALISA 1150

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 62/153 (40%), Gaps = 25/153 (16%)

Query: 6   DRPSRNRQSISGAISVSLGLNRQVHRNSDGEFTXXXXXXXXXXXXXXXDSSSIEIVSPPF 65
           +  +R R  +S AIS+SLGL  Q   ++D                      SI +  P  
Sbjct: 10  NNSNRERNKLSEAISISLGLQEQQGNDNDKYNNDNSNIHGTLNNSRQRRKPSISL-DPTL 68

Query: 66  YNSNNYAGRSYLGGGFLSASPKMNLQQR---------------------NDDSSVLPIDR 104
             S N   RS+  G FLS S   NL                        N ++  LP+  
Sbjct: 69  --SRNIGARSFNCGAFLSRSIDNNLPTTDMFNSSTFRSSNSNNYFTHGLNSNNDHLPVIN 126

Query: 105 SRSKS-IHGSQIIHRQTAELSNNFSDDTTGMEE 136
              KS IHGS  +H++TAE+SN F++  T  E+
Sbjct: 127 PFPKSSIHGSDNLHKRTAEISNEFNNSPTDTED 159

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1060

 Score =  964 bits (2492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/885 (55%), Positives = 624/885 (70%), Gaps = 39/885 (4%)

Query: 140  RYDAMEDENSSLHHYMTHQDYQTLPGGTDEDWTNNNNSQTARASGSSIVQFGQDVLHYFP 199
             Y   ++EN     Y++      LP G       +   +++ +           +  Y P
Sbjct: 213  EYGTFDEENQPATQYIS-----LLPDGASSGGFTSQGFRSSMSHYDKARDLMLRIFQYTP 267

Query: 200  SAVXXXXXXXXXXXXXXMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSGGLSSFTSG 259
            +                MIIFPITEP+FSHLG TGLSMFY+ST+I Q  +S GLSSF S 
Sbjct: 268  AVGLGLLLNILDALSYGMIIFPITEPLFSHLGPTGLSMFYVSTVICQLCFSLGLSSFPSA 327

Query: 260  IGSEMIEVTPFFHTMAFAIRDAIP-GQDDDIITTTIFCYAISSVVTGITFYLLGKLRLGK 318
            IGSEMIE+TPFFHTMA +I ++IP G D+ +I+TTI CYA+SS++TG+TF+LLGK+RLGK
Sbjct: 328  IGSEMIEITPFFHTMALSIMNSIPEGNDNKVISTTIVCYALSSIITGLTFFLLGKMRLGK 387

Query: 319  IVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILWKWLLPVV 378
            IVGFFPRHILIGCIGGVGYFL+ITGL V TR+ + +Y+W+FL  LF D DIL KWL PV+
Sbjct: 388  IVGFFPRHILIGCIGGVGYFLIITGLEVCTRVPEFKYSWQFLSSLFTDFDILLKWLTPVI 447

Query: 379  LTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRW 438
            LT++L++ Q    NSLVLPSFYI+TL+LFHFVVA+VPS+SLD+LRD GWIF    +K+ W
Sbjct: 448  LTLILISVQSRIHNSLVLPSFYIITLLLFHFVVALVPSLSLDKLRDFGWIFAKVNAKENW 507

Query: 439  FDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAH 498
            +D YKL+D+  V W+L+  Q+PTMLALTFFGILHVPINVPALA+SL++DK+DVDKELIAH
Sbjct: 508  YDFYKLYDFKNVQWSLIPKQVPTMLALTFFGILHVPINVPALAMSLNVDKYDVDKELIAH 567

Query: 499  GYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFIPIC 558
            GYSN ISG +GSIQNYLVYTNSVLFIRAGADSP AG ML I TF VMVIGPVI+SFIPIC
Sbjct: 568  GYSNLISGFLGSIQNYLVYTNSVLFIRAGADSPIAGIMLTIGTFIVMVIGPVIISFIPIC 627

Query: 559  IVGSLIFXXXXXXXXXXXXDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIACFSF 618
            IVGSLIF            DT GK+  FEY+TI IIV+TMG+ DFV+G+IVGIL+ACFSF
Sbjct: 628  IVGSLIFLLGYELIQEAVIDTWGKLQPFEYLTIWIIVITMGVVDFVIGIIVGILLACFSF 687

Query: 619  LVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIISIEEK 678
            LV+ST+LQTINGE+DGKVA+STV RDY+QS FL  +GEQIYVLKLQN+LFFGTIISIEEK
Sbjct: 688  LVNSTQLQTINGEYDGKVAKSTVYRDYIQSKFLRNIGEQIYVLKLQNILFFGTIISIEEK 747

Query: 679  IDKLLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISSI 738
            ++ LLEI +S  SSK+RIKYLILDFKNI A +IDYSAAEGFNRIKRF + +RI LIISSI
Sbjct: 748  VNSLLEICES-DSSKKRIKYLILDFKNIRAKSIDYSAAEGFNRIKRFLEKERIHLIISSI 806

Query: 739  KERDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRAREKMQHSYNVTSA 798
             + D IY  F  V L ++VELF+DLNGALEWCENEFL  YK++R + R +          
Sbjct: 807  DKEDQIYLAFDKVRLFENVELFSDLNGALEWCENEFLMRYKRIRTKTRAR---------- 856

Query: 799  IEAAAAKKVPTDNNQISKKXXXXXXXXXXXXXPMNTPRNHQMLSVAQNMFNDEEDVDALE 858
             + A  KK     N++SK              P+NTPRNHQ +S  +N++ +E ++  L 
Sbjct: 857  -KLAQLKK---SQNRMSK-------------LPVNTPRNHQFVSEVRNIYTEEMEIQKLS 899

Query: 859  DESCNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRLTTQSILL 918
            +E     +Q  LP+ L +++ +R  I S +   R  E  LW +L+ YF +++    + + 
Sbjct: 900  NEL--KERQQFLPIFLMSIRKFRNAIQSPNELKRTNELDLWKRLISYFQQKKFPPNTEIR 957

Query: 919  HNQDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEHKVTIVTETDTC 978
            H  + F VVESG+L +   L QG  YETMS +T  G I   +   S+   V+I T+T+  
Sbjct: 958  HRNNMFIVVESGVLNLTHHLIQGEFYETMSPKTAYGVISNVN---SDPLAVSITTDTECV 1014

Query: 979  LWLIDVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYTLVS 1023
            L  ID + L  L+  + +L+TEL++L + I   RF +LLGY+L+S
Sbjct: 1015 LRYIDAESLADLKLTDPELFTELLILVMAIHRDRFRELLGYSLIS 1059

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 38/92 (41%), Gaps = 15/92 (16%)

Query: 68  SNNYAGRSYLGGGFLSASPKMNLQQRN------------DDSSVLPIDRSRSKSIHGSQI 115
           ++ Y GRSY+G      SP M  +  +             D    P     SK IH S  
Sbjct: 30  TSTYLGRSYVGSFI---SPPMEYRSNSNTTSNNNNNSNVGDPFKSPFSSEGSKLIHESGN 86

Query: 116 IHRQTAELSNNFSDDTTGMEEVRNRYDAMEDE 147
           +H+QTA LSN F +D    E      D  +DE
Sbjct: 87  LHKQTAFLSNTFDNDAGNDEGAGFPLDGNDDE 118

>AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR125W
          Length = 1015

 Score =  927 bits (2395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/1010 (49%), Positives = 646/1010 (63%), Gaps = 87/1010 (8%)

Query: 63   PPFYNSNNYAGRSYLGGGFLSASPKMNLQQ--RNDDSSVLPIDRSRSKS-IHGSQIIHRQ 119
            P       Y GRSY+G  F ++   M+ +      DS  LP  R ++ S +H    +HRQ
Sbjct: 45   PTLMRPEAYLGRSYVGS-FSNSGSLMSREAGAAGPDSPPLPRFRDQASSYVHNGSHLHRQ 103

Query: 120  TAELSN-------------------------------------------NFSDDTTGMEE 136
            TA L +                                           N S+    ++E
Sbjct: 104  TAALCDDSRAYDGGPEEEEALVFEGNMILQEGAPPRFGVGPYNLCKVDSNISEVLLNVDE 163

Query: 137  VRNRYDAMEDENSSLHHYMTHQDYQTLPGGTDEDWTNNNNSQTARASGSSIVQFGQDVLH 196
              +  D+ ++  + L       DY    G  +E+ + +  +  A    S +  +G   + 
Sbjct: 164  AVDDSDSDQEAGTRLFLSPITTDYIHSYGAINEEQSASETASRAETGPSPLRLWGTRTVR 223

Query: 197  YFPSAVXXXXXXXXXXXXXXMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSGGLSSF 256
            Y P+ +              MIIFPI EPIFSHLG  GLSMFY+STIISQ +YSGG SSF
Sbjct: 224  YIPAVILGLLLNILDALSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVYSGGFSSF 283

Query: 257  TSGIGSEMIEVTPFFHTMAFAIRDAIPGQ-DDDIITTTIFCYAISSVVTGITFYLLGKLR 315
              G GSEMIEVTPFFHTMA +I++++  +  DDIITTTI CYA+S+++TG  F  LGKLR
Sbjct: 284  GYGTGSEMIEVTPFFHTMALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLTLGKLR 343

Query: 316  LGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILWKWLL 375
            LGK+V FFP HILIGCIGGV YFL+ITG+ V+TR+ K EY+  FL+ LF+D DIL KWL+
Sbjct: 344  LGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAKWLI 403

Query: 376  PVVLTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSK 435
            P +L + ++  Q+   NS++LP FY+    LFHF+VA++PS+SLD LRD GWIFP   S 
Sbjct: 404  PALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESG 463

Query: 436  DRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKEL 495
             RW+D+ +L++  ++HW LVL +IPTMLALTFFGILHVPINVPALAIS  +DK DVDKEL
Sbjct: 464  GRWYDYLELYNPQRIHWELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKEL 523

Query: 496  IAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFI 555
            IAHGYSN  SG  GSIQNYLVYTNSVLFIRAGADS +AG++LAI TF  M  GP I+S I
Sbjct: 524  IAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWIISII 583

Query: 556  PICIVGSLIFXXXXXXXXXXXXDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIAC 615
            P+CIV SLIF            D+  +++NFEYIT+VII+LTMGI+DFVLG+IVG+L+AC
Sbjct: 584  PVCIVSSLIFLLGYELLKEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVAC 643

Query: 616  FSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIISI 675
            FSFLV+ST+ +TI+ EFDGKVA+S  +RDY+QSNFL  V EQIYVLKLQN LFFGTIISI
Sbjct: 644  FSFLVESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISI 703

Query: 676  EEKIDKLLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLII 735
            EEKI  LLE   + S  K+ IKYLILDFK+IN DNIDYSAAEGFNRIKR  + KRIKLI+
Sbjct: 704  EEKIGNLLE--PNGSEYKKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIV 761

Query: 736  SSIKERDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRA-REKMQHSYN 794
            SSI E D IY +FS +GLL DVELF DLN ALEWCENE L EY+ L  RA R K++    
Sbjct: 762  SSISECDKIYTIFSKIGLLQDVELFQDLNSALEWCENELLCEYRSLLSRAHRVKVRR--- 818

Query: 795  VTSAIEAAAAKKVPTDNNQISKKXXXXXXXXXXXXXPMNTPRNHQMLSVAQNMFNDEEDV 854
               + +     ++P +                      NTPRN Q+++ AQ +++ E+ +
Sbjct: 819  --RSKDIVPKAQIPLE----------------------NTPRNAQIMTAAQAVYSGEQQL 854

Query: 855  DALEDESCNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRLTTQ 914
            +  +  S      P L LLL ALK+YR    S   +   +E +LW  L PYFV++  + Q
Sbjct: 855  N--KTLSKYKASHPALALLLVALKTYR----SGHAYKETKEIRLWKHLCPYFVRKSFSPQ 908

Query: 915  SILLHNQDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEHKVTIVTE 974
            + +    D FFVVESGLLKI   LPQG + E ++++TC GNI G     S  +   + TE
Sbjct: 909  TSISDEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISG---PGSLSYSSVVRTE 965

Query: 975  TDTCLWLIDVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024
            T+  LW+ID  GLQKL+ ENL LYTEL+++ + +   RF++LLG++L++ 
Sbjct: 966  TECVLWMIDAPGLQKLQEENLPLYTELLVVYISVIQHRFKELLGHSLING 1015

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 134/673 (19%), Positives = 248/673 (36%), Gaps = 120/673 (17%)

Query: 219 IFPITEPIFSHLGSTGLSMFYISTIISQCL----------YSGGLSSFTSGIGSEMIEVT 268
           + P   P FS L S  L  F+   I    L          Y+  ++      G   +  T
Sbjct: 92  VLPYYLPCFSWLPSYDLRKFFGDFIAGVSLASFQIPLAMSYATSIAHVEPLCGLYALAFT 151

Query: 269 PFFHTMAFAIRDAIPGQDDDI-----------------ITTTIFCYAISSVVTGITFYLL 311
           PFF+ +  ++   I G +  I                 +++   C  I+  ++G+  +  
Sbjct: 152 PFFYAIFGSVPQMIVGPESAISLVVGQAIEPMIRHDPSLSSLDLCVIIT-FISGVVLFTF 210

Query: 312 GKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKI------EYTWEFLKKLFL 365
           G  R G +     R  L G I  VG  ++I  L V  +L K+       Y   F K LFL
Sbjct: 211 GVFRFGFLDNVLSRAFLRGFISAVGVIMVINSLIVELKLKKVFDDAPSHYHSPFEKVLFL 270

Query: 366 DTDILWKWLLPVVLTILLV------------NTQKCFQNSLVLPS--FYIVTLILFHF-- 409
                  + LP  L  L                 K F++ +  P     +VT+I F +  
Sbjct: 271 IKYAPANYHLPTSLLSLCCFLILMSLRLIKKKLLKRFRSLVFFPEILLVVVTVIFFSYNF 330

Query: 410 ---------VVAIVPSISLDQLRDLGWIFPAATSKDRWFDHYKLFDWHKVHWNLVLAQIP 460
                    VV  + +   D+LR+     P + +K  ++      D     +        
Sbjct: 331 DLKHRYNIEVVGDIEASVFDKLRN-----PLSKNKRPFYG-----DLFSAGF-------- 372

Query: 461 TMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAHGYSNFISGMVGSIQNYLVYTNS 520
            M+A+   G         +L  +  +     ++EL+A G  N I  + G++ ++  Y  S
Sbjct: 373 -MVAM--LGFFESTTASKSLGTAYDL-AVSSNRELVALGSLNLIGSLFGALPSFGGYGRS 428

Query: 521 VLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFIPICIVGSLIFXXXXXXXXXXXXDTR 580
            +   +GA +  +G  +  +T   +      + +IP+C++  +              D R
Sbjct: 429 KINAYSGAQTVVSGACMGTITMFTIKFLLKFIRYIPVCVLSVITTVVGLSLLEEAPADLR 488

Query: 581 GKVTNFEY---ITIVIIVLTMGIYDFVLGVIVGILIACFSFLVDSTKLQTINGEFDGKVA 637
             +    Y   I+ +I VLT   Y    G+ VG   +    +  STK +    +  GK+A
Sbjct: 489 FHIRCRGYNELISFIITVLTTFFYSVEAGITVGCGYSIIRVIKHSTKSRI---QILGKLA 545

Query: 638 RST--VNRDYVQSNFLNGVGEQ-----------IYVLKLQNVLFFGTIISIEEKIDKLLE 684
            +   VN D  +    N   E+             ++++   L F     ++ ++++ LE
Sbjct: 546 GTNKFVNADEYEGK--NSTSERRVNPQLEEIEGCLIVRIPEPLTFTNTDDLKTRLNR-LE 602

Query: 685 ITDS--------KSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIIS 736
           +  S        +S  +   KY+I D   +    ID SA +    I    + + + + + 
Sbjct: 603 LYGSTKTHPAAPRSRDQEMTKYVIFDLHGMT--TIDSSAIQILQEIISSYKRRHVHVFLV 660

Query: 737 SIKERDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRAREKMQHSYNVT 796
            +     + N F N G+L+ VE  +D++ +L     + L           E ++ +  + 
Sbjct: 661 RVPSARKVRNRFVNSGILEMVE--SDIHRSLLPSAQQMLTSSPYF-----ETIEEALRIV 713

Query: 797 SAIEAAAAKKVPT 809
             +E  AA  + T
Sbjct: 714 DELELRAASHLDT 726

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 96/488 (19%), Positives = 187/488 (38%), Gaps = 40/488 (8%)

Query: 303 VTGITFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKI------EYT 356
           V+G      G  R G +     + +L G I  VG  ++I  L    +L K        Y 
Sbjct: 200 VSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYH 259

Query: 357 WEFLKKLFLDTDILWKWLLPVV------LTILLVNTQKCFQNSLVLPSFYIVTLILFHFV 410
             F K LFL      ++ +P        L IL +      +             IL   +
Sbjct: 260 TPFEKILFLIDYAPAQYHMPTAIFSGCCLIILFLMRLLKRKLLKYHKGAIFFPDILLVVI 319

Query: 411 VAIVPSISLDQLRDLGWIFPAATSKDRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGI 470
           V I+ S+  D     G       S D  FD  K     +    L+       L +   G 
Sbjct: 320 VTILISMKFDLKHRYGITIVGDFSMDN-FDKLK-NPLTRSRRKLIPDLFSASLIVAMLGF 377

Query: 471 LHVPINVPALAISLHMDKFDVDKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADS 530
                   +L  + ++     ++EL+A G+ N +  + G++ ++  Y  S +   +GA S
Sbjct: 378 FESTTASKSLGTTYNL-TVSSNRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQS 436

Query: 531 PFAGYMLAILTFAVMVIGPVIVSFIPICIVGSLIFXXXXXXXXXXXXDTRGKVTNFEYIT 590
             +G  + ++T   M +    V +IP C++  +              D +  +    Y  
Sbjct: 437 VISGVFVGVITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPSDIKFHLRCGGYSE 496

Query: 591 IVIIVLTMGI---YDFVLGVIVGILIACFSFLVDSTKLQTINGEFDGKVARS---TVNRD 644
           + +  +T G+   Y    G+ +G + +  + +  S K +    +   +VA +   T   D
Sbjct: 497 LFVFAVTFGVTIFYSIEAGICIGCVYSILNIIKHSAKSRI---QILARVAGTSNFTNLDD 553

Query: 645 YVQSNFLNGVG-------EQIYVLKLQNVLFFGTIISIEEKIDKLLEITDSKSSSKRR-- 695
           Y+ +   N +        E   ++++   L F     +++++D++     SK    R+  
Sbjct: 554 YLMNMKRNPLSIENTEEIEGCMIVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSF 613

Query: 696 -----IKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISSIKERDHIYNVFSN 750
                IKY+I D   + +  +D SAA+  + I    + + + + ++++   D I    S 
Sbjct: 614 RSKDSIKYVIFDLGGMTS--LDSSAAQVLDEIITSYKRRNVFIYLANVSINDKIRTRLSK 671

Query: 751 VGLLDDVE 758
            G++ +VE
Sbjct: 672 AGVIPNVE 679

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 57/286 (19%), Positives = 125/286 (43%), Gaps = 22/286 (7%)

Query: 492 DKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVI 551
           ++EL+A G+ N +  + G++ ++  Y  S +   +GA S  +G  + I+T   M +    
Sbjct: 398 NRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMNLLLQF 457

Query: 552 VSFIPICIVGSLIFXXXXXXXXXXXXDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGI 611
           V +IP C++  +              D +  +    Y  + +  +T G+   +  +  GI
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPGDIKFHLRCGGYSELFVFAVTFGV-TILCSIEAGI 516

Query: 612 LIACFSFLVDSTKLQTING-EFDGKVARS---TVNRDYVQSNFLNGVG--------EQIY 659
            I C   +++  K    +  +   +VA +   T   DY+++   N +G        E   
Sbjct: 517 CIGCVYSILNIIKHSAKSRIQILARVAGTSNFTNLDDYLRTMKKNPLGGENRLEEVEGCM 576

Query: 660 VLKLQNVLFFGTIISIEEKIDKLLEITDSKSSSKRR-------IKYLILDFKNINADNID 712
           ++++   L F     +++++D++     SK    R+       IKY+I D   + +  ID
Sbjct: 577 IVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--ID 634

Query: 713 YSAAEGFNRIKRFTQTKRIKLIISSIKERDHIYNVFSNVGLLDDVE 758
            SAA+  + I    + + + + ++++   D I       G++ ++E
Sbjct: 635 SSAAQVLDEIITSYKRRNVFIYVANVSINDKIRTRLLKAGVIPNLE 680

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/287 (20%), Positives = 121/287 (42%), Gaps = 26/287 (9%)

Query: 492 DKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVI 551
           ++EL+A G  N  + ++G++  +  Y  S +   +GA +  +G  + ++    +      
Sbjct: 385 NRELVALGSMNLCASVLGALPAFGGYGRSKINSFSGAQTVMSGVCMGVIVLLTVKFFLSQ 444

Query: 552 VSFIPICIVGSLIFXXXXXXXXXXXXDTRGKVTNFEY---ITIVIIVLTMGIYDFVLGVI 608
           + +IP+CI+  +              D R    +  Y   +   + VLT   Y   +GV 
Sbjct: 445 IRYIPVCILSVITTIVGISLLEEAPADLRFHFNSRGYDELLVFAVTVLTTFFYSLEMGVC 504

Query: 609 VGILIACFSFLVDSTK--LQTI-----NGEF---DGKVARSTVNRDYVQSNFLNGVGEQI 658
           +G   +  S +  S K  +Q +      G+F   D  ++ +T   D      L G     
Sbjct: 505 IGCGYSVISIIKHSAKSRIQILARVESTGQFINSDEYLSSATHPDDLPNIEELEGC---- 560

Query: 659 YVLKLQNVLFFGTIISIEEKIDKLLEI------TDSKSSSKRR-IKYLILDFKNINADNI 711
            V+K+   L F  +  ++E++ +L           +K S +R  IKYL+ D   +    +
Sbjct: 561 LVVKIPEPLTFTNMEDLKERLTRLERFGSAIVHPGAKGSRERESIKYLVFDLNGMTF--M 618

Query: 712 DYSAAEGFNRIKRFTQTKRIKLIISSIKERDHIYNVFSNVGLLDDVE 758
           D SAA+    I +    +R+K+ ++ +   + + +      +L+ VE
Sbjct: 619 DSSAAQIMLEIVKSYNRRRVKVFLARVPLDEQVRSRLETSNILNYVE 665

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 101/493 (20%), Positives = 193/493 (39%), Gaps = 49/493 (9%)

Query: 303 VTGITFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKI------EYT 356
           V+G      G  R G +     + +L G I  VG  ++I  L    +L K        Y 
Sbjct: 200 VSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDKFLVSLPQHYH 259

Query: 357 WEFLKKLFL----------DTDIL--WKWLLPVVLTILLVNTQKCFQNSLVLPSFYIVTL 404
             F K LFL           T I     +++ +V+ +L     K  ++++  P       
Sbjct: 260 TPFEKVLFLIDYAPAQYHKPTAIFSGCCFIILIVMRLLKKKLMKRHKSAVFFPD------ 313

Query: 405 ILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRWFDHYKLFDWHKVHWNLVLAQIPTMLA 464
           IL   +V I+ S+ L   +  G       S D  FD  K    H     L+       L 
Sbjct: 314 ILLVVIVTILISMKLSLKQRYGISIVGDFSMDN-FDKLKNPLTHS-RRKLMPDLFSASLI 371

Query: 465 LTFFGILHVPINVPALAISLHMDKFDVDKELIAHGYSNFISGMVGSIQNYLVYTNSVLFI 524
           +   G         +L  + ++     ++EL+A G  N    + G++ ++  Y  S +  
Sbjct: 372 VAMLGFFESTTASKSLGTTYNL-TVSSNRELVALGCINMFISLFGALPSFGGYGRSKINA 430

Query: 525 RAGADSPFAGYMLAILTFAVMVIGPVIVSFIPICIVGSLIFXXXXXXXXXXXXDTRGKVT 584
            +GA S  +G  + I+T   M +    V +IP C++  +              D +  + 
Sbjct: 431 LSGAQSVMSGVFVGIITLITMKLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIKFHLQ 490

Query: 585 NFEYITIVIIVLTMGI---YDFVLGVIVGILIACFSFLVDSTKLQ-TINGEFDGKVARST 640
              Y  + +  +T G+   Y    G+ +G + +  + +  S K +  I     G    + 
Sbjct: 491 CGGYSELFVFAVTFGVTIFYSIESGICIGCVYSILNIIKHSAKSRIQILARIAGTSNFTN 550

Query: 641 VNRDYVQSNFLN-----GVGEQI---YVLKLQNVLFFGTIISIEEKIDKLLEITDSKSSS 692
           ++ DY+++   N     G  E+I    ++++   L F     +++++D++     SK   
Sbjct: 551 LD-DYLRTTKKNPPAVEGRIEEIEGCMIVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHP 609

Query: 693 KRR-------IKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISSIKERDHIY 745
            R+       IKY+I D   + +  ID SAA+  + I    + + + + ++++   D I 
Sbjct: 610 GRKSFRSKDSIKYVIFDLGGMTS--IDSSAAQVLDEIISCYKRRNVFIYLANVSINDKIR 667

Query: 746 NVFSNVGLLDDVE 758
                 G+  +VE
Sbjct: 668 TRLLKAGVTPNVE 680

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 109/498 (21%), Positives = 197/498 (39%), Gaps = 92/498 (18%)

Query: 325 RHILIGCIGGVGYFLLITGLGVTTRLAKI------EYTWEFLKKLFL----------DTD 368
           R +L G I GVG  ++IT L V  +L  +       Y   F K LF+           T 
Sbjct: 201 RALLRGFISGVGVIMVITSLVVELKLNHVTPTRQEHYHSPFEKVLFIMKYGPENYHKPTA 260

Query: 369 ILWKWLLPVVLTILLVNTQ--KCFQNSLVLPS-FYIVTLILF---------HFVVAIVPS 416
           IL      +++++ +   +  K F+  ++LP    +V L +F          + + I+  
Sbjct: 261 ILSLVAFVILMSLRIFKKRYGKKFKWLVLLPDILVVVALSIFVSYKMHLKSRYGIEIIND 320

Query: 417 ISLDQLRDLGWIFP---AATSKDRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHV 473
           I  D ++ L   F     AT KD       LF               T   +   G    
Sbjct: 321 IPKDSMKHLKNPFSNVNVATFKD-------LFS--------------TGFMVAMLGFFES 359

Query: 474 PINVPALAISLHMDKFDVDKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFA 533
                +L  S ++     ++ELIA G  N +  M   +  +  Y  S +   +GA +  +
Sbjct: 360 ATASKSLGTSYNL-AISSNRELIALGSMNVVGSMFAILPAFGGYGRSKINAYSGAQTTMS 418

Query: 534 GYMLAILT-FAVMVIGPVIVSFIPICIVGSLIFXXXXXXXXXXXXDTR--GKVTNFEYIT 590
           G+ + ++T F +  + P+I  +IP+CI+  +              D +   +   +  +T
Sbjct: 419 GFFMGLVTLFTIQFLLPII-RYIPVCILSVITTVVGLTLLEEAPHDLKFHWRCKGYSELT 477

Query: 591 IVIIVLTMGI-YDFVLGVIVGILIACFSFLVDSTKLQ-TINGEFDGKVARSTVNRDYVQS 648
           +  + L   + Y    G+ +G   +  + +  S K +  I G   G    + +N D  Q+
Sbjct: 478 VFTVTLLATLFYSLEAGIYIGCACSIINVIKHSAKSRIQILGRVPG--TETFINADDYQA 535

Query: 649 N----FLNGVGEQI---YVLKLQNVLFFGTIISIEEKIDKLLE----ITDSKSSSKRR-- 695
           N    F+N   E+I    ++K+   L F     ++ ++ +L +    +T   +   RR  
Sbjct: 536 NAAGYFINPQIEEIEGFLIVKIAEPLTFTNADDLKMRLHRLEKHGSAVTHPAAPRSRRKE 595

Query: 696 -IKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISSIKERD-HIYNVFSNVGL 753
             + +I D K +   +ID SAA+                I+S+   RD H++   +NV L
Sbjct: 596 MTENVIFDMKGMT--HIDSSAAQTLEE------------ILSAYNRRDVHVF--LTNVPL 639

Query: 754 LDDVELFNDLNGALEWCE 771
            + V      +G  E CE
Sbjct: 640 TEKVRERLVTSGVAELCE 657

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 104/521 (19%), Positives = 201/521 (38%), Gaps = 79/521 (15%)

Query: 301 SVVTGITFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKI------E 354
           ++++G    + G  RLG +     + +L G IG VG+ ++I  L    +L  I       
Sbjct: 213 TLISGTILLISGIFRLGYLGNILNKALLHGFIGSVGFVMIIDSLINELKLGDILADTPEH 272

Query: 355 YTWEFLKKLFLDTDILWKWLLPVVLTILLVNTQ----KCFQNSLV--------LPSFYIV 402
           Y   FLK +FL       + +P  L   +        + F+  L+        +P   IV
Sbjct: 273 YNTPFLKIVFLWKYAFQNFHVPTTLISFISIIILLIVRAFKKVLMHRHRWLIFIPEILIV 332

Query: 403 --TLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRWFDHYKLFDWHK--VHWNLVLAQ 458
             T+++  + +    +  +D L D         S +    H  L + ++  +H   V+  
Sbjct: 333 LTTVLILSYKLDFADTYDIDILGDF-------KSNENSIFHNPLSNKNRGLIH---VVFN 382

Query: 459 IPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAHGYSNFISGMVGSIQNYLVYT 518
           I  + A+  FG         AL  S        ++EL+A G SN +   +G++ ++  Y 
Sbjct: 383 IGIITAI--FGFFESTTASKALGASSER-SVSSNRELVALGLSNIVISTLGALPSFGGYG 439

Query: 519 NSVLFIRAGADSPFAGYMLAILT-FAVMVIGPVIVSFIPICIVGSLI----FXXXXXXXX 573
            S +   +G  +  +G  + + T  A++ + PVI  +IP+CI+  +     F        
Sbjct: 440 RSKINALSGGKTLLSGVFMGLTTILAILFLMPVI-HYIPVCILSVITTVIGFTLLEEIPK 498

Query: 574 XXXXDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIACFSFLVDSTK--------- 624
                 R +  N E   IV+  +T   Y     + +G + +  + +  S K         
Sbjct: 499 EVSFHWRCRGYN-ELFLIVLTFMTSIFYSVETSMYIGCVYSILNIIKHSAKSRIQIYTDA 557

Query: 625 --LQTINGE--------FDGKVARSTVNRDYVQSNFLNGV---------GEQIYVLKLQN 665
             + +I+                +ST + DY   +  N            EQ  ++K+  
Sbjct: 558 PLITSISNPPSIDNSNINSNNNIKSTRSSDYRPESRRNSADECFRCSLTNEQTLIVKIPE 617

Query: 666 VLFFGTIISIEEKIDKLLEITDSKSSSKR-------RIKYLILDFKNINADNIDYSAAEG 718
            L F     ++EK+++   +    +   +       + KY+I D + +    +D SA E 
Sbjct: 618 PLTFTNCEDLKEKLNRFERLGTHTAHPGKILKDTLFQPKYIIFDLQGMTL--MDSSATEI 675

Query: 719 FNRIKRFTQTKRIKLIISSIKERDHIYNVFSNVGLLDDVEL 759
              I    +     +   ++  R++I N     G++D +EL
Sbjct: 676 LKEIVLSYRRSGSHIFFVNVSFRENIRNRIQASGIIDLIEL 716

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 117/599 (19%), Positives = 228/599 (38%), Gaps = 76/599 (12%)

Query: 265 IEVTPFFHTMAFAIRDAIPGQDD----------------DIITTTIFCYAISSVVTGITF 308
           + VTPF + +  ++   I G +                 D+   T+    + S ++G+T 
Sbjct: 123 LAVTPFIYALFGSVPHMIVGPESAISLVVGQAVETLTSHDLSLETVDIATMISFMSGLTL 182

Query: 309 YLLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKI------EYTWEFLKK 362
              G  RLG +     + +L G I  +G+ +++  L    +L K+       Y   F K 
Sbjct: 183 LFGGIFRLGFLGNILSKALLRGFISSIGFVMIVNSLITELKLNKLMLTIPEHYHTPFEKI 242

Query: 363 LFLDTDILWKWLLPVVLTILLVNTQ----KCFQNSLVLPSFYIVTLILFHFVVAIVPSIS 418
           LFL       + LP     L V T     + F+  ++    +IV   +   +  ++ SI 
Sbjct: 243 LFLVRYGPSNYHLPTSFLSLAVFTTLMTIRIFKKKMMRRIKWIV--FIPEILSVVIFSIV 300

Query: 419 LDQLRDLGWIFPAATSKDRWFDHYKLF--DWHKVHWNLVLAQIPTMLALTFFGILHVPIN 476
           L  + DL   +  +   D   D +  F     K +  L+ A     L     G L     
Sbjct: 301 LSYMCDLKKKYDISVIGDFNTDGFDDFRNPLSKCNRGLIPALRDVSLVSALLGFLE---- 356

Query: 477 VPALAISLHMDKF-----DVDKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSP 531
             ++  S  +  +       ++EL+A G  N I    G I  +  Y  S +   +GA + 
Sbjct: 357 --SITASKSLGGYGNTVASSNRELVALGLMNTIGSAFGIIPAFGGYGRSKINAFSGAQTV 414

Query: 532 FAG-YMLAILTFAVMVIGPVIVSFIPICIVGSLIFXXXXXXXXXXXXDTRGKVTNFEYIT 590
            AG +M ++  F +  + PVI  +IP C++  +              D +  +    Y  
Sbjct: 415 MAGVFMGSVTLFTIKFLLPVI-HYIPTCVLSVITTFVGVSLLEEAPHDIKFHIRCKGYDE 473

Query: 591 IVIIVLTM---GIYDFVLGVIVGILIACFSFLVDSTKLQ-TINGEFDGKVARSTVNRDYV 646
           +++ VLT      Y    G++ G   +  S +  S + +  I    +G       N +Y+
Sbjct: 474 LIMFVLTFLCTCFYSIEFGILAGCTYSLISIVKHSAQSRIQILARVEGTDHFINAN-EYL 532

Query: 647 QSNFLNGVG--------EQIYVLKLQNVLFFGTIISIEEKIDKLLEITDS------KSSS 692
           Q +  +           E   V+K+   L F     ++E++D+L     +      KS  
Sbjct: 533 QLDLDSDNCSAPDIEHFEGCLVVKIPEPLTFTNTEDLKERLDRLERFGSTKAHPGMKSEG 592

Query: 693 KRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISSIKERDHIYNVFSNVG 752
              I+Y+I D   +    +D SA +    I    + + + + ++ +     +       G
Sbjct: 593 GSSIEYIIFDLHGMTF--MDSSATQILKDIVVEYRKRDVVVFLARVPPNLEVRERLKESG 650

Query: 753 LLDDV---ELFNDLNGALEWCENEFLGEYK---------KLRDRAREKMQHSYNVTSAI 799
           + D V   E+    N +L+  +  +              K R R+++ ++ S +++S++
Sbjct: 651 INDLVQKQEVKQHSNHSLQSAQTPYFPNIAEALSMVDNLKARTRSQQILRTSPSISSSM 709

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 109/565 (19%), Positives = 223/565 (39%), Gaps = 78/565 (13%)

Query: 249 YSGGLSSFTSGIGSEMIEVTPFFHTMAFAIRDAIPGQDDDIITT---------------- 292
           Y+  L+      G   + +TPF + +  ++   I G +  I                   
Sbjct: 116 YATSLAHVEPLCGLYSLAITPFVYCVFGSVPQMIVGPESAISLVVGQAVEKLVTHNEKVG 175

Query: 293 TIFCYAISSVVTGITFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFL----LITGLGVTT 348
           TI    + + ++G    + G  RLG +     R +L G I  VG  +    LIT L +T 
Sbjct: 176 TINISVVVTFLSGAILLIFGITRLGFLGNILSRALLRGFISSVGLVMVINSLITELKLTK 235

Query: 349 RLAKI--EYTWEFLKKLFL----------DTDIL--WKWLLPVVLTILLVNTQKCFQNSL 394
            LA +   Y   F K  FL           T IL    +++ + L  L     K +++ +
Sbjct: 236 LLATVPEHYHTPFEKVQFLFKYGPENLHKPTAILSLCSFIILMTLRFLKKKLMKRYKSVI 295

Query: 395 VLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRWFDHYKLFD-WHKVHWN 453
             P   I+ +++   ++++  + +L +  D+  +   +TS    FD  KL +   K + +
Sbjct: 296 FFPE--ILLIVISSLIISV--NFNLKKDFDISMLGDFSTS---GFD--KLNNPLGKDNRS 346

Query: 454 LVLAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAHGYSNFISGMVGSIQN 513
           L    +   L     G         +L  +++      ++EL+A G  N +  + G++ +
Sbjct: 347 LCHELLSVGLMCAILGFFESTTASKSLG-TIYDLTISSNRELVALGSMNLVGSLFGALPS 405

Query: 514 YLVYTNSVLFIRAGADSPFAGYMLAILT-FAVMVIGPVIVSFIPICIVGSLIFXXXXXXX 572
           +  Y  S +   +GA +  +G  + ++T F +  + PVI  + P+CI+  +         
Sbjct: 406 FGGYGRSKINALSGAQTVMSGACMGLITLFTIKFLLPVI-HYTPLCILSVITTVVGLSLL 464

Query: 573 XXXXXDTRGKVTNFEY---ITIVIIVLTMGIYDFVLGVIVGIL--------------IAC 615
                D R  +    Y   I   +I +T  I+    G+ VG +              I  
Sbjct: 465 EEAPSDIRFHIRCHGYNELIIFTLIFVTTIIHSVEAGISVGCIYSIGSIIKHSAQSRIQI 524

Query: 616 FSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIISI 675
            + ++ + +   ++G + G     T+  D  +S+ L  + +   ++K+   L F     +
Sbjct: 525 LTRVIGTNQFVPVDGYYPG---LKTI--DLRESSALEELDDSTLIVKIPEPLTFTNTEDL 579

Query: 676 EEKIDKLLEITDSKSSSKRR-------IKYLILDFKNINADNIDYSAAEGFNRIKRFTQT 728
           +E++++L      +    RR       IKY+I +   + +  +D SAA+    I +  + 
Sbjct: 580 KERLNRLERFRSVRIHPGRRPLHNRENIKYVIFELGGMTS--MDSSAAQILKEIIKTYKK 637

Query: 729 KRIKLIISSIKERDHIYNVFSNVGL 753
           + + +    +     I     + G+
Sbjct: 638 RSVNVYFCKVSSNLQIRTRLHDAGI 662

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 54/285 (18%), Positives = 116/285 (40%), Gaps = 20/285 (7%)

Query: 492 DKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVI 551
           ++EL+A G  N  S ++GS+  +  Y  S +   +GA +  +G  + +L    +     +
Sbjct: 393 NRELVALGSMNLFSSILGSLPAFGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLLPM 452

Query: 552 VSFIPICIVGSLIFXXXXXXXXXXXXDTRGKVTNFEY---ITIVIIVLTMGIYDFVLGVI 608
           + +IPIC++  +              D       F Y   +   + VLT   Y   +G+ 
Sbjct: 453 IHYIPICVLSVVTTMVGISLLEEAPADLMFHFRCFGYDELLVFTLTVLTTMFYSVEVGIC 512

Query: 609 VGILIACFSFLVDSTK-----LQTINGE---FDGKVARSTVNRDYVQSNFLNGVGEQIYV 660
           +G   +  S +  S K     L  + G     +        NR++   N      E   +
Sbjct: 513 IGCGYSVISIIKHSAKSRIQILARVQGTSRFVNSDDYLKQTNREHANENLELEELEGCLI 572

Query: 661 LKLQNVLFFGTIISIEEKIDKLLEITDSK-------SSSKRRIKYLILDFKNINADNIDY 713
           +K+   L F     ++E++++L +   ++         S+   +Y+I+D   +   ++D 
Sbjct: 573 VKIPEPLTFTNTEDLKERLNRLEKFGSTRVHPGARGRRSRSSTRYVIIDLHGMT--HMDS 630

Query: 714 SAAEGFNRIKRFTQTKRIKLIISSIKERDHIYNVFSNVGLLDDVE 758
           SAA+    I    + + +++ ++ +     +       G++D VE
Sbjct: 631 SAAQILLEIVSSYRKRDVRVFLARVTIDARVRERLEKSGVVDLVE 675

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/271 (20%), Positives = 105/271 (38%), Gaps = 48/271 (17%)

Query: 487 DKFDVD----KELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTF 542
           +KFD+D    +EL++ G  N +S +  ++  +  Y  S L I   A +P AG ++++   
Sbjct: 341 EKFDIDISSNRELVSLGLINVVSSVFSALPAFGGYGRSKLNILCSAQTPMAGIVVSVAAI 400

Query: 543 AVMVIGPVIVSFIPICIVGSLIFXXXXXXXXXXXXDT--RGKVTNF-EYITIVIIVLTMG 599
             M        ++P+C++  +I             D      V  + E +T V +V+T  
Sbjct: 401 FCMNYMMGAFHYLPLCVLAVIISYIAYNLLEEIPSDLFFYWSVGGYQELLTFVAVVVTTL 460

Query: 600 IYDFVLGVIVGILIACFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQ-- 657
           ++    GV +G+ +     L  +T+ +              + RD V   F N   EQ  
Sbjct: 461 VWSPQFGVSIGVGLTMIRLLKHTTQSRV-----------QILGRDPVTKKFQNIYAEQSE 509

Query: 658 ---------IYVLKLQNVLFFGTIISIEEKIDKLLEITDSK-----------------SS 691
                      V+K+   L F  +  +++++ +L +    K                 S 
Sbjct: 510 QIPLEEIEKTMVIKIPEPLIFSNVSDLKKRLSRLEKYGSLKVHPSYPTPLRPVSASAGSQ 569

Query: 692 SKRRIKYLILDFKNINADNIDYSAAEGFNRI 722
           S+  I Y+I D   +    ID SA +    +
Sbjct: 570 SESYISYVIFDL--LGMTYIDMSALQALTEM 598

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 105/521 (20%), Positives = 193/521 (37%), Gaps = 71/521 (13%)

Query: 283 PGQDDDIITTTIFCYAISSVVTGITFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLLIT 342
           P  + D   +TI    + + ++G     LG  RLG +     R +L G I  VG+ ++I 
Sbjct: 145 PMVNHDERISTISISIVVTFISGSFLLFLGIFRLGFLGNILSRALLRGFICSVGFVMIIN 204

Query: 343 GLGVTTRLAKI------EYTWEFLKKLFL----------DTDI--LWKWLLPVVLTILLV 384
            L    +L K+       Y   F K LFL           T I  L+ +++ +++ ++  
Sbjct: 205 SLISELKLDKVLATSPEHYHTPFEKILFLIKYGQHNYHAPTAILSLYSFIILMLMKVMKK 264

Query: 385 NTQKCFQNSLVLPSFYIVTL--ILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRWFD-- 440
              K F+  + +P   IV +  I+F F   I     +  + D          K   FD  
Sbjct: 265 RLMKRFKWVIFVPEILIVIVGTIMFSFHFDIKHKFDISIIGDF---------KVNGFDSL 315

Query: 441 HYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAHGY 500
           H  L    K +  L+   +   +     G         AL  +  +     ++EL+A G 
Sbjct: 316 HNPL---DKTNRLLLKPLLDAGIVCAVLGFFESTTASKALGTTYDL-TVSSNRELVALGS 371

Query: 501 SNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILT-FAVMVIGPVIVSFIPICI 559
            N +  + G++  +  Y  S +   +G  +  +G  L  +T F +    PV+ +  P C+
Sbjct: 372 MNIVGSLFGALPAFGGYGRSKINALSGGQTVMSGVCLGSVTLFTIKFFLPVVHN-TPTCV 430

Query: 560 VGSLIFXXXXXXXXXXXXDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIACFSFL 619
           +  +              D +    +  Y  ++++ LT  I      V VGI + C   +
Sbjct: 431 LSVVTSVVGLTLLEEAPTDLKFYFQSHGYNELIVLGLTF-ITTIFYSVEVGICVGCCYSI 489

Query: 620 VD------STKLQTIN--------------GEFDGKVARSTVNRDYVQSNFLNGVGEQIY 659
           +        +++Q +               G FDG+   +    +      L  + E   
Sbjct: 490 ISIIKHSAQSRIQILAKRKGDNRFSNADELGIFDGENNNNNTFFE----PLLEDLDEDRL 545

Query: 660 VLKLQNVLFFGTIISIEEKIDKLLEITDSKSSSKRR-------IKYLILDFKNINADNID 712
           V+K+   L F     ++E++ +L      +    RR        KY+I D   +    ID
Sbjct: 546 VVKIPEPLTFTNTEDLKERLSRLERFGSVRVHPGRRDLRSRDKTKYIIFDLHGMTY--ID 603

Query: 713 YSAAEGFNRIKRFTQTKRIKLIISSIKERDHIYNVFSNVGL 753
            SAA+    I      +++ +    +  R  +   F   GL
Sbjct: 604 ASAAQILLEIILAYNRRQVFVFFVRVPMRREVRQRFERSGL 644

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 63/307 (20%), Positives = 123/307 (40%), Gaps = 35/307 (11%)

Query: 492 DKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVI 551
           ++EL+A G  N +  + G++ ++  Y  S +   +GA +  +G  + ++T          
Sbjct: 388 NRELVALGSLNLVGSLFGALPSFGGYGRSKINAYSGAATVMSGVFMGLITLITSKFLLNA 447

Query: 552 VSFIPICIVGSLIFXXXXXXXXXXXXDT----RGKVTNFEYITIVIIVLTMGIYDFVLGV 607
           +  IPIC++  +              D     R +  N E +T  I VLT     F   V
Sbjct: 448 IRHIPICVLSVITTMVGISLFEEAPADLKFHFRCRGYN-ELLTFAITVLT----TFFYSV 502

Query: 608 IVGILIACFSFLVDSTKLQTING-EFDGKVARST--VNRD--YVQSNFLNGVG------E 656
             GI + C   ++ + K  T +G +  G+++ +   VN D  Y  S+  +  G      E
Sbjct: 503 EAGITLGCGYSIIRAIKNSTQSGIQILGRISGTNRFVNADEFYSASSLDSEFGPRLDHME 562

Query: 657 QIYVLKLQNVLFFGTIISIEEKIDKL-------LEITDSKSSSKRRIKYLILDFKNINAD 709
              V ++   L F     ++ ++++L             +S  K   + +I D + +   
Sbjct: 563 GCLVARIAEPLTFTNTEDLKSRLNRLENHGSVKTHPASPRSRDKDLTRNMIFDLEGMT-- 620

Query: 710 NIDYSAAEGFNRIKRFTQTKRIKLIISSIKERDHIYNVFSNVGLLDDVELFNDLNGAL-- 767
            ID SA++    I +    +++++ ++ +    H+       G+   VE    LN A   
Sbjct: 621 QIDSSASQILCEIVKSLTKRKVRVYLARVPRALHVRERLVASGVAGMVENNIPLNTASMG 680

Query: 768 ----EWC 770
                WC
Sbjct: 681 QPGDSWC 687

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 123/291 (42%), Gaps = 31/291 (10%)

Query: 489 FDVD----KELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAV 544
           FD+D    +EL++ G  N +  +  S+  +  Y  S L I  GA +P AG  +++     
Sbjct: 343 FDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSKLNIFCGAQTPMAGIFVSLSAIFC 402

Query: 545 MVIGPVIVSFIPICIVGSLIFXXXXXXXXXXXXDT--RGKVTNF-EYITIVIIVLTMGIY 601
           M     +  ++P+CI+  +I             D      V+ + E IT   +VL+  I+
Sbjct: 403 MRFLMGVFHYLPLCILAVIISFIAYNLLEEVPGDMFFYWSVSGYQELITFSAVVLSTLIW 462

Query: 602 DFVLGVIVGILIACFSFLVDST--KLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIY 659
               G+++G+ +     L  +T  ++Q +  +   K  R+ +  ++ +   L  + E+  
Sbjct: 463 SPQFGLVMGLGLTMIRLLKHTTQSRIQILGKDPITKKFRN-IYSEHNEEIPLEEI-EKTM 520

Query: 660 VLKLQNVLFFGTIISIEEKIDKL-----LEITDSKSSSKRR------------IKYLILD 702
           V+K+   L F  +  + +K+ +L     L +  S  +S R             +KY+I+D
Sbjct: 521 VIKVPEPLVFWNVPDLMKKVKRLEKYGSLYVHPSYPTSLRPVSGVTTLKDNVYVKYIIMD 580

Query: 703 FKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISSIKERDHIYNVFSNVGL 753
              +    ID SA +    +      + I +I      RD + N F   G+
Sbjct: 581 L--LGMTYIDMSALQALVDMVVNYHKRGIYVIFCRSSIRD-LKNKFDKSGI 628

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 53/253 (20%), Positives = 109/253 (43%), Gaps = 27/253 (10%)

Query: 492 DKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVI 551
           ++EL++ G  N +S +  ++  +  Y  S + I  GA + F+G  +++L  A++ +  ++
Sbjct: 272 NRELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLL--AIICMNFLM 329

Query: 552 VSF--IPICIVGSLIFXXXXXXXXXXXXDTR--GKVTNFEYITI-VIIVLTMGIYDFVLG 606
            +F  +PICI+  +I             D      V  ++ + I +IIV+T  ++    G
Sbjct: 330 NAFHHLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLVWSPQFG 389

Query: 607 VIVGILIACFSFLVDSTKLQT-INGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQN 665
           V +G+ +     L  ST+ +  I G          ++ D      L  + E++ V+K+  
Sbjct: 390 VTMGMCLTMIRLLKHSTRSRVQILGRDPITYTFKNIDDDENSDIPLEEI-EKVMVVKIPE 448

Query: 666 VLFFGTIISIEEKIDK----------------LLEITDSKSSSKRRIKYLILDFKNINAD 709
            L F  +  +   + +                L ++    +S +  +KYL++D   +   
Sbjct: 449 PLIFSNVSDLRTSLKRMEKYGSLKVHPSYPLPLRQMLSPTTSGQVSLKYLVIDLFGMT-- 506

Query: 710 NIDYSAAEGFNRI 722
            ID SA +    I
Sbjct: 507 YIDISALQALREI 519

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 102/501 (20%), Positives = 192/501 (38%), Gaps = 55/501 (10%)

Query: 299 ISSVVTGITFYLL---GKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKI-- 353
           IS+V+T ++  +L   G  R G +     + +L G I  VG  ++I  L    +L K   
Sbjct: 203 ISTVITFVSGTILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLV 262

Query: 354 ----EYTWEFLKKLFL----------DTDILWKWLLPVVLTILLVNTQ--KCFQNSLVLP 397
                Y   F K LFL           T I     L V+    L+  +  K  ++++  P
Sbjct: 263 SLPQHYHTPFEKILFLIDYAPAQYHIPTAIFSGCCLIVLFLTRLLKRKLMKYHKSAIFFP 322

Query: 398 SFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRWFDHYKLFDWHKVHWNLVLA 457
                  IL   +V I+ S+  +     G       S D  FD  K     +    L+  
Sbjct: 323 D------ILLVVIVTILISMKFNLKHRYGISIIGDFSMDN-FDELK-NPLTRPRRKLIPD 374

Query: 458 QIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAHGYSNFISGMVGSIQNYLVY 517
                L +   G         +L  + ++     ++EL+A G+ N +  + G++  +  Y
Sbjct: 375 LFSASLIVAMLGFFESTTASKSLGTTYNL-TVSSNRELVALGFMNIVISLFGALPAFGGY 433

Query: 518 TNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFIPICIVGSLIFXXXXXXXXXXXX 577
             S +   +GA S  +G  + ++T   M +    V +IP C++  +              
Sbjct: 434 GRSKINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGISLLEEVPG 493

Query: 578 DTRG--KVTNF-EYITIVIIVLTMGIYDFVLGVIVGILIACFSFLVDSTKLQTINGEFDG 634
           D +   +   F E     +   T   Y    G+ +G + +  + +  S K +    +   
Sbjct: 494 DIKFHLRCGGFSELFVFAVTFCTTIFYSIEAGICIGCVYSIINIIKHSAKSRI---QILA 550

Query: 635 KVARS---TVNRDY---VQSNFLNGVG----EQIYVLKLQNVLFFGTIISIEEKIDKLLE 684
           +VA +   T   DY   ++ N L+  G    E   ++++   L F     +++++D++  
Sbjct: 551 RVAGTSNFTNLDDYMMNMKRNSLDVEGTEEIEGCMIVRIPEPLTFTNSEDLKQRLDRIER 610

Query: 685 ITDSKSSSKRR-------IKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISS 737
              SK    R+       IKY+I D   + +  ID SAA+    I    + + + + + +
Sbjct: 611 YGSSKIHPGRKSLRSKDSIKYVIFDLGGMTS--IDSSAAQVLEEIITSYKRRNVFIYLVN 668

Query: 738 IKERDHIYNVFSNVGLLDDVE 758
           +   D +       G+   VE
Sbjct: 669 VSINDKVRRRLFKAGVAASVE 689

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score = 40.0 bits (92), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 57/283 (20%), Positives = 116/283 (40%), Gaps = 25/283 (8%)

Query: 492 DKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVI 551
           ++EL+A G  N I+ + G++ ++  Y  S +   +G+ +  +G  +  +T   +     +
Sbjct: 392 NRELVALGSMNVIASLFGALPSFGGYGRSKINAFSGSKTVMSGVFMGSVTLITIRYLLPL 451

Query: 552 VSFIPICIVGSL--IFXXXXXXXXXXXXDTRGKVTNF-EYITIVIIVLTMGIYDFVLGVI 608
           + +IP+CI+  +  I                 +   + E     I VL   +Y   +G+ 
Sbjct: 452 IHYIPLCILSVITSIVGISLLEEAPSELKFHFRCKGYDELFVFAITVLATLLYSVEMGIC 511

Query: 609 VGILIACFSFLVDSTKLQ-TINGEFDGKVARSTVNRD-YVQSNFLNGVGEQIYVL----- 661
           +G   +  S +  S K +  I G   G   R   N D Y+ S+ +  +    +VL     
Sbjct: 512 IGCGYSIISIVKHSAKSRIQILGRVQG--TREFANIDEYLDSDPIGDIETNKFVLEEIEG 569

Query: 662 ----KLQNVLFFGTIISIEEKIDKLLEITDSKS-------SSKRRIKYLILDFKNINADN 710
               K+   L F     ++E++++L      K+        SK   K +I D   + +  
Sbjct: 570 CLIVKIPEPLTFTNTDDLKERLNRLERFGSVKAHPGGPGGRSKDYTKCVIFDLHGMTS-- 627

Query: 711 IDYSAAEGFNRIKRFTQTKRIKLIISSIKERDHIYNVFSNVGL 753
           ID SA + F  I    + +++K+ ++ + +   I       G+
Sbjct: 628 IDSSATQIFFDIVATYKKRKVKVFLARVLQSKQIRERLEKSGV 670

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 105/551 (19%), Positives = 211/551 (38%), Gaps = 72/551 (13%)

Query: 299 ISSVVTGITFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKI----- 353
           I + ++G   +  G +R G +     R +L G I  VG  +++  L    +L K+     
Sbjct: 171 ILTFISGAILFCFGIMRFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLKKVFNDAP 230

Query: 354 -EYTWEFLKKLFLDTDILWKWLLPVVLTIL----------LVNTQ--KCFQNSLVLPSFY 400
             Y   F K +FL       + +P  L  L          LV  +  + ++  + +P   
Sbjct: 231 GHYHAPFQKLIFLFHYAPGNYHVPTALLSLSSFSILMSLRLVKKRLSRVYKKVIFVPEIL 290

Query: 401 IV----TLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRWFDHYKLFDWHKVHWNLVL 456
           IV    TL  +HF   +  +I +     +G I    TSK R           K + +L  
Sbjct: 291 IVVALVTLGSYHFSFKLRYNIDI-----VGDIEVGDTSKFRN-------PLSKKNLSLFS 338

Query: 457 AQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAHGYSNFISGMVGSIQNYLV 516
                   +   G         +L  S  +     ++EL+A G  N +  + G++ ++  
Sbjct: 339 ELFHAGFMVALLGFFESTTASKSLGSSYELS-VSSNRELVALGSLNLVGSIFGALPSFGG 397

Query: 517 YTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFIPICIVGSLIFXXXXXXXXXXX 576
           Y  S +   +GA +  +G  + ++T    +     +  IP+C++  +             
Sbjct: 398 YGRSKINAYSGAATVMSGVFMGLITCVTSMFLLNAIHHIPVCVLSVITTMVGITLFEEAP 457

Query: 577 XDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIAC----FSFLVDSTK-----LQT 627
            D R       Y  ++I  LT+ +  F   V  GI + C       + +STK     L+ 
Sbjct: 458 ADLRYHFRCRGYNELLIFALTV-LTTFFYSVEAGITLGCGYSVIRVIKNSTKSKIQILRR 516

Query: 628 INGE---FDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIISIEEKIDKLLE 684
           ++G     +     S+ N   V    L+ + E   ++K+   L F     ++ ++ +L +
Sbjct: 517 VSGTDQFVNADDFNSSTNTCVVIPPRLDDI-EGSLIVKIPERLTFMNTEDLKTRLYRLEK 575

Query: 685 I-------TDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISS 737
                      K  ++ + K++I D   +    ID SA++    I    + + +++ ++ 
Sbjct: 576 YGSVKTHPASPKPRNRNQTKHMIFDMNGMT--EIDSSASQILQEIVLSLRKRGVRVYLAR 633

Query: 738 IKERDHIYNVFSNVGLLDDVELFNDLNGAL-----EWCENEFLGEYKKLRDRAREKMQHS 792
           +     +       G+++ VE  +    A+     +WC       +K ++D  R  +   
Sbjct: 634 VPLIAGVRERLVASGVVEMVEKCDASVTAVDSAFDDWC-------FKNIQDALR--VSDE 684

Query: 793 YNVTSAIEAAA 803
            +V S +E A+
Sbjct: 685 MDVNSVVEVAS 695

>Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 88/421 (20%), Positives = 149/421 (35%), Gaps = 89/421 (21%)

Query: 280 DAIPGQDDDIITTTIFCYAISSVVTGITFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFL 339
           D  P     +I TT+      +++ GI    +G LRLG +V     + + G + G  + +
Sbjct: 214 DGDPAITGPVIATTL------ALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGSAFNI 267

Query: 340 L------ITGLG--VTTRLAKIEYTWEFLKKLFLDTDI-------------LWKWLLPVV 378
           L      + G    V TR A  +   E LK L  DT +             +WKW     
Sbjct: 268 LWGQVPALMGYNSLVNTRAATYKVVIETLKHL-PDTKLDAVFGLIPLFLLYVWKWWCGTY 326

Query: 379 LTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRW 438
             IL  N +   +N    P  + +    + +  A    + +     +GW      SK   
Sbjct: 327 GPIL--NDRYNSKN----PRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSE- 379

Query: 439 FDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVP--------INVPALAISLHMDKFD 490
                      +    +L  +P+   L   G+ HVP         N+PA  I L ++   
Sbjct: 380 ---------RPIS---ILGSVPS--GLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIA 425

Query: 491 V--------------DKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYM 536
           +              D+ELIA G SN +     +      ++ S L  +    +P +G  
Sbjct: 426 ISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLF 485

Query: 537 --------LAILTFAVMVIGPVIVSFIPICIVGSLIFXXXXXXXXXXXXDTRGKVTNFEY 588
                   L  LT A   I    +S + I  V  L+                 K+   ++
Sbjct: 486 SGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFW-------KMNPLDF 538

Query: 589 ITIVIIVLTMGIYDFVLGVIVGILIACFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQS 648
           I  ++ VL         G+   +  +C   L+   K+    G+F G+V  + V   Y+++
Sbjct: 539 ICFIVTVLITVFASIEDGIYFAMCWSCAMLLL---KMAFPAGKFLGRVEIAEVTDAYIKA 595

Query: 649 N 649
           N
Sbjct: 596 N 596

>Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 48/225 (21%), Positives = 84/225 (37%), Gaps = 42/225 (18%)

Query: 455 VLAQIPTMLALTFFGILHVPI--------NVPALAISLHMDKFDV--------------D 492
           +L  +P+   L   G+ HVP         N+PA  I L ++   +              D
Sbjct: 384 ILGSVPS--GLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRVNDYKVVPD 441

Query: 493 KELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYM--------LAILTFAV 544
           +ELIA G SN +     +      ++ S L  +    +P +G          L  LT A 
Sbjct: 442 QELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAF 501

Query: 545 MVIGPVIVSFIPICIVGSLIFXXXXXXXXXXXXDTRGKVTNFEYITIVIIVLTMGIYDFV 604
             I    +S + I  V  L+                 K+   ++I  ++ VL        
Sbjct: 502 FYIPKATLSAVIIHAVSDLLASYQTTWNFW-------KMNPLDFICFIVTVLITVFSSIE 554

Query: 605 LGVIVGILIACFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSN 649
            G+   +  +C  F++   K+    G+F G+V  + V   YV+++
Sbjct: 555 NGIYFAMCWSCAIFIL---KVAFPAGKFLGRVEIAEVTDAYVRAD 596

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 103,272,703
Number of extensions: 4543246
Number of successful extensions: 13893
Number of sequences better than 10.0: 60
Number of HSP's gapped: 14218
Number of HSP's successfully gapped: 76
Length of query: 1024
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 904
Effective length of database: 39,721,479
Effective search space: 35908217016
Effective search space used: 35908217016
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)