Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07964g6.13ON50550526280.0
SAKL0E00946g6.13ON49347920330.0
TDEL0G045806.13ON48446320170.0
KLTH0C11462g6.13ON49248120150.0
Kwal_56.223626.13ON49347719950.0
KLLA0D00902g6.13ON49249819920.0
ACR013C6.13ON48850419750.0
Ecym_30166.13ON48948319670.0
Kpol_1045.766.13ON48546319400.0
CAGL0A01045g6.13ON48346319340.0
YPL262W (FUM1)6.13ON48846019260.0
NCAS0D026206.13ON49350519260.0
Kpol_1032.46.13ON46745919200.0
Skud_16.166.13ON48846019110.0
Smik_6.4706.13ON48846019110.0
KAFR0B065206.13ON49550419090.0
Suva_16.436.13ON48846019080.0
TPHA0J002706.13ON49648818940.0
KNAG0E027506.13ON49846418920.0
TBLA0G010006.13ON46546317920.0
TBLA0A071306.13ON50050017950.0
NDAI0I024706.13ON47546117870.0
KLLA0A08404g1.354ON4612151492e-09
NDAI0G059401.354ON4622381482e-09
Kpol_1018.1251.354ON4602471411e-08
KNAG0I015601.354ON4622181411e-08
NCAS0A090101.354ON4622421374e-08
TDEL0D022201.354ON4652381374e-08
SAKL0D09746g1.354ON4642421374e-08
TPHA0A021901.354ON4632421366e-08
Suva_15.2011.354ON4632381357e-08
Smik_8.831.354ON4632381349e-08
AEL019W1.354ON4692161312e-07
CAGL0I08987g1.354ON4612801312e-07
Ecym_27491.354ON4702711303e-07
Skud_8.701.354ON4632381303e-07
TBLA0F034801.354ON4662671294e-07
KAFR0A009501.354ON4642631294e-07
YHR018C (ARG4)1.354ON4632381276e-07
ZYRO0G00748g1.354ON4622411269e-07
KLTH0G19338g1.354ON4652571124e-05
Skud_12.4434.197ON4821921125e-05
CAGL0B02794g4.197ON4821921109e-05
Kwal_27.127821.354ON4652521091e-04
Kwal_47.180664.197ON4821891081e-04
TPHA0B010404.197ON4821921072e-04
NDAI0J019504.197ON4821941072e-04
Kpol_1042.164.197ON4821921072e-04
Suva_10.4594.197ON4821921072e-04
YLR359W (ADE13)4.197ON4821921072e-04
NCAS0J012004.197ON4821921062e-04
Smik_12.4464.197ON4821921062e-04
KNAG0B058404.197ON4821921053e-04
Ecym_24524.197ON4822091044e-04
KAFR0A062304.197ON4821921028e-04
KLLA0B13189g4.197ON4821951010.001
SAKL0B04972g4.197ON4821921000.001
ZYRO0B07964g4.197ON4821861000.001
TBLA0A083204.197ON482192990.002
ABL006C4.197ON482192930.009
KLTH0A03344g4.197ON482192930.010
TDEL0E017604.197ON482192910.014
Kpol_1031.428.144ON35997704.8
SAKL0A01430g6.334ON302136696.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C07964g
         (505 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...  1016   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   787   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   781   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   780   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   773   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   771   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   765   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   762   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   751   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   749   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   746   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   746   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   744   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   740   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   740   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   739   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   739   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   734   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   733   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   694   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   696   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   692   0.0  
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    62   2e-09
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    62   2e-09
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    59   1e-08
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    59   1e-08
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    57   4e-08
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    57   4e-08
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    57   4e-08
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    57   6e-08
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    57   7e-08
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    56   9e-08
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    55   2e-07
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    55   2e-07
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    55   3e-07
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    55   3e-07
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    54   4e-07
KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.3...    54   4e-07
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    54   6e-07
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    53   9e-07
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    48   4e-05
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    48   5e-05
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    47   9e-05
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    47   1e-04
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    46   1e-04
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    46   2e-04
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    46   2e-04
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    46   2e-04
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    46   2e-04
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    46   2e-04
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    45   2e-04
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    45   2e-04
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    45   3e-04
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    45   4e-04
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    44   8e-04
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    44   0.001
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    43   0.001
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    43   0.001
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    43   0.002
ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON} S...    40   0.009
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    40   0.010
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    40   0.014
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    32   4.8  
SAKL0A01430g Chr1 complement(136728..137636) [909 bp, 302 aa] {O...    31   6.0  

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 505

 Score = 1016 bits (2628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/505 (97%), Positives = 493/505 (97%)

Query: 1   MLRLSSNVLKNSCVCQVSSPRLTSKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPADK 60
           MLRLSSNVLKNSCVCQVSSPRLTSKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPADK
Sbjct: 1   MLRLSSNVLKNSCVCQVSSPRLTSKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPADK 60

Query: 61  YWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAAD 120
           YWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAAD
Sbjct: 61  YWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAAD 120

Query: 121 EVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQS 180
           EVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQS
Sbjct: 121 EVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQS 180

Query: 181 SNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQ 240
           SNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQ
Sbjct: 181 SNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQ 240

Query: 241 EFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ 300
           EFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ
Sbjct: 241 EFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ 300

Query: 301 TAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSS 360
           TAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSS
Sbjct: 301 TAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSS 360

Query: 361 IMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKPVMXXXXXXXXXXXXDA 420
           IMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKPVM            DA
Sbjct: 361 IMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKPVMISNLLSSINLLSDA 420

Query: 421 SYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESA 480
           SYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESA
Sbjct: 421 SYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESA 480

Query: 481 LQLNILTAEEFDHWVVPEHMIGPKP 505
           LQLNILTAEEFDHWVVPEHMIGPKP
Sbjct: 481 LQLNILTAEEFDHWVVPEHMIGPKP 505

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 493

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/479 (78%), Positives = 416/479 (86%), Gaps = 1/479 (0%)

Query: 27  PMSQISQLHTTTPWLQE-HRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEA 85
           P S I  L T++   Q+ +R+ETDAFGEIKVPADKYWGAQTQRSFENF+IGG RERMPEA
Sbjct: 14  PSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEA 73

Query: 86  VVHAFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSN 145
           VV AFG+LKK+ A VNE+ G LDP+++  I++AADEV  GKL DHFPLVVFQTGSGTQSN
Sbjct: 74  VVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSN 133

Query: 146 MNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNL 205
           MNANEVISNRAIE++GG+ GSK VHPNNH N +QSSNDTFP+VMHIAAV  IT  LLP L
Sbjct: 134 MNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPEL 193

Query: 206 TALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKL 265
           TAL+DS QKKS+EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RVE +L  LK 
Sbjct: 194 TALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKF 253

Query: 266 LAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTL 325
           LAQGGTAVGTGLNTK+G+AE +A +V+KETGIDF+TAPNKFEALAAHDAVVE SGALNTL
Sbjct: 254 LAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTL 313

Query: 326 AVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNH 385
           A SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQV GN+
Sbjct: 314 ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN 373

Query: 386 SAITFAGASGQFELNVFKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHE 445
           +AITFAGASGQFELNVFKPVM            DASYSFRVHCVDGI+AN + I+KLLHE
Sbjct: 374 AAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHE 433

Query: 446 SLMLVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPK 504
           SLMLVTALNPKIGYDAASKVAKNAHK GITLKESALQL +L  +EFD WV+PE MIGPK
Sbjct: 434 SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 492

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
           Anc_6.13 YPL262W
          Length = 484

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/463 (80%), Positives = 407/463 (87%)

Query: 43  EHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNE 102
           + RVETDAFGEIKV AD+YWGAQTQRS ENFRIGG RERMPE +V AFG+LKK+ A VNE
Sbjct: 22  QFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNE 81

Query: 103 ANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGG 162
           + G LDPK+A  IKQAADEVA GKL  HFPLVVFQTGSGTQSNMNANEVISNRAIEL+GG
Sbjct: 82  SLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGG 141

Query: 163 KLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADI 222
           +LGSK +HPNNH N +QSSNDTFP+VMHIAAV  IT+ LLP L  L+DSL  KS+EF+DI
Sbjct: 142 ELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDI 201

Query: 223 VKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIG 282
           VKIGRTHLQDATPLTLGQEFSGYVQQV+NGI RVE +L  LK LAQGGTAVGTGLNTKIG
Sbjct: 202 VKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIG 261

Query: 283 WAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSG 342
           +AE +A +V+KETG+DF+TAPNKFEALAAHDAVVEASGALNT+A SLFKIAQDIRYLGSG
Sbjct: 262 FAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSG 321

Query: 343 PRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVF 402
           PRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQV GN++AITFAGASGQFELNVF
Sbjct: 322 PRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVF 381

Query: 403 KPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAA 462
           KPVM            DASYSFRVHCVDGI ANR+ I KL+HESLMLVTALNPKIGYDAA
Sbjct: 382 KPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAA 441

Query: 463 SKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPKP 505
           SKVAKNAHK GITLK+SAL L +LT  EFD WVVPE+MIGPKP
Sbjct: 442 SKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPKP 484

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 492

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/481 (77%), Positives = 416/481 (86%), Gaps = 2/481 (0%)

Query: 24  SKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMP 83
           S +P +++  + T++   Q+ RVETDAFGEI VPADKYWGAQTQRS ENF+IGG RERMP
Sbjct: 14  SGSPKTRL--ISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMP 71

Query: 84  EAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQ 143
           E VV AFGILKK+ A VNE+ G LDPK++  I+QAADEV SGKL DHFPLVVFQTGSGTQ
Sbjct: 72  EPVVRAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQ 131

Query: 144 SNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLP 203
           SNMNANEVISNRAIE++GGK+G+KS+HPNNH N +QSSNDTFP+VMHIAAV  IT  LLP
Sbjct: 132 SNMNANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLP 191

Query: 204 NLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSL 263
            LTAL+DS   KS+EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RVE +L  L
Sbjct: 192 ELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHL 251

Query: 264 KLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALN 323
           K LAQGGTAVGTGLNTK+G+ E +A +V+KETGIDF+TAPNKFEALAAHDA+VE SGALN
Sbjct: 252 KFLAQGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALN 311

Query: 324 TLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFG 383
           TLA SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQV G
Sbjct: 312 TLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371

Query: 384 NHSAITFAGASGQFELNVFKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLL 443
           N++AITFAGASGQFELNVFKPVM            DA YSFRVHCVDGI+ANR+ IAKLL
Sbjct: 372 NNAAITFAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLL 431

Query: 444 HESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGP 503
           HESLMLVTALNPKIGYDAASKVAKNAHK GITLKESAL+L +LT+ EFD WVVPE+M+GP
Sbjct: 432 HESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGP 491

Query: 504 K 504
           K
Sbjct: 492 K 492

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
           (FUM1) - mitochondrial and cytoplasmic fumarase
           (fumarate hydralase) [contig 186] FULL
          Length = 493

 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/477 (77%), Positives = 414/477 (86%)

Query: 29  SQISQLHTTTPWLQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVH 88
           S+   + T++   Q++RVETDAFGEIKVP DK WGAQTQRS ENF+IGGQRERMPE +V 
Sbjct: 17  SKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVK 76

Query: 89  AFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNA 148
           AFGILKK+ A VNE+ G LDPK++  I+ AADEV SGKL DHFPLVVFQTGSGTQSNMNA
Sbjct: 77  AFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNA 136

Query: 149 NEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTAL 208
           NEVISNRAI+L+GG++GSKS+HPNNH N +QSSNDTFP+VMHIAAV  +T  LLP L AL
Sbjct: 137 NEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIAL 196

Query: 209 KDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQ 268
           +D+  KK++EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RVE +L +LK LAQ
Sbjct: 197 RDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQ 256

Query: 269 GGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVS 328
           GGTAVGTGLNTK+G+AE +A +V+KETGIDF+TAPNKFEALAAHDAVVE SGALNTLA S
Sbjct: 257 GGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACS 316

Query: 329 LFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAI 388
           LFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQV GN++AI
Sbjct: 317 LFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAI 376

Query: 389 TFAGASGQFELNVFKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLM 448
           TFAGASGQFELNVFKPVM            DA YSFRVHCV+GIQAN + IAKLLHESLM
Sbjct: 377 TFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLM 436

Query: 449 LVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPKP 505
           LVTALNPKIGYDAASKVAKNAHK GITLKESAL+L +L++ EFD WVVPE+M+GPKP
Sbjct: 437 LVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPKP 493

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 492

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/498 (75%), Positives = 428/498 (85%), Gaps = 8/498 (1%)

Query: 8   VLKNSCVCQ-VSSPRLTSKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPADKYWGAQT 66
           +L+NS V + ++  R+++K  +++++ L   +     +RVETDAFGEI+VP+DKYWGAQT
Sbjct: 1   MLRNSIVSRGLAQTRVSAK--VNRLASLRMVS-----YRVETDAFGEIQVPSDKYWGAQT 53

Query: 67  QRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGK 126
           QRS +NF+IGG RERMPE +V AFG+LKK+ A VNE  G LDP++A  IKQAADEVA GK
Sbjct: 54  QRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGK 113

Query: 127 LKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFP 186
           L +HFPLVVFQTGSGTQSNMNANEVISNRAIEL+GG+LGSK +HPNNH N +QSSNDTFP
Sbjct: 114 LMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFP 173

Query: 187 TVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYV 246
           +VMHIAAV  IT  LLP L  LK +L++KS+EF  IVKIGRTHLQDATPLTLGQEFSGYV
Sbjct: 174 SVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYV 233

Query: 247 QQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKF 306
           QQV NGI RV+ +L  LK LAQGGTAVGTGLNTK+G+AE++A +V+KETGIDF+TAPNKF
Sbjct: 234 QQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKF 293

Query: 307 EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 366
           EALAAHDAVVEASGALNTLAVSLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKV
Sbjct: 294 EALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 353

Query: 367 NPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKPVMXXXXXXXXXXXXDASYSFRV 426
           NPTQNEA+TQVCVQV GNH+AITFAGASGQFELNVFKPVM            DAS SFR+
Sbjct: 354 NPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRI 413

Query: 427 HCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNIL 486
           HCV+GI+AN + IAKLLHESLMLVTALNPKIGYDAASKVAKNAHK GITLKESAL+L +L
Sbjct: 414 HCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVL 473

Query: 487 TAEEFDHWVVPEHMIGPK 504
           ++EEFD WV+PE MIGPK
Sbjct: 474 SSEEFDQWVIPEKMIGPK 491

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL262W
           (FUM1)
          Length = 488

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/504 (74%), Positives = 415/504 (82%), Gaps = 17/504 (3%)

Query: 1   MLRLSSNVLKNSCVCQVSSPRLTSKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPADK 60
           MLRLS       CV   ++ RL S            T    Q+ RVETDAFGEI+VPADK
Sbjct: 1   MLRLS-----RGCVGSSAARRLMS------------TAGAPQQFRVETDAFGEIRVPADK 43

Query: 61  YWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAAD 120
           YWGAQTQRS ENFRIGG RERMPE VV AFG+LKK+ A VNE  G L+P +A AI+QAAD
Sbjct: 44  YWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAAD 103

Query: 121 EVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQS 180
           EVA G+L +HFPLVVFQTGSGTQSNMNANEVISNRAIELLGG+LGSK VHPNNH N +QS
Sbjct: 104 EVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQS 163

Query: 181 SNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQ 240
           SNDTFP+VMHIAAV  IT+ LLP L AL+ S Q+K++EFA IVKIGRTHLQDATPLTLGQ
Sbjct: 164 SNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQ 223

Query: 241 EFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ 300
           EFSGY QQ+ANGI RVE   +SL+ LAQGGTAVGTGLNT+ G+AE +AA+V++ETG++F+
Sbjct: 224 EFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFR 283

Query: 301 TAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSS 360
           TAPNKFEALAAHDAVVEASGALNTLA SLFKIA DIRYLGSGPRCGYGELSLPENEPGSS
Sbjct: 284 TAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSS 343

Query: 361 IMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKPVMXXXXXXXXXXXXDA 420
           IMPGKVNPTQNEALTQ CVQV GN++AITFAGASGQFELNVFKPVM            DA
Sbjct: 344 IMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADA 403

Query: 421 SYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESA 480
           + SFRVHCVDGIQ N + IAKLLHESLMLVTALNPKIGYDAAS VAKNAHK GITL+ SA
Sbjct: 404 ARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASA 463

Query: 481 LQLNILTAEEFDHWVVPEHMIGPK 504
           L+L +LT  EFD WVVPE MIGP+
Sbjct: 464 LELGVLTDAEFDEWVVPEKMIGPR 487

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii ACR013C
          Length = 489

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/483 (75%), Positives = 411/483 (85%), Gaps = 2/483 (0%)

Query: 23  TSKTPMSQIS-QLHTTTPWL-QEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRE 80
           + K P  +I+ ++ +TT  L Q+ R+ETDAFGEIKVPA+KYWGAQTQRS ENF+IGG RE
Sbjct: 5   SKKIPAKRIADRMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRE 64

Query: 81  RMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGS 140
           RMPE ++ AFGILKK+ A VNE+ G LDPK++  I+QAADEV  GKL DHFPLVVFQTGS
Sbjct: 65  RMPEPIIKAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGS 124

Query: 141 GTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKD 200
           GTQSNMNANEVISNRAIEL+GG+LG+K +HPNNH N +QSSNDTFP+VMHIAAV  IT  
Sbjct: 125 GTQSNMNANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNT 184

Query: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260
           LLP LTAL+DS QKK+EEF+ IVKIGRTHLQDATPLTLGQEF GY QQ+ NGI RVE +L
Sbjct: 185 LLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSL 244

Query: 261 DSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASG 320
             LK LAQGGTAVGTGLNTK+G+AE +A +V+KET I+F+TAPNKFEALAAHDAVVE SG
Sbjct: 245 HHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSG 304

Query: 321 ALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQ 380
           ALNT+A SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQ
Sbjct: 305 ALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQ 364

Query: 381 VFGNHSAITFAGASGQFELNVFKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIA 440
           V GN+S ITFAGASGQFELNVFKPVM            DASYSFRVHCVDGI+AN + IA
Sbjct: 365 VMGNNSTITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIA 424

Query: 441 KLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHM 500
           K+LHESLMLVTALNPKIGYD+A KVAKNAHK  ITLKESAL+L +L+ EEF  WVVPE M
Sbjct: 425 KILHESLMLVTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKM 484

Query: 501 IGP 503
           IGP
Sbjct: 485 IGP 487

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa]
           {ON} complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/463 (77%), Positives = 399/463 (86%)

Query: 41  LQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATV 100
           L+  RVETD FGEIKVPA+KYWGAQT+RSFENF+IGG RERMPEAVV AFG+LKK  A V
Sbjct: 21  LKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIV 80

Query: 101 NEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELL 160
           N   G LDP  +  I+QAADEVA+GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIEL 
Sbjct: 81  NTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELK 140

Query: 161 GGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFA 220
           GG LGSK +HPNNH NM+QSSNDTFPTVMHIAAV  I++ LLP LT L+D+L  KS EF 
Sbjct: 141 GGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFE 200

Query: 221 DIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTK 280
            IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+E    +L+ LAQGGTAVGTGLNTK
Sbjct: 201 HIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTK 260

Query: 281 IGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLG 340
            GWAE +AAE++KETG+ F+TAPNKFEALAAHDA+VEASGALNT+A SLFKIAQDIRYLG
Sbjct: 261 NGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLG 320

Query: 341 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELN 400
           SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQV GN++A+TFAGASGQFELN
Sbjct: 321 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELN 380

Query: 401 VFKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYD 460
           VFKPV+            DAS SFRVHCV+GI+AN   I++LLH SLMLVTALNPKIGYD
Sbjct: 381 VFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYD 440

Query: 461 AASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGP 503
           AA+KVAKNAHK GITLKESAL+L +LT +EFD WVVPE M+GP
Sbjct: 441 AATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/463 (76%), Positives = 400/463 (86%)

Query: 41  LQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATV 100
           +  +RVETD FGEIKVPADKYWGAQTQRSF+NF+IGG RERMPE +V AFG+LKK+ A V
Sbjct: 19  MMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSAAIV 78

Query: 101 NEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELL 160
           NE  G LD ++A  I+QAADEVA GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIEL+
Sbjct: 79  NEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELI 138

Query: 161 GGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFA 220
           GG+LGSK +HPNNH N +QSSNDTFP+VMHIAAV  IT  LLP +T LKD+L KK+EEF 
Sbjct: 139 GGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQ 198

Query: 221 DIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTK 280
           DIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+E+TL  LK LAQGGTAVGTGLNTK
Sbjct: 199 DIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTK 258

Query: 281 IGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLG 340
            G+ + +A +++KETGIDF+TAPNKFEALAAHDA+VEASGALNT+A SLFKIAQDIRYLG
Sbjct: 259 EGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLG 318

Query: 341 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELN 400
           SGPRCGYGEL LPENEPGSSIMPGKVNPTQNEA+TQVCVQV GN++A+TFAGA+GQFELN
Sbjct: 319 SGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFELN 378

Query: 401 VFKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYD 460
           VFKPVM            DA +SFRVHCV+GI+ANRE I   LH SLMLVTALNPKIGYD
Sbjct: 379 VFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIGYD 438

Query: 461 AASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGP 503
           AASK+AKNA K  ITLKESAL+L  LT+EEFD WV+PE+M+GP
Sbjct: 439 AASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
           converts fumaric acid to L-malic acid in the TCA cycle;
           cytosolic and mitochondrial distribution determined by
           the N-terminal targeting sequence, protein conformation,
           and status of glyoxylate shunt; phosphorylated in
           mitochondria
          Length = 488

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/460 (78%), Positives = 398/460 (86%)

Query: 45  RVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEAN 104
           R ETDAFGEI VPADKYWGAQTQRSF+NF+IGG RERMP  +VHAFG+LKK+ A VNE+ 
Sbjct: 29  RTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESL 88

Query: 105 GQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKL 164
           G LDPK++ AI+QAADEVASGKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE+LGGK+
Sbjct: 89  GGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148

Query: 165 GSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVK 224
           GSK VHPNNH N SQSSNDTFPTVMHIAA L I  +L+P LT LK++L+ KS+EF  IVK
Sbjct: 149 GSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFDHIVK 208

Query: 225 IGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWA 284
           IGRTHLQDATPLTLGQEFSGYVQQV NGI+RV  +L +L  LAQGGTAVGTGLNTK G+ 
Sbjct: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFD 268

Query: 285 ENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPR 344
             +A +++KETG+ FQTAPNKFEALAAHDA+VE SGALNTLA SLFKIAQDIRYLGSGPR
Sbjct: 269 VKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328

Query: 345 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKP 404
           CGY EL LPENEPGSSIMPGKVNPTQNEALTQVCVQV GN++AITFAG+ GQFELNVFKP
Sbjct: 329 CGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKP 388

Query: 405 VMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASK 464
           VM            DA+YSFRVHCV+GI+AN   I +LL +SLMLVTALNPKIGYDAASK
Sbjct: 389 VMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448

Query: 465 VAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPK 504
           VAKNAHK GITLKESAL+L +LT +EFD WVVPEHM+GPK
Sbjct: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPEHMLGPK 488

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
           Anc_6.13 YPL262W
          Length = 493

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/505 (71%), Positives = 418/505 (82%), Gaps = 12/505 (2%)

Query: 1   MLRLSSNVLKNSCVCQVSSPRLTSKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPADK 60
           ML+L    L N  + ++ + R++  T         TT    Q++R+ETD+FGEIKVPADK
Sbjct: 1   MLKLK---LANPTILRLQASRMSLST---------TTAASQQQYRIETDSFGEIKVPADK 48

Query: 61  YWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAAD 120
           YWGAQTQRSF+NF+IGG RER+P+ ++ AFGILKK+ A VNE+ G LDPK+A  IK+AAD
Sbjct: 49  YWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKKSAAIVNESLGTLDPKVADPIKKAAD 108

Query: 121 EVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQS 180
           EV  GKLKDHFPLVVFQTGSGTQ+NMN NEVISNRAIEL+GGKLGSK +HPNNH N SQS
Sbjct: 109 EVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQS 168

Query: 181 SNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQ 240
           SNDTFP+VMHIAAVL IT  L+P LT LKD+L  K++EFADIVKIGRTHLQDATPLTLGQ
Sbjct: 169 SNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQ 228

Query: 241 EFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ 300
           EFSGYVQQ+ NGI R+ES+L  LK LAQGGTAVGTGLNTKIG+ + +A EV+KETGI+F+
Sbjct: 229 EFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFK 288

Query: 301 TAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSS 360
           TAPNKFEALAAHDA+V ASGALNT+A SLFKIAQDIRYLGSGPRCGYGEL LPENEPGSS
Sbjct: 289 TAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSS 348

Query: 361 IMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKPVMXXXXXXXXXXXXDA 420
           IMPGKVNPTQNEA+TQVCVQ+ GN+  I+ AG+ GQFELNV+KP+M            DA
Sbjct: 349 IMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQFELNVYKPLMIANLLNSIRLMTDA 408

Query: 421 SYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESA 480
             SFR+HC+D ++AN++ I + L++SLMLVTALNPKIGYDAASK+AKNAH   ITLKESA
Sbjct: 409 CKSFRIHCIDDLKANKDKINENLNKSLMLVTALNPKIGYDAASKIAKNAHLKNITLKESA 468

Query: 481 LQLNILTAEEFDHWVVPEHMIGPKP 505
           L+L  LTAEEFD WVVPE+MIGPKP
Sbjct: 469 LELKYLTAEEFDEWVVPENMIGPKP 493

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
           [1404 nt, 468 aa]
          Length = 467

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/459 (77%), Positives = 398/459 (86%)

Query: 45  RVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEAN 104
           R+ETD FGEIKVPADKYWGAQTQRS+ENF+IGG RERMPE VV AFG+LKK+ A VNE  
Sbjct: 8   RLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEEF 67

Query: 105 GQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKL 164
           G LD  ++  I+QAADEV  GKL +HFPLVVFQTGSGTQSNMNANEVISNRAIEL GG +
Sbjct: 68  GILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGIM 127

Query: 165 GSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVK 224
           GSK +HPNNH NM+QSSNDTFPTVMHIAAV  IT  L+P +T LKD+L  KS+EF  IVK
Sbjct: 128 GSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIVK 187

Query: 225 IGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWA 284
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+E +L +LK LAQGGTAVGTGLNTKIG+A
Sbjct: 188 IGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGFA 247

Query: 285 ENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPR 344
           E +A +V+KETGI+F+TAPNKFEALAAHDA+VE+SGALNT+A SLFKIAQDIRYLGSGPR
Sbjct: 248 ERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPR 307

Query: 345 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKP 404
           CGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQV GN++AITFAGASGQFELNVFKP
Sbjct: 308 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 367

Query: 405 VMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASK 464
           VM            DA +SF +HCV+GIQAN + I KLLHESLMLVTALNPKIGYD+A+K
Sbjct: 368 VMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSATK 427

Query: 465 VAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGP 503
           VAKNAHK GITLKESAL+L +LT +EFD WVVPE M+GP
Sbjct: 428 VAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/460 (77%), Positives = 397/460 (86%)

Query: 45  RVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEAN 104
           R+ETDAFGEI VPADKYWGAQTQRSF+NF+IGG RERMP  +VHAFG+LKK+ A VNE+ 
Sbjct: 29  RIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNESL 88

Query: 105 GQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKL 164
           G LDPK++ AI+QAADEV SGKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE+LGGK+
Sbjct: 89  GGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148

Query: 165 GSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVK 224
           GSK VHPNNH N SQSSNDTFPTVMHIAA L I  +L+P LT LK++L+ KS+EF  IVK
Sbjct: 149 GSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIVK 208

Query: 225 IGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWA 284
           IGRTHLQDATPLTLGQEFSGYVQQV NGI+RV  +L +L  LAQGGTAVGTGLNTK G+ 
Sbjct: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFD 268

Query: 285 ENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPR 344
             +A +++ ETG+ FQTAPNKFEALAAHDA+VE SGALNTLA SLFKIAQDIRYLGSGPR
Sbjct: 269 IKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328

Query: 345 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKP 404
           CGY EL LPENEPGSSIMPGKVNPTQNEALTQVCVQV GN++AITFAG+ GQFELNVFKP
Sbjct: 329 CGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKP 388

Query: 405 VMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASK 464
           VM            D++YSFRVHCV+GI+AN   I +LL +SLMLVTALNPKIGYDAASK
Sbjct: 389 VMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448

Query: 465 VAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPK 504
           VAKNAHK GITLKESAL+L +LT +EFD WVVPE+M+GPK
Sbjct: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
           YPL262W (REAL)
          Length = 488

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/460 (77%), Positives = 397/460 (86%)

Query: 45  RVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEAN 104
           R ETDAFGEI VPADKYWGAQTQRSF+NF+IGG RERMP  +VHAFG+LKK+ A VNE+ 
Sbjct: 29  RTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESL 88

Query: 105 GQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKL 164
           G LDPK++ AI++AADEVASGKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE+LGGK+
Sbjct: 89  GGLDPKISKAIQEAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148

Query: 165 GSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVK 224
           GSK VHPNNH N SQSSNDTFPTVMHIAA L I  +L+P L  LK++L+ KS+EF  IVK
Sbjct: 149 GSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELANLKNALEAKSKEFDHIVK 208

Query: 225 IGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWA 284
           IGRTHLQDATPLTLGQEFSGYVQQV NGI+RV  +L +L  LAQGGTAVGTGLNTK G+ 
Sbjct: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFD 268

Query: 285 ENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPR 344
             +A +++KETG+ FQTAPNKFEALAAHDA+VE SGALNTLA SLFKIAQDIRYLGSGPR
Sbjct: 269 VKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328

Query: 345 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKP 404
           CGY EL LPENEPGSSIMPGKVNPTQNEALTQVCVQV GN++AITFAG+ GQFELNVFKP
Sbjct: 329 CGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKP 388

Query: 405 VMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASK 464
           VM            DA+YSFRVHCV+GI+AN   I +LL +SLMLVTALNPKIGYDAASK
Sbjct: 389 VMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448

Query: 465 VAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPK 504
           VAKNAHK GITLKESAL+L +LT +EFD WVVPE+M+GPK
Sbjct: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
           YPL262W
          Length = 495

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/504 (71%), Positives = 414/504 (82%), Gaps = 11/504 (2%)

Query: 1   MLRLSSNVLKNSCVCQVSSPRLTSKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPADK 60
           M+ +SS   K S V  V   +LTS T     S+ +T +      R ETD+FGEI VP DK
Sbjct: 2   MINISS---KGSIVHLV---KLTSYT-----SRFYTMSSIKSSFRAETDSFGEINVPNDK 50

Query: 61  YWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAAD 120
           YWGAQTQRS +NF+IGG+RE++P  ++ AFGILKK+ A VNE  G LD +LA  I  AAD
Sbjct: 51  YWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKKSAAIVNERLGTLDSELAKNIIIAAD 110

Query: 121 EVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQS 180
           EV+ GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIEL+GGKLGSK+VHPNNH+N SQS
Sbjct: 111 EVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELMGGKLGSKTVHPNNHVNQSQS 170

Query: 181 SNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQ 240
           SNDTFPTVMHIAA+L IT+ LLP L +LK+SL KKS EF DIVKIGRTHLQDATPLTLGQ
Sbjct: 171 SNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQ 230

Query: 241 EFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ 300
           EFSGYVQQ+ NGI+R+E+ L  LK LAQGGTAVGTGLNTK G+ + +A ++++ETGI+F+
Sbjct: 231 EFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLNTKAGFDKLIAEQISEETGINFE 290

Query: 301 TAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSS 360
           TAPNKFEALAAHDA+VE SGALNTLA SLFKIAQDIRYLGSGPRCGYGELSLPENEPGSS
Sbjct: 291 TAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSS 350

Query: 361 IMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKPVMXXXXXXXXXXXXDA 420
           IMPGKVNPTQNEA+TQVC+QV GNHS ITFAG+ GQFELNV+KP++            DA
Sbjct: 351 IMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQGQFELNVYKPLLISNLLSSIRLLTDA 410

Query: 421 SYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESA 480
           SYSFRVHC+DG++ANRENI + L++SLMLVTALNP IGYD ASK+AKNAH   ITLKESA
Sbjct: 411 SYSFRVHCIDGLKANRENITENLNKSLMLVTALNPYIGYDNASKIAKNAHHKNITLKESA 470

Query: 481 LQLNILTAEEFDHWVVPEHMIGPK 504
           L+L +LT E+F  WV+PE MIGPK
Sbjct: 471 LELGLLTEEQFSEWVIPEKMIGPK 494

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/460 (77%), Positives = 396/460 (86%)

Query: 45  RVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEAN 104
           R ETDAFGEI VPADKYWGAQTQRSF+NF+IGG RERMP  +VHAFG+LKK+ A VNE+ 
Sbjct: 29  RTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESL 88

Query: 105 GQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKL 164
           G LDPK++ AI+QAADEVA+GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE+LGGK+
Sbjct: 89  GGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148

Query: 165 GSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVK 224
           GSK VHPNN  N SQSSNDTFPTVMHIAA L I K+L+P LT LK++L+ KS+EF  IVK
Sbjct: 149 GSKQVHPNNDCNQSQSSNDTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVK 208

Query: 225 IGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWA 284
           IGRTHLQDATPLTLGQEFSGYVQQV NGI+RV  TL +L  LAQGGTAVGTGLNTK G+ 
Sbjct: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFD 268

Query: 285 ENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPR 344
             +A +++KETG+ FQTAPNKFEALAAHDA+VE SGALNTLA SLFKIAQDIRYLGSGPR
Sbjct: 269 VKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328

Query: 345 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKP 404
           CGY EL LPENEPGSSIMPGKVNPTQNEALTQVCVQV GN++AITF G+ GQFELNVFKP
Sbjct: 329 CGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNVFKP 388

Query: 405 VMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASK 464
           VM            DAS SFR+HCV+GI+AN   I +LL +SLMLVTALNPKIGYDAASK
Sbjct: 389 VMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448

Query: 465 VAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPK 504
           VAKNAHK GITLKESAL+L +LT +EFD WVVPE+M+GPK
Sbjct: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
           YPL262W
          Length = 496

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/488 (71%), Positives = 401/488 (82%), Gaps = 3/488 (0%)

Query: 20  PRLTSKTPMSQISQLHTTTPWLQEH---RVETDAFGEIKVPADKYWGAQTQRSFENFRIG 76
           PR        Q + +H +   L +    R+ETD FGEIKVPA+KYWGAQT+RSFENFRIG
Sbjct: 9   PRGVKSVAKVQKTGMHQSMRCLSDEAGFRIETDGFGEIKVPANKYWGAQTERSFENFRIG 68

Query: 77  GQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVF 136
           G RERMP+ VV AFG+LKK+ A VNE  G LDP+++  I++AADEV  GKL DHFPLVVF
Sbjct: 69  GPRERMPDPVVKAFGVLKKSAAIVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVF 128

Query: 137 QTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLA 196
           QTGSGTQSNMNANEVISNRAIELLGG LGSK VHPNNH+N +QSSND+FPTVMHIAAV  
Sbjct: 129 QTGSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTE 188

Query: 197 ITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRV 256
           IT  L+P +  L+D+L+ KS++FA IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+
Sbjct: 189 ITDHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRI 248

Query: 257 ESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVV 316
           E +L +LK LAQGGTAVGTGLNT+IG+AE +A +++KETG+ F+TAPNKFEALAAHDA+V
Sbjct: 249 EHSLINLKFLAQGGTAVGTGLNTRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIV 308

Query: 317 EASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQ 376
           EASGA+ T+A SLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQ
Sbjct: 309 EASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQ 368

Query: 377 VCVQVFGNHSAITFAGASGQFELNVFKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANR 436
           VC Q+ GN+  I FAG  GQFELNVFKPVM            D S SFR+HCV+GI+AN 
Sbjct: 369 VCAQIIGNNQTIIFAGTQGQFELNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANE 428

Query: 437 ENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVV 496
           E IA L+++SLMLVTALNPKIGYD A+KVAKNAHK GITLKESA+QL  LT  EFD WVV
Sbjct: 429 ERIADLMNKSLMLVTALNPKIGYDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVV 488

Query: 497 PEHMIGPK 504
           PE MIGPK
Sbjct: 489 PEKMIGPK 496

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
           YPL262W
          Length = 498

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/464 (75%), Positives = 395/464 (85%)

Query: 42  QEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVN 101
           QE RVETD+FGEI VPAD+YWGAQTQRSF+NF+IGG RE++PE VV AFGILKK+ ATVN
Sbjct: 35  QEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFGILKKSAATVN 94

Query: 102 EANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLG 161
           E  G LD  +A  IK AADEVA GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIELLG
Sbjct: 95  ENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIELLG 154

Query: 162 GKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFAD 221
           G+LGSK VHPNNH+N SQSSNDTFPTVMHIAA   I   L+P L  LKD+LQ K EEF+ 
Sbjct: 155 GELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSS 214

Query: 222 IVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKI 281
           IVKIGRTHLQDATPLTLGQEFSGYVQQV NGI+RV+S+L  L  LAQGGTAVGTGLNTK+
Sbjct: 215 IVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKV 274

Query: 282 GWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGS 341
           G+ + VA EV+KETG+ F+TAPNKFEALAAHDA+VEASGALNTLA SLFKIAQDIRYLGS
Sbjct: 275 GFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGS 334

Query: 342 GPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNV 401
           GPRCGYGEL LP NEPGSSIMPGKVNPTQNEA+TQVCVQV GN+S ITFAG+ GQFELNV
Sbjct: 335 GPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNV 394

Query: 402 FKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDA 461
           +KP+M            DAS SFR+HC++ ++AN++ I + L++SLMLVTALNPKIGYDA
Sbjct: 395 YKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVTALNPKIGYDA 454

Query: 462 ASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPKP 505
           A+KVAKNAH   ITLKESAL+L +LT +EFD WV+PE+MI PKP
Sbjct: 455 AAKVAKNAHHKNITLKESALELGVLTEKEFDEWVIPENMISPKP 498

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
           YPL262W
          Length = 465

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/463 (69%), Positives = 390/463 (84%)

Query: 41  LQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATV 100
           + E R+E D FGE++VPA+KYWGAQTQR+  NF IGG+RERMPE ++ A+GILKK+ A V
Sbjct: 1   MPETRIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIV 60

Query: 101 NEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELL 160
           NE+ G LDPK++ AI++AADEVA G L +HFPLVVFQTGSGTQ+NMN NEVISNRAIE+L
Sbjct: 61  NESLGTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEIL 120

Query: 161 GGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFA 220
           GG+LGSK+VHPNNH+N SQS+ND+FPT MHI+AV  +   LLP L  L+D+L+ KS EF 
Sbjct: 121 GGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFN 180

Query: 221 DIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTK 280
            IVKIGRTHLQDATPLTLGQEFSGYVQQV NGI RV+++L +LK +AQGGTAVGTG+NTK
Sbjct: 181 KIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTK 240

Query: 281 IGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLG 340
             +   VA +++ ETGI+F+TAPNKFEALA+HDA+VE SGALNTLA SLFKI+QDIR+LG
Sbjct: 241 KDFDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLG 300

Query: 341 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELN 400
           SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+ Q C+QV GN+SAITFAGASGQFELN
Sbjct: 301 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELN 360

Query: 401 VFKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYD 460
            +KP+M            D+  SFR+HC+ GI+AN + I KLL+ESLMLVTALNPKIGYD
Sbjct: 361 TYKPLMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYD 420

Query: 461 AASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGP 503
           AA+ +AK+AHKNG+TLKE+AL+  +LTAE+FD W+VPE M+ P
Sbjct: 421 AATAIAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
           YPL262W
          Length = 500

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/500 (67%), Positives = 396/500 (79%), Gaps = 13/500 (2%)

Query: 4   LSSNVLKNSCVCQVSSPRLTSKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPADKYWG 63
           +S N+ +N   CQ    R  S TP+S       +   LQ  R ETD+FGEI+VPA+KYWG
Sbjct: 13  VSLNIFRN---CQ----RSFSITPVSH------SIADLQGTRTETDSFGEIQVPANKYWG 59

Query: 64  AQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAADEVA 123
           AQTQRSF NF+IGG+RERMPE ++ AFG  KKA A VN + G LD  L  AI QAA+EV+
Sbjct: 60  AQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNSLGTLDDTLKDAIVQAAEEVS 119

Query: 124 SGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSND 183
            G L +HFPLVVFQTGSGTQSNMNANEVISNRAIELLGG LGSK VHPNNH+N SQSSND
Sbjct: 120 QGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSND 179

Query: 184 TFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFS 243
           TFPTVMHIAA+  IT  LLPNL  L+++L  K++EF  I+KIGRTHLQDATPLTLGQEFS
Sbjct: 180 TFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFS 239

Query: 244 GYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAP 303
           GY QQ+ N IKR+E  L  L+ +AQGGTAVGTGLNTKIG+AE  A +++ +T + F T+P
Sbjct: 240 GYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSP 299

Query: 304 NKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMP 363
           NKFE+LAAHDA+V    +LNTLA SLFKI+QDIRYL SGPRCGYGELS+PENEPGSSIMP
Sbjct: 300 NKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMP 359

Query: 364 GKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKPVMXXXXXXXXXXXXDASYS 423
           GKVNPTQNEA+ Q CVQV GN+S I+FAGASGQFELN +KP+M            DA +S
Sbjct: 360 GKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANLLSSTRLLSDAIFS 419

Query: 424 FRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESALQL 483
           F +HC  GIQAN++ I +LLHESLMLVT+LNPKIGYDAASKVAKNAH  GITLK+SAL+L
Sbjct: 420 FNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASKVAKNAHHKGITLKQSALEL 479

Query: 484 NILTAEEFDHWVVPEHMIGP 503
           +IL++++FD WV PE+M+GP
Sbjct: 480 DILSSKQFDEWVRPENMLGP 499

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
           Anc_6.13 YPL262W
          Length = 475

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/461 (71%), Positives = 394/461 (85%)

Query: 45  RVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEAN 104
           RVETD+FGEIKVP++KYWGAQTQRSF+NF+IGG+RE++P  ++ AFGILKK+ A VN++ 
Sbjct: 15  RVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQSL 74

Query: 105 GQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKL 164
           G LDP +A  I +A+DEV  GKL DHFPLVVFQTGSGTQ+NMNANEVISNRA EL+G +L
Sbjct: 75  GTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAEL 134

Query: 165 GSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVK 224
           GSK +HPNNH+N SQSSNDTFP+VMHIAAVL +  +L+P LT LK+SL  K++E+A+IVK
Sbjct: 135 GSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIVK 194

Query: 225 IGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWA 284
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R++++L  LK LAQGGTAVGTGLNTK+G+ 
Sbjct: 195 IGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGFD 254

Query: 285 ENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPR 344
           + +A EV+KETGIDF+TAPNKFEALAAHDA+V AS A+ T+A SLFKIAQDIRYLGSGPR
Sbjct: 255 KMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPR 314

Query: 345 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKP 404
           CGYGEL LPENEPGSSIMPGKVNPTQNEA+TQV +Q+ GN+  I  AG+ GQFELNV+KP
Sbjct: 315 CGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYKP 374

Query: 405 VMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASK 464
           +M            DA +SF++HCVDG++AN + I + LH+SLMLVTALNPKIGYDAASK
Sbjct: 375 LMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAASK 434

Query: 465 VAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPKP 505
           +AKNAH   ITLKESAL+L +LT EEFD WV+PE+MIGPKP
Sbjct: 435 LAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPKP 475

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 461

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 98/215 (45%), Gaps = 21/215 (9%)

Query: 175 INMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDAT 234
           ++  +S ND   T M I     +   +LP L++L   + +++EE  D++  G THLQ A 
Sbjct: 107 VHTGRSRNDQVATDMRIYCRDILNGTVLPALSSLIKVILQRAEEEIDVLMPGYTHLQRAQ 166

Query: 235 PLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVG---TGLNTKIGWAENVAAEV 291
           P+      S Y        KR++  ++ L +   G  A+     G++      E +AA  
Sbjct: 167 PIRWAHWLSCYATYFTEDYKRLQQIVERLNVSPLGAGALAGHPYGIDR-----EFLAA-- 219

Query: 292 AKETGIDFQ-TAPNKFEALAAHDAVVEAS--GALNTLAVSLFKIAQDIRYLGSGPRCGYG 348
               G++F     N   A+A  D VVE    G+L    +S F  A+D+  + S    G+ 
Sbjct: 220 ----GLNFNGVIGNSLTAVADRDFVVEIMFWGSLFMNHISRF--AEDL-IIYSTAEFGFI 272

Query: 349 ELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFG 383
           +LS      GSS+MP K NP   E L     +VFG
Sbjct: 273 QLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 306

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON}
           Anc_1.354 YHR018C
          Length = 462

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 100/238 (42%), Gaps = 21/238 (8%)

Query: 148 ANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTA 207
           ANE    R  E++G  +  K       ++  +S ND   T + I     + + L P +T+
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPGMTS 140

Query: 208 LKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLA 267
           L + L K++EE  DI+  G THLQ A P+      S Y       +KR++  L+      
Sbjct: 141 LIEVLIKRAEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLKQILERFNKSP 200

Query: 268 QGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ-TAPNKFEALAAHDAVVEASGALNTLA 326
            G  A+        G    +  E   E G+ F     N   A++  D VVE         
Sbjct: 201 LGAGALA-------GHPYGIDREFLAE-GLGFDGVIGNSLVAVSDRDFVVELMFWGTLFM 252

Query: 327 VSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGN 384
             + + A+D+  + S    G+ +LS      GSS+MP K N    E L     +VFG+
Sbjct: 253 NHISRFAEDL-VIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]
           {ON} complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 73/247 (29%), Positives = 101/247 (40%), Gaps = 25/247 (10%)

Query: 148 ANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTA 207
           ANE    R  EL+G  +  K       ++  +S ND   T + I     I   LLP+L +
Sbjct: 89  ANE---RRLGELIGTDISGK-------VHTGRSRNDQCVTDLRIYCRDIIQDKLLPSLKS 138

Query: 208 LKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLA 267
           L   L K+ E    I+  G THLQ A P+      S Y        KR++  LD L +  
Sbjct: 139 LIQVLVKRGEGEIGILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQLLDRLNVSP 198

Query: 268 QGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ-TAPNKFEALAAHDAVVEA--SGALNT 324
            G  A+        G    +  E     G+ F     N   A++  D VVE    G L  
Sbjct: 199 LGAGALA-------GHPYGIDREFLA-NGLGFNGVIGNSLVAVSDRDFVVELLFWGTLFM 250

Query: 325 LAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGN 384
             +S F  A+D+  + S    G+  LS      GSS+MP K N    E L     +VFGN
Sbjct: 251 NHISRF--AEDL-IIYSTAEFGFITLS-DAYSTGSSLMPQKKNSDSLELLRGKSGRVFGN 306

Query: 385 HSAITFA 391
            S +  +
Sbjct: 307 LSGLLMS 313

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
           YHR018C
          Length = 462

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/218 (28%), Positives = 92/218 (42%), Gaps = 15/218 (6%)

Query: 170 HPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTH 229
           H    ++  +S ND   T M I     + + LLP +  L   L K++E   D +  G TH
Sbjct: 103 HIAGKVHTGRSRNDQVVTDMRIYCRDILNEKLLPFMADLIKVLVKRAENEIDTLMPGYTH 162

Query: 230 LQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAA 289
           LQ A P+      S Y        KR++  L+ L +   G  A+        G    +  
Sbjct: 163 LQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVSPLGAGALA-------GHPYGIDR 215

Query: 290 EVAKETGIDF-QTAPNKFEALAAHDAVVEAS--GALNTLAVSLFKIAQDIRYLGSGPRCG 346
           E   E G++F     N   A++  D VVE    G L    +S F  A+D+  + S    G
Sbjct: 216 EFLAE-GLNFGGVIGNSLVAVSDRDFVVELMFWGTLFMNHISRF--AEDL-IIYSTAEFG 271

Query: 347 YGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGN 384
           + +LS      GSS+MP K N    E L     +VFG+
Sbjct: 272 FVKLS-DSYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa]
           {ON} Anc_1.354 YHR018C
          Length = 462

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 98/242 (40%), Gaps = 21/242 (8%)

Query: 148 ANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTA 207
           ANE    R  E++G  +  K       ++  +S ND   T + I     + + L P LT+
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPALTS 140

Query: 208 LKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLA 267
           L   L K+ EE  DI+  G THLQ A P+      S Y       + R++  L       
Sbjct: 141 LIQVLIKRGEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLNRLKQILVRFNKSP 200

Query: 268 QGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ-TAPNKFEALAAHDAVVEASGALNTLA 326
            G  A+        G    +  E   E G++F     N   A++  D VVE         
Sbjct: 201 LGAGALA-------GHPYGIDREFLAE-GLEFNGVIGNSLVAVSDRDFVVELMFWSTLFM 252

Query: 327 VSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHS 386
             + + A+D+  + S    G+ +L+      GSS+MP K N    E L     +VFG+ S
Sbjct: 253 NHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLS 310

Query: 387 AI 388
             
Sbjct: 311 GF 312

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
           YHR018C
          Length = 465

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 97/238 (40%), Gaps = 21/238 (8%)

Query: 148 ANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTA 207
           ANE    R  E++G  +  K       ++  +S ND   T + I     +   L P+L A
Sbjct: 91  ANE---RRLGEIIGRNIAGK-------VHTGRSRNDQCVTDLRIYCRDLLNDKLFPDLQA 140

Query: 208 LKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLA 267
           L D + K+ +E  D++  G THLQ A P+      S Y        KR+   +D +    
Sbjct: 141 LVDVMIKRGKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDFKRLRQIMDRINQSP 200

Query: 268 QGGTAVGTGLNTKIGWAENVAAE-VAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLA 326
            G  A+        G    +  E +A   G D     N   A++  D +VE         
Sbjct: 201 LGAGALA-------GHPYGIDREFLAAGLGFD-GVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 327 VSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGN 384
             + + A+D+  + S    G+ +L+      GSS+MP K N    E L     +VFG+
Sbjct: 253 NHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 464

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 98/242 (40%), Gaps = 21/242 (8%)

Query: 148 ANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTA 207
           ANE    R  E++G ++  K       ++  +S ND   T M I     + + LLP L A
Sbjct: 92  ANE---RRLGEIIGREISGK-------VHTGRSRNDQVATDMRIYCRDILNEVLLPALQA 141

Query: 208 LKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLA 267
               L  +++E  D++  G THLQ A P+      S Y         R++  ++ L    
Sbjct: 142 FIKVLTTRAKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKSP 201

Query: 268 QGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ-TAPNKFEALAAHDAVVEASGALNTLA 326
            G  A+        G    +  E     G+ FQ    N   A++  D VVE         
Sbjct: 202 LGAGALA-------GHPYGIDREFLAR-GLGFQGVIGNSLTAVSDRDFVVEIMFWGTLFM 253

Query: 327 VSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHS 386
             + + ++D+  + S    G+ +LS      GSS+MP K NP   E L     +VFG  S
Sbjct: 254 NHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNPDSLELLRGKAGRVFGELS 311

Query: 387 AI 388
             
Sbjct: 312 GF 313

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
           YHR018C
          Length = 463

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 100/242 (41%), Gaps = 21/242 (8%)

Query: 148 ANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTA 207
           ANE    R  E++G K+  K       ++  +S ND   T + I     ++  LL NL  
Sbjct: 91  ANE---RRLGEIIGTKISGK-------VHTGRSRNDQCVTDLRIYCREYLSDKLLKNLET 140

Query: 208 LKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLA 267
           L + L  ++EE  + +  G THLQ A P+      S Y        KR+    + L    
Sbjct: 141 LINVLINRAEEEIEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERLNKSP 200

Query: 268 QGGTAVGTGLNTKIGWAENVAAE-VAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLA 326
            G  A+        G    +  E +A++ G D     N   A++  D VVE         
Sbjct: 201 LGAGALA-------GHPYGIDREYLAEKLGFD-SVIGNSLVAVSDRDFVVEILFWSTLFM 252

Query: 327 VSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHS 386
             + + A+D+  + S    G+ +LS      GSS+MP K N    E L     +VFGN S
Sbjct: 253 NHISRFAEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGNLS 310

Query: 387 AI 388
            +
Sbjct: 311 GL 312

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 94/238 (39%), Gaps = 21/238 (8%)

Query: 148 ANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTA 207
           ANE    R  EL+G  +  K       ++  +S ND   T + I     +   L P +  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDSLFPAMKG 140

Query: 208 LKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLA 267
           L D L K++E   DI+  G THLQ A P+      S Y        KR+   L  L    
Sbjct: 141 LVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLVQILHRLNQSP 200

Query: 268 QGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTA-PNKFEALAAHDAVVEASGALNTLA 326
            G  A+        G    +  E   E G+ F +   N   A++  D +VE         
Sbjct: 201 LGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 327 VSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGN 384
             + + A+D+  +      G+ +LS      GSS+MP K N    E L     +VFG+
Sbjct: 253 NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 94/238 (39%), Gaps = 21/238 (8%)

Query: 148 ANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTA 207
           ANE    R  EL+G  +  K       ++  +S ND   T + I     +   L P L  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNGTLFPALKG 140

Query: 208 LKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLA 267
           L D L K++E   DI+  G THLQ A P+      S Y        KR+   L  L    
Sbjct: 141 LVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSP 200

Query: 268 QGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTA-PNKFEALAAHDAVVEASGALNTLA 326
            G  A+        G    +  E   E G+ F +   N   A++  D +VE         
Sbjct: 201 LGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 327 VSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGN 384
             + + A+D+  +      G+ +LS      GSS+MP K N    E L     +VFG+
Sbjct: 253 NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 88/216 (40%), Gaps = 11/216 (5%)

Query: 170 HPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTH 229
           H +  ++  +S ND   T M +     +   + P L  L   L  ++ E  D++  G TH
Sbjct: 103 HISGKVHTGRSRNDQVATDMRLYCREMLQDKVEPALFELIKVLLHRAREEIDVLMPGYTH 162

Query: 230 LQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAA 289
           LQ A P+      S Y        KR++  +  L     G  A+        G    +  
Sbjct: 163 LQRAQPIRWSHWLSCYATYFVEDFKRLKEVIARLNQSPLGAGALA-------GHPYGIDR 215

Query: 290 E-VAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYG 348
           E +A E G D     N   A++  D VVE     +     + ++A+D+  + S    G+ 
Sbjct: 216 EYLACELGFD-GVIGNSMTAVSDRDFVVEIMSWGSLFMNHISRLAEDL-IIYSTAEFGFV 273

Query: 349 ELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGN 384
           +L+      GSS+MP K NP   E L     +VFG 
Sbjct: 274 KLA-DAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQ 308

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018c ARLY
          Length = 461

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/280 (24%), Positives = 108/280 (38%), Gaps = 30/280 (10%)

Query: 110 KLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSV 169
           K+   +K   +E   GK   H            +S+ + +     R  EL+G  +  K  
Sbjct: 63  KIHSGLKDIENEWDEGKFVRH------------ESDEDIHTANERRLGELIGRDIAGK-- 108

Query: 170 HPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTH 229
                ++  +S ND   T M I     + + + P + +L + L  ++E+  DI+  G TH
Sbjct: 109 -----VHTGRSRNDQVVTDMRIYCREILNEKIFPAMKSLINVLVNRAEKEIDILMPGYTH 163

Query: 230 LQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAA 289
           LQ A P+      S Y       +KR+E   + L     G  A+        G      A
Sbjct: 164 LQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERLNKSPLGSGALA---GHPYGIDRQFLA 220

Query: 290 EVAKETGIDFQ-TAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYG 348
           E     G+ F     N   A++  D VVE           + + ++D+  + S    G+ 
Sbjct: 221 E-----GLGFNGVIGNSLVAVSDRDFVVELMFWATLFMNHVSRFSEDL-IIYSTAEFGFI 274

Query: 349 ELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAI 388
           +LS      GSS+MP K N    E L     +VFG  S  
Sbjct: 275 KLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGELSGF 313

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
           similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 69/271 (25%), Positives = 106/271 (39%), Gaps = 34/271 (12%)

Query: 121 EVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQS 180
           E +SGK ++H            +    ANE    R  EL+G  +  K       ++  +S
Sbjct: 73  EWSSGKFEEH---------PDDEDIHTANE---RRLGELIGTAVAGK-------VHTGRS 113

Query: 181 SNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQ 240
            ND   T M I     + + +LP +++    L  ++ E  D++  G THLQ A P+    
Sbjct: 114 RNDQVATDMRIYCREILNEKILPAVSSFIRVLINRAREEVDVLMPGYTHLQRAQPIRWSH 173

Query: 241 EFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ 300
             S Y         R+   ++ L    Q     G       G      AE     GI   
Sbjct: 174 WLSCYATYFTEDYNRLRQVVERLN---QSPLGAGALAGHPYGIDRKYLAEQLGFNGI--- 227

Query: 301 TAPNKFEALAAHDAVVEAS--GALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPE-NEP 357
              N   A++  D V+E    G+L    +S F  A+D+    +     +G ++L +    
Sbjct: 228 -IGNSLVAVSDRDFVIEIMFWGSLFMNHISRF--AEDLIIYSTAE---FGFINLADAYST 281

Query: 358 GSSIMPGKVNPTQNEALTQVCVQVFGNHSAI 388
           GSS+MP K NP   E L     +VFG  S  
Sbjct: 282 GSSLMPQKKNPDSLELLRGKSGRVFGQLSGF 312

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 96/238 (40%), Gaps = 21/238 (8%)

Query: 148 ANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTA 207
           ANE    R  E++G  +  K       ++  +S ND   T + I     +  +L P L  
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDNLFPALKG 140

Query: 208 LKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLA 267
           L D L K+++   +I+  G THLQ A P+      S Y        KR++  L  L    
Sbjct: 141 LVDVLIKRAKGEINILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLDQILHRLNQSP 200

Query: 268 QGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTA-PNKFEALAAHDAVVEASGALNTLA 326
            G  A+        G    +  E   E G+ F +   N   A++  D +VE         
Sbjct: 201 LGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSMVAVSDRDFIVELMFWGTLFM 252

Query: 327 VSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGN 384
             + + A+D+  +      G+ +LS      GSS+MP K N    E L     +VFG+
Sbjct: 253 NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
           YHR018C
          Length = 466

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 63/267 (23%), Positives = 107/267 (40%), Gaps = 25/267 (9%)

Query: 125 GKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDT 184
           G++K  +    F+     +    ANE    R  E++G  +  K       ++  +S ND 
Sbjct: 68  GEIKKEWDNGTFKRHPNDEDIHTANE---RRLGEIIGTHIAGK-------VHTGRSRNDQ 117

Query: 185 FPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSG 244
             T + I     + + LLP +  L   + K++E   DI+  G THLQ A P+      S 
Sbjct: 118 CVTDLRIYCRDILVEKLLPFMIDLVQVITKRAENEIDILMPGYTHLQRAQPIRWSHWLSS 177

Query: 245 YVQQVANGIKRVESTLDSLKLLAQGGTAVG---TGLNTKIGWAENVAAEVAKETGIDFQT 301
           Y        KR++  L+ L     G  A+     G++ +          ++ E G +   
Sbjct: 178 YATYFTEDYKRLKQVLERLNKCPLGAGAIAGHPYGIDRQY---------LSDELGFN-SI 227

Query: 302 APNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSI 361
             N   A++  D +V+           + + ++D+  + S    G+ +LS      GSS+
Sbjct: 228 IGNSLVAVSDRDFIVDIMFWSTLFMNHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSL 285

Query: 362 MPGKVNPTQNEALTQVCVQVFGNHSAI 388
           MP K N    E L     +VFG  S  
Sbjct: 286 MPQKKNADSLELLRGKSGRVFGQLSGF 312

>KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.354
           YHR018C
          Length = 464

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 71/263 (26%), Positives = 110/263 (41%), Gaps = 25/263 (9%)

Query: 125 GKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDT 184
           GK+K+ +    F      +    ANE    R  E++G  +  K       ++  +S ND 
Sbjct: 69  GKIKEEWENNTFIRLPSDEDIHTANE---RRLGEIIGTGIAGK-------VHTGRSRNDQ 118

Query: 185 FPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSG 244
             T M I     +T +LL  L  L   + +++ E  DI+  G THLQ A P+      S 
Sbjct: 119 VATDMRIYCRDILTNNLLTYLKELISVICRRANEEMDILMPGYTHLQRAQPIRWSHWLSF 178

Query: 245 YVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAE-VAKETGIDFQTAP 303
           Y        KR++  L  L +   G  A+        G    +  E +A++ G       
Sbjct: 179 YATYFTEDYKRLQEILARLNVSPLGAGALA-------GHPYGIDREFLAQDLGFS-GVIG 230

Query: 304 NKFEALAAHDAVVEAS--GALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSI 361
           N   A++  D VVE    G+L    +S F  ++D+  + S    G+ +LS      GSS+
Sbjct: 231 NSLVAVSDRDFVVEIMFWGSLFMNHISRF--SEDL-IIYSTAEFGFIKLS-DAYSTGSSL 286

Query: 362 MPGKVNPTQNEALTQVCVQVFGN 384
           MP K N    E L     +VFG+
Sbjct: 287 MPQKKNADSLELLRGKSGRVFGD 309

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
           ARG4Argininosuccinate lyase, catalyzes the final step in
           the arginine biosynthesis pathway
          Length = 463

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 94/238 (39%), Gaps = 21/238 (8%)

Query: 148 ANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTA 207
           ANE    R  EL+G  +  K       ++  +S ND   T + I     +   L P L  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDIVNDTLFPALKG 140

Query: 208 LKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLA 267
           L + L K++E   D++  G THLQ A P+      S Y        KR+   L  L    
Sbjct: 141 LVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSP 200

Query: 268 QGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTA-PNKFEALAAHDAVVEASGALNTLA 326
            G  A+        G    +  E   E G+ F +   N   A++  D +VE         
Sbjct: 201 LGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 327 VSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGN 384
             + + A+D+  +      G+ +LS      GSS+MP K N    E L     +VFG+
Sbjct: 253 NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
           similar to uniprot|P04076 Saccharomyces cerevisiae
           YHR018C ARG4 Argininosuccinate lyase catalyzes the final
           step in the arginine biosynthesis pathway
          Length = 462

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 99/241 (41%), Gaps = 27/241 (11%)

Query: 148 ANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTA 207
           ANE    R  E++G  +  K       ++  +S ND   T M I     + + LLP L  
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQVVTDMRIFCRDTVNEKLLPGLKE 140

Query: 208 LKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLA 267
           L   + K++E+    +  G THLQ A P+      S Y       +KR+   L+      
Sbjct: 141 LVSVMVKRAEKEIGYLMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLRQLLERFNQSP 200

Query: 268 QGGTAVG---TGLNTKIGWAENVAAEVAKETGIDFQ-TAPNKFEALAAHDAVVEASGALN 323
            G  A+     G++ +          +A+E G  FQ    N   A++  D VVE      
Sbjct: 201 LGAGALAGHPYGIDREF---------LAEELG--FQGVIGNSLVAVSDRDFVVELMFWGT 249

Query: 324 TLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFG 383
                + + A+D+  + S    G+ +L+      GSS+MP K N    E L     +VFG
Sbjct: 250 LFMNHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

Query: 384 N 384
           +
Sbjct: 308 D 308

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]
           {ON} highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 465

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 105/257 (40%), Gaps = 22/257 (8%)

Query: 136 FQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVL 195
           F    G +    ANE    R  E++G  +  K       ++  +S ND   T M I    
Sbjct: 81  FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVATDMRIYCRE 130

Query: 196 AITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKR 255
           A+  ++   L  L  ++ +++E+  D +  G THLQ A P+      + Y        KR
Sbjct: 131 AL-DNMAKILKDLVGAILQRAEQEIDALMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKR 189

Query: 256 VESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAE-VAKETGIDFQTAPNKFEALAAHDA 314
           ++   + L +   G  A+        G    +  E +A+  G D     N  +A++  D 
Sbjct: 190 LKQIRERLNVSPLGCGALA-------GHPYGIDREHIAERLGFD-GVIGNSLQAVSDRDF 241

Query: 315 VVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAL 374
           VVE     +     + + ++D+  + S     + +LS      GSS+MP K NP   E L
Sbjct: 242 VVEILFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQKKNPDSLELL 299

Query: 375 TQVCVQVFGNHSAITFA 391
                +VFG+ S    +
Sbjct: 300 RGKSGRVFGSLSGFMMS 316

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 85/192 (44%), Gaps = 31/192 (16%)

Query: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260
           ++P L  + + L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++  E   
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 261 DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 306
           + + L    GT        A+  G + K+   E + A V +  G D       QT   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDARVTELLGFDKVYPVTGQTYSRKI 244

Query: 307 EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 366
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 367 NPTQNEALTQVC 378
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359w ADE13
          Length = 482

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 84/192 (43%), Gaps = 31/192 (16%)

Query: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260
           ++P L  + + L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++  E   
Sbjct: 128 VIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 261 DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 306
           + + L    GT        A+  G + K+   E +   V +  G D       QT   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVTELLGFDTVYPVTGQTYSRKI 244

Query: 307 EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 366
           +        ++    L++ A S  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 367 NPTQNEALTQVC 378
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]
           {ON} YHR018C (ARG4) - argininosuccinate lyase [contig
           260] FULL
          Length = 465

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/252 (24%), Positives = 103/252 (40%), Gaps = 26/252 (10%)

Query: 136 FQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVL 195
           F    G +    ANE    R  E++G  +  K       ++  +S ND   T M I    
Sbjct: 81  FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVATDMRIYCRE 130

Query: 196 AITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKR 255
           A+  +L   L  L  ++ ++SE+  D +  G THLQ A P+      + Y        KR
Sbjct: 131 AL-DNLAKILEDLIGAILQRSEQEIDALMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKR 189

Query: 256 VESTLDSLKLLAQGGTAVG---TGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAH 312
           ++   + L +   G  A+     G++ +          +A+  G       N  +A++  
Sbjct: 190 LKQIRERLNVSPLGCGALAGHPYGIDREF---------LAERLGFS-DVIGNSLQAVSDR 239

Query: 313 DAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 372
           D VVE     +     + + ++D+  + S     + +LS      GSS+MP K NP   E
Sbjct: 240 DFVVEIMFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQKKNPDSLE 297

Query: 373 ALTQVCVQVFGN 384
            L     +VFG+
Sbjct: 298 LLRGKSGRVFGS 309

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
           (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 80/189 (42%), Gaps = 25/189 (13%)

Query: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260
           L+P L  + D L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 LIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 261 DSLKLLAQGGTAVGTG-----LNTKIGWAENVAAEVAKETGIDF------QTAPNKFEAL 309
           + + L    GT    G      ++     E +   V +  G D       QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQGSFLALFHSDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 310 AAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 369
                 ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPM 296

Query: 370 QNEALTQVC 378
           + E   +VC
Sbjct: 297 RCE---RVC 302

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 82/192 (42%), Gaps = 31/192 (16%)

Query: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260
           ++P L  + D L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDLRNFVRAR 187

Query: 261 DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 306
           + L L    GT        A+  G + K+   E +   V +  G D       QT   K 
Sbjct: 188 NDLGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVTELLGFDTVYPVTGQTYSRKI 244

Query: 307 EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 366
           +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 367 NPTQNEALTQVC 378
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 85/194 (43%), Gaps = 35/194 (18%)

Query: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260
           ++P L  + D L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 VIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 261 DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 306
           + + L    GT        A+  G + K+   E +   V +  G D       QT   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 307 EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPG 364
           +        ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAY 291

Query: 365 KVNPTQNEALTQVC 378
           K NP + E   +VC
Sbjct: 292 KRNPMRCE---RVC 302

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
           (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 83/192 (43%), Gaps = 31/192 (16%)

Query: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260
           ++P L  + D L K + E+ D+  +G TH Q A   T+G+  + ++Q++   ++      
Sbjct: 128 IIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVRAR 187

Query: 261 DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 306
           + + L    GT        A+  G + K+   E +   V +  G D       QT   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDDDKV---EALDKRVVELLGFDTVYPVTGQTYSRKI 244

Query: 307 EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 366
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 367 NPTQNEALTQVC 378
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 84/192 (43%), Gaps = 31/192 (16%)

Query: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260
           ++P L  + + L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++  E   
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFERAR 187

Query: 261 DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 306
           + + L    GT        A+  G + K+   E +   V +  G D       QT   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFDKVYPVTGQTYSRKI 244

Query: 307 EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 366
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 367 NPTQNEALTQVC 378
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
           ADE13Adenylosuccinate lyase, catalyzes two steps in the
           'de novo' purine nucleotide biosynthetic pathway;
           expression is repressed by adenine and activated by
           Bas1p and Pho2p; mutations in human ortholog ADSL cause
           adenylosuccinase deficiency
          Length = 482

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 84/192 (43%), Gaps = 31/192 (16%)

Query: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260
           ++P L  + + L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++  E   
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 261 DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 306
           + + L    GT        A+  G + K+   E +   V +  G D       QT   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFDKVYPVTGQTYSRKI 244

Query: 307 EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 366
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 367 NPTQNEALTQVC 378
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 82/192 (42%), Gaps = 31/192 (16%)

Query: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260
           ++P L  + D L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 261 DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 306
           + + L    GT        A+  G + K+   E +   V +  G D       QT   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 307 EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 366
           +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKR 293

Query: 367 NPTQNEALTQVC 378
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 31/192 (16%)

Query: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260
           ++P L  + + L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++  E   
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 261 DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 306
           + + L    GT        A+  G + K+   E +   V +  G D       QT   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFDKVYPVTGQTYSRKI 244

Query: 307 EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 366
           +        ++    L++ A +  K+A DIR L +       E    + + GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKR 293

Query: 367 NPTQNEALTQVC 378
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 31/192 (16%)

Query: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260
           ++P L  + D L K + ++ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 VIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVRAR 187

Query: 261 DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 306
           + + L    GT        A+  G + K+   E +   V +  G D       QT   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 307 EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 366
           +        ++    L++ A S  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 367 NPTQNEALTQVC 378
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ABL006C
          Length = 482

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 90/209 (43%), Gaps = 37/209 (17%)

Query: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260
           L+P L  + + L   + ++ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 LIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 261 DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 306
           + +      GT        A+  G + K+   E +   VA+ +G D       QT   K 
Sbjct: 188 NDIGFRGVKGTTGTQASFLALFHGDHDKV---EALDKRVAELSGFDIIYPVTGQTYSRKV 244

Query: 307 EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPG 364
           +        ++  G L++ A +  K+A DIR L +       EL  P   ++ GSS M  
Sbjct: 245 D--------IDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMAY 291

Query: 365 KVNPTQNEALTQVCVQVFGNHSAITFAGA 393
           K NP + E   +VC      H    ++GA
Sbjct: 292 KRNPMRCE---RVC--SLARHLGSLYSGA 315

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 83/192 (43%), Gaps = 31/192 (16%)

Query: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260
           L+P L  + + L K +    D+  +G TH Q A   TLG+  + ++Q++   ++  E   
Sbjct: 128 LIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 261 DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 306
           + + L    GT        A+  G + K+   E +   V +  G D       QT   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHNKV---EKLDERVVELLGFDTVYPVTGQTYSRKI 244

Query: 307 EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 366
           +        ++A   L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDAFAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 367 NPTQNEALTQVC 378
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 85/195 (43%), Gaps = 37/195 (18%)

Query: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260
           L+P L  + + L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 LIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 261 DSLKLLAQGGTAVGT---------GLNTKIGWAENVAAE------VAKETGIDFQTAPNK 305
           + + L    GT  GT         G + K+   +   AE      V   TG   QT   K
Sbjct: 188 NDIGLRGVKGTT-GTQASFLTLFHGDHDKVEALDKRVAELLGFSTVYPVTG---QTYSRK 243

Query: 306 FEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMP 363
            +        ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M 
Sbjct: 244 ID--------IDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMA 290

Query: 364 GKVNPTQNEALTQVC 378
            K NP + E   +VC
Sbjct: 291 YKRNPMRCE---RVC 302

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 83/192 (43%), Gaps = 31/192 (16%)

Query: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260
           L+P L  + + L + + E+ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 LIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 261 DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 306
           + + L    GT        A+  G + K+   E +   V +  G D       QT   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 307 EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 366
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKR 293

Query: 367 NPTQNEALTQVC 378
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 79/186 (42%), Gaps = 19/186 (10%)

Query: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260
           ++P L  + D L K +  + D+  +G TH Q A   TLG+  + ++Q +   ++  +   
Sbjct: 128 IIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDRAR 187

Query: 261 DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAH 312
           + + L    GT        A+  G + K+   E +   V +  G  F+T         + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDQRVTELLG--FETVYPVTGQTYSR 242

Query: 313 DAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 372
              ++    L + A +  K+A DIR L +       E    + + GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE 299

Query: 373 ALTQVC 378
              +VC
Sbjct: 300 ---RVC 302

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 82/192 (42%), Gaps = 31/192 (16%)

Query: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260
           ++P L  + + L   + E+ D+  +G TH Q A   TLG+  + ++Q++   ++  E   
Sbjct: 128 VIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 261 DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 306
           + + L    GT        A+  G + K+   E +   V +  G D       QT   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVVELLGFDTVYPVTGQTYSRKI 244

Query: 307 EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 366
           +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVVSPLVSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 367 NPTQNEALTQVC 378
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR359W
           (ADE13)
          Length = 482

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 82/192 (42%), Gaps = 31/192 (16%)

Query: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260
           ++P L  + + L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 IIPKLVNVINRLSKFACEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 261 DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 306
           + + L    GT        A+  G + ++   E +   V +  G D       QT   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDRV---EALDKRVTELLGFDIVYPVTGQTYSRKI 244

Query: 307 EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 366
           +        ++  G+ ++   +  K+A DIR L +       E    + + GSS M  K 
Sbjct: 245 D--------IDILGSGSSFEATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKR 293

Query: 367 NPTQNEALTQVC 378
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 82/192 (42%), Gaps = 31/192 (16%)

Query: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260
           L+P L  + + L + + ++ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 LIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 261 DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 306
           + + L    GT        A+  G + K+   E +   V +  G D       QT   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 307 EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 366
           +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLCSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKR 293

Query: 367 NPTQNEALTQVC 378
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 82/192 (42%), Gaps = 31/192 (16%)

Query: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260
           ++P L  + + L   + ++ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 IIPKLVNVINRLSDFALKYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 261 DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 306
           + + L    GT        A+  G + K+   E +   V +  G D       QT   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 307 EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 366
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLSPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKR 293

Query: 367 NPTQNEALTQVC 378
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa]
           {ON} complement(101434..102513) [1080 nt, 360 aa]
          Length = 359

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 39/97 (40%), Gaps = 5/97 (5%)

Query: 106 QLDPKLAVAIKQAADEVASG-KLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKL 164
           + D  L    K   DE++S  K+ ++F L +F T S +QS  +   V   R         
Sbjct: 103 ETDISLDTRFKLTEDEISSTRKVMNYFKLNIFSTNSNSQSMFDEQAVFKKRYF----WNR 158

Query: 165 GSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDL 201
             KS + ++ IN      D F   MH      +  D+
Sbjct: 159 NKKSKNDSDDINKHMLDIDNFDNDMHAYDFNDLDDDM 195

>SAKL0A01430g Chr1 complement(136728..137636) [909 bp, 302 aa] {ON}
           similar to uniprot|P53727 Saccharomyces cerevisiae
           YNR027W BUD17 Protein involved in bud-site selection
           diploid mutants display a random budding pattern instead
           of the wild-type bipolar pattern
          Length = 302

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 56/136 (41%), Gaps = 15/136 (11%)

Query: 212 LQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGT 271
            + K++E  DI++ G   L     L      +GY+  V +G+K +  T+  L    +  T
Sbjct: 53  FKSKAQELRDIIEKG---LLQGLELKYDAVLTGYLPDV-DGLKAISETVSRL---CESDT 105

Query: 272 AVG------TGLNTKIGWAENVAAEVAK--ETGIDFQTAPNKFEALAAHDAVVEASGALN 323
           ++        G N K+   E       K  E G  F T PN+FE     D  +    +L 
Sbjct: 106 SIKWVVDPVLGDNGKLYVPEETVPIYRKILECGSVFLTTPNQFEMETLTDVKITDCASLR 165

Query: 324 TLAVSLFKIAQDIRYL 339
           +  +   ++   ++Y+
Sbjct: 166 SSLIKFHQLYPTVKYV 181

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,163,027
Number of extensions: 1914583
Number of successful extensions: 5692
Number of sequences better than 10.0: 73
Number of HSP's gapped: 5834
Number of HSP's successfully gapped: 73
Length of query: 505
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 391
Effective length of database: 40,409,475
Effective search space: 15800104725
Effective search space used: 15800104725
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 68 (30.8 bits)