Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07964g6.13ON50550525040.0
SAKL0E00946g6.13ON49347919390.0
TDEL0G045806.13ON48446319270.0
KLTH0C11462g6.13ON49247119190.0
Kwal_56.223626.13ON49347719050.0
KLLA0D00902g6.13ON49249819030.0
Ecym_30166.13ON48948318830.0
ACR013C6.13ON48847618750.0
CAGL0A01045g6.13ON48346318580.0
Kpol_1045.766.13ON48546318570.0
Kpol_1032.46.13ON46745918460.0
YPL262W (FUM1)6.13ON48846018480.0
NCAS0D026206.13ON49347718410.0
Skud_16.166.13ON48846018340.0
Smik_6.4706.13ON48846018340.0
Suva_16.436.13ON48846018300.0
KAFR0B065206.13ON49547618180.0
TPHA0J002706.13ON49648818120.0
KNAG0E027506.13ON49846418100.0
NDAI0I024706.13ON47548217560.0
TBLA0G010006.13ON46546317140.0
TBLA0A071306.13ON50050017120.0
KLLA0A08404g1.354ON4612981455e-09
NDAI0G059401.354ON4622611455e-09
Kpol_1018.1251.354ON4602421375e-08
TPHA0A021901.354ON4632421366e-08
CAGL0I08987g1.354ON4613011358e-08
KNAG0I015601.354ON4622921358e-08
NCAS0A090101.354ON4622401341e-07
SAKL0D09746g1.354ON4642401331e-07
TDEL0D022201.354ON4652381322e-07
Suva_15.2011.354ON4632381294e-07
Smik_8.831.354ON4632381286e-07
KAFR0A009501.354ON4642611286e-07
TBLA0F034801.354ON4662631286e-07
ZYRO0G00748g1.354ON4622611251e-06
Ecym_27491.354ON4702671251e-06
Skud_8.701.354ON4632381242e-06
AEL019W1.354ON4692151242e-06
YHR018C (ARG4)1.354ON4632381232e-06
KLTH0G19338g1.354ON4652801134e-05
Kwal_27.127821.354ON4652771117e-05
Skud_12.4434.197ON4821861036e-04
CAGL0B02794g4.197ON4821861028e-04
Kwal_47.180664.197ON4821751000.001
Suva_10.4594.197ON4821831000.001
YLR359W (ADE13)4.197ON4821831000.001
TPHA0B010404.197ON482186990.002
Smik_12.4464.197ON482183990.002
KLLA0B13189g4.197ON482183970.003
NDAI0J019504.197ON482182970.003
Kpol_1042.164.197ON482180960.004
NCAS0J012004.197ON482180950.006
KNAG0B058404.197ON482180950.006
Ecym_24524.197ON482209930.010
ZYRO0B07964g4.197ON482180930.010
KAFR0A062304.197ON482186930.010
SAKL0B04972g4.197ON482180900.023
TBLA0A083204.197ON482186900.023
ABL006C4.197ON482186820.21
TDEL0E017604.197ON482180820.21
KLTH0A03344g4.197ON482180810.28
SAKL0A01430g6.334ON302137704.9
NCAS0A034704.106ON81689706.5
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ZYRO0C07964g
         (1518 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   969   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   751   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   746   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   743   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   738   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   737   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   729   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   726   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   720   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   719   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   715   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   716   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   713   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   711   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   711   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   709   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   704   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   702   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   701   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   681   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   664   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   664   0.0  
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    60   5e-09
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    60   5e-09
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    57   5e-08
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    57   6e-08
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    57   8e-08
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    57   8e-08
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    56   1e-07
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    56   1e-07
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    55   2e-07
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    54   4e-07
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    54   6e-07
KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.3...    54   6e-07
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    54   6e-07
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    53   1e-06
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    53   1e-06
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    52   2e-06
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    52   2e-06
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    52   2e-06
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    48   4e-05
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    47   7e-05
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    44   6e-04
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    44   8e-04
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    43   0.001
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    43   0.001
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    43   0.001
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    43   0.002
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    43   0.002
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    42   0.003
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    42   0.003
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    42   0.004
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    41   0.006
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    41   0.006
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    40   0.010
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    40   0.010
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    40   0.010
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    39   0.023
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    39   0.023
ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON} S...    36   0.21 
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    36   0.21 
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    36   0.28 
SAKL0A01430g Chr1 complement(136728..137636) [909 bp, 302 aa] {O...    32   4.9  
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     32   6.5  

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
            highly similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262W FUM1 Fumarase converts fumaric acid to L-malic
            acid in the TCA cycle cytosolic and mitochondrial
            localization determined by the N-terminal mitochondrial
            targeting sequence and protein conformation
          Length = 505

 Score =  969 bits (2504), Expect = 0.0
 Identities = 493/505 (97%), Positives = 493/505 (97%)
 Frame = +1

Query: 1    MLRLSSNVLKNSCVCQVSSPRLTSKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPADK 180
            MLRLSSNVLKNSCVCQVSSPRLTSKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPADK
Sbjct: 1    MLRLSSNVLKNSCVCQVSSPRLTSKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPADK 60

Query: 181  YWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAAD 360
            YWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAAD
Sbjct: 61   YWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAAD 120

Query: 361  EVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQS 540
            EVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQS
Sbjct: 121  EVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQS 180

Query: 541  SNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQ 720
            SNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQ
Sbjct: 181  SNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQ 240

Query: 721  EFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ 900
            EFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ
Sbjct: 241  EFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ 300

Query: 901  TAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSS 1080
            TAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSS
Sbjct: 301  TAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSS 360

Query: 1081 IMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKPVMXXXXXXXXXXXXDA 1260
            IMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKPVM            DA
Sbjct: 361  IMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKPVMISNLLSSINLLSDA 420

Query: 1261 SYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESA 1440
            SYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESA
Sbjct: 421  SYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESA 480

Query: 1441 LQLNILTAEEFDHWVVPEHMIGPKP 1515
            LQLNILTAEEFDHWVVPEHMIGPKP
Sbjct: 481  LQLNILTAEEFDHWVVPEHMIGPKP 505

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
            similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262W FUM1 Fumarase converts fumaric acid to L-malic
            acid in the TCA cycle cytosolic and mitochondrial
            localization determined by the N-terminal mitochondrial
            targeting sequence and protein conformation
          Length = 493

 Score =  751 bits (1939), Expect = 0.0
 Identities = 377/479 (78%), Positives = 416/479 (86%), Gaps = 1/479 (0%)
 Frame = +1

Query: 79   PMSQISQLHTTTPWLQE-HRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEA 255
            P S I  L T++   Q+ +R+ETDAFGEIKVPADKYWGAQTQRSFENF+IGG RERMPEA
Sbjct: 14   PSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEA 73

Query: 256  VVHAFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSN 435
            VV AFG+LKK+ A VNE+ G LDP+++  I++AADEV  GKL DHFPLVVFQTGSGTQSN
Sbjct: 74   VVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSN 133

Query: 436  MNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNL 615
            MNANEVISNRAIE++GG+ GSK VHPNNH N +QSSNDTFP+VMHIAAV  IT  LLP L
Sbjct: 134  MNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPEL 193

Query: 616  TALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKL 795
            TAL+DS QKKS+EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RVE +L  LK 
Sbjct: 194  TALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKF 253

Query: 796  LAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTL 975
            LAQGGTAVGTGLNTK+G+AE +A +V+KETGIDF+TAPNKFEALAAHDAVVE SGALNTL
Sbjct: 254  LAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTL 313

Query: 976  AVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNH 1155
            A SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQV GN+
Sbjct: 314  ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN 373

Query: 1156 SAITFAGASGQFELNVFKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHE 1335
            +AITFAGASGQFELNVFKPVM            DASYSFRVHCVDGI+AN + I+KLLHE
Sbjct: 374  AAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHE 433

Query: 1336 SLMLVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPK 1512
            SLMLVTALNPKIGYDAASKVAKNAHK GITLKESALQL +L  +EFD WV+PE MIGPK
Sbjct: 434  SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 492

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
            Anc_6.13 YPL262W
          Length = 484

 Score =  746 bits (1927), Expect = 0.0
 Identities = 375/463 (80%), Positives = 407/463 (87%)
 Frame = +1

Query: 127  EHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNE 306
            + RVETDAFGEIKV AD+YWGAQTQRS ENFRIGG RERMPE +V AFG+LKK+ A VNE
Sbjct: 22   QFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNE 81

Query: 307  ANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGG 486
            + G LDPK+A  IKQAADEVA GKL  HFPLVVFQTGSGTQSNMNANEVISNRAIEL+GG
Sbjct: 82   SLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGG 141

Query: 487  KLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADI 666
            +LGSK +HPNNH N +QSSNDTFP+VMHIAAV  IT+ LLP L  L+DSL  KS+EF+DI
Sbjct: 142  ELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDI 201

Query: 667  VKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIG 846
            VKIGRTHLQDATPLTLGQEFSGYVQQV+NGI RVE +L  LK LAQGGTAVGTGLNTKIG
Sbjct: 202  VKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIG 261

Query: 847  WAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSG 1026
            +AE +A +V+KETG+DF+TAPNKFEALAAHDAVVEASGALNT+A SLFKIAQDIRYLGSG
Sbjct: 262  FAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSG 321

Query: 1027 PRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVF 1206
            PRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQV GN++AITFAGASGQFELNVF
Sbjct: 322  PRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVF 381

Query: 1207 KPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAA 1386
            KPVM            DASYSFRVHCVDGI ANR+ I KL+HESLMLVTALNPKIGYDAA
Sbjct: 382  KPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAA 441

Query: 1387 SKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPKP 1515
            SKVAKNAHK GITLK+SAL L +LT  EFD WVVPE+MIGPKP
Sbjct: 442  SKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPKP 484

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
            highly similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262W FUM1 Fumarase converts fumaric acid to L-malic
            acid in the TCA cycle cytosolic and mitochondrial
            localization determined by the N-terminal mitochondrial
            targeting sequence and protein conformation
          Length = 492

 Score =  743 bits (1919), Expect = 0.0
 Identities = 372/471 (78%), Positives = 410/471 (87%)
 Frame = +1

Query: 100  LHTTTPWLQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGIL 279
            + T++   Q+ RVETDAFGEI VPADKYWGAQTQRS ENF+IGG RERMPE VV AFGIL
Sbjct: 22   ISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAFGIL 81

Query: 280  KKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVIS 459
            KK+ A VNE+ G LDPK++  I+QAADEV SGKL DHFPLVVFQTGSGTQSNMNANEVIS
Sbjct: 82   KKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVIS 141

Query: 460  NRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQ 639
            NRAIE++GGK+G+KS+HPNNH N +QSSNDTFP+VMHIAAV  IT  LLP LTAL+DS  
Sbjct: 142  NRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFA 201

Query: 640  KKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAV 819
             KS+EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RVE +L  LK LAQGGTAV
Sbjct: 202  TKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAV 261

Query: 820  GTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIA 999
            GTGLNTK+G+ E +A +V+KETGIDF+TAPNKFEALAAHDA+VE SGALNTLA SLFKIA
Sbjct: 262  GTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKIA 321

Query: 1000 QDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGA 1179
             DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQV GN++AITFAGA
Sbjct: 322  NDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGA 381

Query: 1180 SGQFELNVFKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTAL 1359
            SGQFELNVFKPVM            DA YSFRVHCVDGI+ANR+ IAKLLHESLMLVTAL
Sbjct: 382  SGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLVTAL 441

Query: 1360 NPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPK 1512
            NPKIGYDAASKVAKNAHK GITLKESAL+L +LT+ EFD WVVPE+M+GPK
Sbjct: 442  NPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
            (FUM1) - mitochondrial and cytoplasmic fumarase (fumarate
            hydralase) [contig 186] FULL
          Length = 493

 Score =  738 bits (1905), Expect = 0.0
 Identities = 369/477 (77%), Positives = 414/477 (86%)
 Frame = +1

Query: 85   SQISQLHTTTPWLQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVH 264
            S+   + T++   Q++RVETDAFGEIKVP DK WGAQTQRS ENF+IGGQRERMPE +V 
Sbjct: 17   SKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVK 76

Query: 265  AFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNA 444
            AFGILKK+ A VNE+ G LDPK++  I+ AADEV SGKL DHFPLVVFQTGSGTQSNMNA
Sbjct: 77   AFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNA 136

Query: 445  NEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTAL 624
            NEVISNRAI+L+GG++GSKS+HPNNH N +QSSNDTFP+VMHIAAV  +T  LLP L AL
Sbjct: 137  NEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIAL 196

Query: 625  KDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQ 804
            +D+  KK++EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RVE +L +LK LAQ
Sbjct: 197  RDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQ 256

Query: 805  GGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVS 984
            GGTAVGTGLNTK+G+AE +A +V+KETGIDF+TAPNKFEALAAHDAVVE SGALNTLA S
Sbjct: 257  GGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACS 316

Query: 985  LFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAI 1164
            LFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQV GN++AI
Sbjct: 317  LFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAI 376

Query: 1165 TFAGASGQFELNVFKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLM 1344
            TFAGASGQFELNVFKPVM            DA YSFRVHCV+GIQAN + IAKLLHESLM
Sbjct: 377  TFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLM 436

Query: 1345 LVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPKP 1515
            LVTALNPKIGYDAASKVAKNAHK GITLKESAL+L +L++ EFD WVVPE+M+GPKP
Sbjct: 437  LVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPKP 493

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
            similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262W FUM1 Fumarase converts fumaric acid to L-malic
            acid in the TCA cycle cytosolic and mitochondrial
            localization determined by the N-terminal mitochondrial
            targeting sequence and protein conformation
          Length = 492

 Score =  737 bits (1903), Expect = 0.0
 Identities = 374/498 (75%), Positives = 428/498 (85%), Gaps = 1/498 (0%)
 Frame = +1

Query: 22   VLKNSCVCQ-VSSPRLTSKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPADKYWGAQT 198
            +L+NS V + ++  R+++K  +++++ L   +     +RVETDAFGEI+VP+DKYWGAQT
Sbjct: 1    MLRNSIVSRGLAQTRVSAK--VNRLASLRMVS-----YRVETDAFGEIQVPSDKYWGAQT 53

Query: 199  QRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGK 378
            QRS +NF+IGG RERMPE +V AFG+LKK+ A VNE  G LDP++A  IKQAADEVA GK
Sbjct: 54   QRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGK 113

Query: 379  LKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFP 558
            L +HFPLVVFQTGSGTQSNMNANEVISNRAIEL+GG+LGSK +HPNNH N +QSSNDTFP
Sbjct: 114  LMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFP 173

Query: 559  TVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYV 738
            +VMHIAAV  IT  LLP L  LK +L++KS+EF  IVKIGRTHLQDATPLTLGQEFSGYV
Sbjct: 174  SVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYV 233

Query: 739  QQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKF 918
            QQV NGI RV+ +L  LK LAQGGTAVGTGLNTK+G+AE++A +V+KETGIDF+TAPNKF
Sbjct: 234  QQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKF 293

Query: 919  EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 1098
            EALAAHDAVVEASGALNTLAVSLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKV
Sbjct: 294  EALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 353

Query: 1099 NPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKPVMXXXXXXXXXXXXDASYSFRV 1278
            NPTQNEA+TQVCVQV GNH+AITFAGASGQFELNVFKPVM            DAS SFR+
Sbjct: 354  NPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRI 413

Query: 1279 HCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNIL 1458
            HCV+GI+AN + IAKLLHESLMLVTALNPKIGYDAASKVAKNAHK GITLKESAL+L +L
Sbjct: 414  HCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVL 473

Query: 1459 TAEEFDHWVVPEHMIGPK 1512
            ++EEFD WV+PE MIGPK
Sbjct: 474  SSEEFDQWVIPEKMIGPK 491

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
            Ashbya gossypii ACR013C
          Length = 489

 Score =  729 bits (1883), Expect = 0.0
 Identities = 365/483 (75%), Positives = 408/483 (84%), Gaps = 2/483 (0%)
 Frame = +1

Query: 67   TSKTPMSQISQ--LHTTTPWLQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRE 240
            + K P  +I+   + TT    Q+ R+ETDAFGEIKVPA+KYWGAQTQRS ENF+IGG RE
Sbjct: 5    SKKIPAKRIADRMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRE 64

Query: 241  RMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGS 420
            RMPE ++ AFGILKK+ A VNE+ G LDPK++  I+QAADEV  GKL DHFPLVVFQTGS
Sbjct: 65   RMPEPIIKAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGS 124

Query: 421  GTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKD 600
            GTQSNMNANEVISNRAIEL+GG+LG+K +HPNNH N +QSSNDTFP+VMHIAAV  IT  
Sbjct: 125  GTQSNMNANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNT 184

Query: 601  LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 780
            LLP LTAL+DS QKK+EEF+ IVKIGRTHLQDATPLTLGQEF GY QQ+ NGI RVE +L
Sbjct: 185  LLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSL 244

Query: 781  DSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASG 960
              LK LAQGGTAVGTGLNTK+G+AE +A +V+KET I+F+TAPNKFEALAAHDAVVE SG
Sbjct: 245  HHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSG 304

Query: 961  ALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQ 1140
            ALNT+A SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQ
Sbjct: 305  ALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQ 364

Query: 1141 VFGNHSAITFAGASGQFELNVFKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIA 1320
            V GN+S ITFAGASGQFELNVFKPVM            DASYSFRVHCVDGI+AN + IA
Sbjct: 365  VMGNNSTITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIA 424

Query: 1321 KLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHM 1500
            K+LHESLMLVTALNPKIGYD+A KVAKNAHK  ITLKESAL+L +L+ EEF  WVVPE M
Sbjct: 425  KILHESLMLVTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKM 484

Query: 1501 IGP 1509
            IGP
Sbjct: 485  IGP 487

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YPL262W
            (FUM1)
          Length = 488

 Score =  726 bits (1875), Expect = 0.0
 Identities = 368/476 (77%), Positives = 407/476 (85%)
 Frame = +1

Query: 85   SQISQLHTTTPWLQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVH 264
            S   +L +T    Q+ RVETDAFGEI+VPADKYWGAQTQRS ENFRIGG RERMPE VV 
Sbjct: 12   SAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVR 71

Query: 265  AFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNA 444
            AFG+LKK+ A VNE  G L+P +A AI+QAADEVA G+L +HFPLVVFQTGSGTQSNMNA
Sbjct: 72   AFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNA 131

Query: 445  NEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTAL 624
            NEVISNRAIELLGG+LGSK VHPNNH N +QSSNDTFP+VMHIAAV  IT+ LLP L AL
Sbjct: 132  NEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEAL 191

Query: 625  KDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQ 804
            + S Q+K++EFA IVKIGRTHLQDATPLTLGQEFSGY QQ+ANGI RVE   +SL+ LAQ
Sbjct: 192  RVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQ 251

Query: 805  GGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVS 984
            GGTAVGTGLNT+ G+AE +AA+V++ETG++F+TAPNKFEALAAHDAVVEASGALNTLA S
Sbjct: 252  GGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACS 311

Query: 985  LFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAI 1164
            LFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQ CVQV GN++AI
Sbjct: 312  LFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAI 371

Query: 1165 TFAGASGQFELNVFKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLM 1344
            TFAGASGQFELNVFKPVM            DA+ SFRVHCVDGIQ N + IAKLLHESLM
Sbjct: 372  TFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLM 431

Query: 1345 LVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPK 1512
            LVTALNPKIGYDAAS VAKNAHK GITL+ SAL+L +LT  EFD WVVPE MIGP+
Sbjct: 432  LVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 487

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
            highly similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  720 bits (1858), Expect = 0.0
 Identities = 356/463 (76%), Positives = 400/463 (86%)
 Frame = +1

Query: 121  LQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATV 300
            +  +RVETD FGEIKVPADKYWGAQTQRSF+NF+IGG RERMPE +V AFG+LKK+ A V
Sbjct: 19   MMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSAAIV 78

Query: 301  NEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELL 480
            NE  G LD ++A  I+QAADEVA GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIEL+
Sbjct: 79   NEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELI 138

Query: 481  GGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFA 660
            GG+LGSK +HPNNH N +QSSNDTFP+VMHIAAV  IT  LLP +T LKD+L KK+EEF 
Sbjct: 139  GGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQ 198

Query: 661  DIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTK 840
            DIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+E+TL  LK LAQGGTAVGTGLNTK
Sbjct: 199  DIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTK 258

Query: 841  IGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLG 1020
             G+ + +A +++KETGIDF+TAPNKFEALAAHDA+VEASGALNT+A SLFKIAQDIRYLG
Sbjct: 259  EGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLG 318

Query: 1021 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELN 1200
            SGPRCGYGEL LPENEPGSSIMPGKVNPTQNEA+TQVCVQV GN++A+TFAGA+GQFELN
Sbjct: 319  SGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFELN 378

Query: 1201 VFKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYD 1380
            VFKPVM            DA +SFRVHCV+GI+ANRE I   LH SLMLVTALNPKIGYD
Sbjct: 379  VFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIGYD 438

Query: 1381 AASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGP 1509
            AASK+AKNA K  ITLKESAL+L  LT+EEFD WV+PE+M+GP
Sbjct: 439  AASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] {ON}
            complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  719 bits (1857), Expect = 0.0
 Identities = 359/463 (77%), Positives = 399/463 (86%)
 Frame = +1

Query: 121  LQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATV 300
            L+  RVETD FGEIKVPA+KYWGAQT+RSFENF+IGG RERMPEAVV AFG+LKK  A V
Sbjct: 21   LKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIV 80

Query: 301  NEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELL 480
            N   G LDP  +  I+QAADEVA+GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIEL 
Sbjct: 81   NTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELK 140

Query: 481  GGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFA 660
            GG LGSK +HPNNH NM+QSSNDTFPTVMHIAAV  I++ LLP LT L+D+L  KS EF 
Sbjct: 141  GGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFE 200

Query: 661  DIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTK 840
             IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+E    +L+ LAQGGTAVGTGLNTK
Sbjct: 201  HIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTK 260

Query: 841  IGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLG 1020
             GWAE +AAE++KETG+ F+TAPNKFEALAAHDA+VEASGALNT+A SLFKIAQDIRYLG
Sbjct: 261  NGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLG 320

Query: 1021 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELN 1200
            SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQV GN++A+TFAGASGQFELN
Sbjct: 321  SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELN 380

Query: 1201 VFKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYD 1380
            VFKPV+            DAS SFRVHCV+GI+AN   I++LLH SLMLVTALNPKIGYD
Sbjct: 381  VFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYD 440

Query: 1381 AASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGP 1509
            AA+KVAKNAHK GITLKESAL+L +LT +EFD WVVPE M+GP
Sbjct: 441  AATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
            [1404 nt, 468 aa]
          Length = 467

 Score =  715 bits (1846), Expect = 0.0
 Identities = 356/459 (77%), Positives = 398/459 (86%)
 Frame = +1

Query: 133  RVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEAN 312
            R+ETD FGEIKVPADKYWGAQTQRS+ENF+IGG RERMPE VV AFG+LKK+ A VNE  
Sbjct: 8    RLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEEF 67

Query: 313  GQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKL 492
            G LD  ++  I+QAADEV  GKL +HFPLVVFQTGSGTQSNMNANEVISNRAIEL GG +
Sbjct: 68   GILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGIM 127

Query: 493  GSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVK 672
            GSK +HPNNH NM+QSSNDTFPTVMHIAAV  IT  L+P +T LKD+L  KS+EF  IVK
Sbjct: 128  GSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIVK 187

Query: 673  IGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWA 852
            IGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+E +L +LK LAQGGTAVGTGLNTKIG+A
Sbjct: 188  IGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGFA 247

Query: 853  ENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPR 1032
            E +A +V+KETGI+F+TAPNKFEALAAHDA+VE+SGALNT+A SLFKIAQDIRYLGSGPR
Sbjct: 248  ERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPR 307

Query: 1033 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKP 1212
            CGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQV GN++AITFAGASGQFELNVFKP
Sbjct: 308  CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 367

Query: 1213 VMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASK 1392
            VM            DA +SF +HCV+GIQAN + I KLLHESLMLVTALNPKIGYD+A+K
Sbjct: 368  VMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSATK 427

Query: 1393 VAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGP 1509
            VAKNAHK GITLKESAL+L +LT +EFD WVVPE M+GP
Sbjct: 428  VAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
            converts fumaric acid to L-malic acid in the TCA cycle;
            cytosolic and mitochondrial distribution determined by
            the N-terminal targeting sequence, protein conformation,
            and status of glyoxylate shunt; phosphorylated in
            mitochondria
          Length = 488

 Score =  716 bits (1848), Expect = 0.0
 Identities = 359/460 (78%), Positives = 398/460 (86%)
 Frame = +1

Query: 133  RVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEAN 312
            R ETDAFGEI VPADKYWGAQTQRSF+NF+IGG RERMP  +VHAFG+LKK+ A VNE+ 
Sbjct: 29   RTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESL 88

Query: 313  GQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKL 492
            G LDPK++ AI+QAADEVASGKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE+LGGK+
Sbjct: 89   GGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148

Query: 493  GSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVK 672
            GSK VHPNNH N SQSSNDTFPTVMHIAA L I  +L+P LT LK++L+ KS+EF  IVK
Sbjct: 149  GSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFDHIVK 208

Query: 673  IGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWA 852
            IGRTHLQDATPLTLGQEFSGYVQQV NGI+RV  +L +L  LAQGGTAVGTGLNTK G+ 
Sbjct: 209  IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFD 268

Query: 853  ENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPR 1032
              +A +++KETG+ FQTAPNKFEALAAHDA+VE SGALNTLA SLFKIAQDIRYLGSGPR
Sbjct: 269  VKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328

Query: 1033 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKP 1212
            CGY EL LPENEPGSSIMPGKVNPTQNEALTQVCVQV GN++AITFAG+ GQFELNVFKP
Sbjct: 329  CGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKP 388

Query: 1213 VMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASK 1392
            VM            DA+YSFRVHCV+GI+AN   I +LL +SLMLVTALNPKIGYDAASK
Sbjct: 389  VMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448

Query: 1393 VAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPK 1512
            VAKNAHK GITLKESAL+L +LT +EFD WVVPEHM+GPK
Sbjct: 449  VAKNAHKKGITLKESALELGVLTEKEFDEWVVPEHMLGPK 488

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
            Anc_6.13 YPL262W
          Length = 493

 Score =  713 bits (1841), Expect = 0.0
 Identities = 354/477 (74%), Positives = 408/477 (85%)
 Frame = +1

Query: 85   SQISQLHTTTPWLQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVH 264
            S++S   TT    Q++R+ETD+FGEIKVPADKYWGAQTQRSF+NF+IGG RER+P+ ++ 
Sbjct: 17   SRMSLSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIIT 76

Query: 265  AFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNA 444
            AFGILKK+ A VNE+ G LDPK+A  IK+AADEV  GKLKDHFPLVVFQTGSGTQ+NMN 
Sbjct: 77   AFGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNV 136

Query: 445  NEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTAL 624
            NEVISNRAIEL+GGKLGSK +HPNNH N SQSSNDTFP+VMHIAAVL IT  L+P LT L
Sbjct: 137  NEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKL 196

Query: 625  KDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQ 804
            KD+L  K++EFADIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+ES+L  LK LAQ
Sbjct: 197  KDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQ 256

Query: 805  GGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVS 984
            GGTAVGTGLNTKIG+ + +A EV+KETGI+F+TAPNKFEALAAHDA+V ASGALNT+A S
Sbjct: 257  GGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGS 316

Query: 985  LFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAI 1164
            LFKIAQDIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEA+TQVCVQ+ GN+  I
Sbjct: 317  LFKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTI 376

Query: 1165 TFAGASGQFELNVFKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLM 1344
            + AG+ GQFELNV+KP+M            DA  SFR+HC+D ++AN++ I + L++SLM
Sbjct: 377  SIAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLM 436

Query: 1345 LVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPKP 1515
            LVTALNPKIGYDAASK+AKNAH   ITLKESAL+L  LTAEEFD WVVPE+MIGPKP
Sbjct: 437  LVTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPKP 493

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (REAL)
          Length = 488

 Score =  711 bits (1834), Expect = 0.0
 Identities = 355/460 (77%), Positives = 397/460 (86%)
 Frame = +1

Query: 133  RVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEAN 312
            R+ETDAFGEI VPADKYWGAQTQRSF+NF+IGG RERMP  +VHAFG+LKK+ A VNE+ 
Sbjct: 29   RIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNESL 88

Query: 313  GQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKL 492
            G LDPK++ AI+QAADEV SGKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE+LGGK+
Sbjct: 89   GGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148

Query: 493  GSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVK 672
            GSK VHPNNH N SQSSNDTFPTVMHIAA L I  +L+P LT LK++L+ KS+EF  IVK
Sbjct: 149  GSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIVK 208

Query: 673  IGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWA 852
            IGRTHLQDATPLTLGQEFSGYVQQV NGI+RV  +L +L  LAQGGTAVGTGLNTK G+ 
Sbjct: 209  IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFD 268

Query: 853  ENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPR 1032
              +A +++ ETG+ FQTAPNKFEALAAHDA+VE SGALNTLA SLFKIAQDIRYLGSGPR
Sbjct: 269  IKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328

Query: 1033 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKP 1212
            CGY EL LPENEPGSSIMPGKVNPTQNEALTQVCVQV GN++AITFAG+ GQFELNVFKP
Sbjct: 329  CGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKP 388

Query: 1213 VMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASK 1392
            VM            D++YSFRVHCV+GI+AN   I +LL +SLMLVTALNPKIGYDAASK
Sbjct: 389  VMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448

Query: 1393 VAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPK 1512
            VAKNAHK GITLKESAL+L +LT +EFD WVVPE+M+GPK
Sbjct: 449  VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
            YPL262W (REAL)
          Length = 488

 Score =  711 bits (1834), Expect = 0.0
 Identities = 356/460 (77%), Positives = 397/460 (86%)
 Frame = +1

Query: 133  RVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEAN 312
            R ETDAFGEI VPADKYWGAQTQRSF+NF+IGG RERMP  +VHAFG+LKK+ A VNE+ 
Sbjct: 29   RTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESL 88

Query: 313  GQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKL 492
            G LDPK++ AI++AADEVASGKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE+LGGK+
Sbjct: 89   GGLDPKISKAIQEAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148

Query: 493  GSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVK 672
            GSK VHPNNH N SQSSNDTFPTVMHIAA L I  +L+P L  LK++L+ KS+EF  IVK
Sbjct: 149  GSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELANLKNALEAKSKEFDHIVK 208

Query: 673  IGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWA 852
            IGRTHLQDATPLTLGQEFSGYVQQV NGI+RV  +L +L  LAQGGTAVGTGLNTK G+ 
Sbjct: 209  IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFD 268

Query: 853  ENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPR 1032
              +A +++KETG+ FQTAPNKFEALAAHDA+VE SGALNTLA SLFKIAQDIRYLGSGPR
Sbjct: 269  VKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328

Query: 1033 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKP 1212
            CGY EL LPENEPGSSIMPGKVNPTQNEALTQVCVQV GN++AITFAG+ GQFELNVFKP
Sbjct: 329  CGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKP 388

Query: 1213 VMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASK 1392
            VM            DA+YSFRVHCV+GI+AN   I +LL +SLMLVTALNPKIGYDAASK
Sbjct: 389  VMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448

Query: 1393 VAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPK 1512
            VAKNAHK GITLKESAL+L +LT +EFD WVVPE+M+GPK
Sbjct: 449  VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (REAL)
          Length = 488

 Score =  709 bits (1830), Expect = 0.0
 Identities = 356/460 (77%), Positives = 396/460 (86%)
 Frame = +1

Query: 133  RVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEAN 312
            R ETDAFGEI VPADKYWGAQTQRSF+NF+IGG RERMP  +VHAFG+LKK+ A VNE+ 
Sbjct: 29   RTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESL 88

Query: 313  GQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKL 492
            G LDPK++ AI+QAADEVA+GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE+LGGK+
Sbjct: 89   GGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148

Query: 493  GSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVK 672
            GSK VHPNN  N SQSSNDTFPTVMHIAA L I K+L+P LT LK++L+ KS+EF  IVK
Sbjct: 149  GSKQVHPNNDCNQSQSSNDTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVK 208

Query: 673  IGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWA 852
            IGRTHLQDATPLTLGQEFSGYVQQV NGI+RV  TL +L  LAQGGTAVGTGLNTK G+ 
Sbjct: 209  IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFD 268

Query: 853  ENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPR 1032
              +A +++KETG+ FQTAPNKFEALAAHDA+VE SGALNTLA SLFKIAQDIRYLGSGPR
Sbjct: 269  VKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328

Query: 1033 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKP 1212
            CGY EL LPENEPGSSIMPGKVNPTQNEALTQVCVQV GN++AITF G+ GQFELNVFKP
Sbjct: 329  CGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNVFKP 388

Query: 1213 VMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASK 1392
            VM            DAS SFR+HCV+GI+AN   I +LL +SLMLVTALNPKIGYDAASK
Sbjct: 389  VMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448

Query: 1393 VAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPK 1512
            VAKNAHK GITLKESAL+L +LT +EFD WVVPE+M+GPK
Sbjct: 449  VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
            YPL262W
          Length = 495

 Score =  704 bits (1818), Expect = 0.0
 Identities = 349/476 (73%), Positives = 401/476 (84%)
 Frame = +1

Query: 85   SQISQLHTTTPWLQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVH 264
            S  S+ +T +      R ETD+FGEI VP DKYWGAQTQRS +NF+IGG+RE++P  ++ 
Sbjct: 19   SYTSRFYTMSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIE 78

Query: 265  AFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNA 444
            AFGILKK+ A VNE  G LD +LA  I  AADEV+ GKL DHFPLVVFQTGSGTQSNMNA
Sbjct: 79   AFGILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNA 138

Query: 445  NEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTAL 624
            NEVISNRAIEL+GGKLGSK+VHPNNH+N SQSSNDTFPTVMHIAA+L IT+ LLP L +L
Sbjct: 139  NEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSL 198

Query: 625  KDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQ 804
            K+SL KKS EF DIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+E+ L  LK LAQ
Sbjct: 199  KNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQ 258

Query: 805  GGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVS 984
            GGTAVGTGLNTK G+ + +A ++++ETGI+F+TAPNKFEALAAHDA+VE SGALNTLA S
Sbjct: 259  GGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACS 318

Query: 985  LFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAI 1164
            LFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVC+QV GNHS I
Sbjct: 319  LFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTI 378

Query: 1165 TFAGASGQFELNVFKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLM 1344
            TFAG+ GQFELNV+KP++            DASYSFRVHC+DG++ANRENI + L++SLM
Sbjct: 379  TFAGSQGQFELNVYKPLLISNLLSSIRLLTDASYSFRVHCIDGLKANRENITENLNKSLM 438

Query: 1345 LVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPK 1512
            LVTALNP IGYD ASK+AKNAH   ITLKESAL+L +LT E+F  WV+PE MIGPK
Sbjct: 439  LVTALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPK 494

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
            YPL262W
          Length = 496

 Score =  702 bits (1812), Expect = 0.0
 Identities = 349/488 (71%), Positives = 401/488 (82%), Gaps = 3/488 (0%)
 Frame = +1

Query: 58   PRLTSKTPMSQISQLHTTTPWLQEH---RVETDAFGEIKVPADKYWGAQTQRSFENFRIG 228
            PR        Q + +H +   L +    R+ETD FGEIKVPA+KYWGAQT+RSFENFRIG
Sbjct: 9    PRGVKSVAKVQKTGMHQSMRCLSDEAGFRIETDGFGEIKVPANKYWGAQTERSFENFRIG 68

Query: 229  GQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVF 408
            G RERMP+ VV AFG+LKK+ A VNE  G LDP+++  I++AADEV  GKL DHFPLVVF
Sbjct: 69   GPRERMPDPVVKAFGVLKKSAAIVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVF 128

Query: 409  QTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLA 588
            QTGSGTQSNMNANEVISNRAIELLGG LGSK VHPNNH+N +QSSND+FPTVMHIAAV  
Sbjct: 129  QTGSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTE 188

Query: 589  ITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRV 768
            IT  L+P +  L+D+L+ KS++FA IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+
Sbjct: 189  ITDHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRI 248

Query: 769  ESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVV 948
            E +L +LK LAQGGTAVGTGLNT+IG+AE +A +++KETG+ F+TAPNKFEALAAHDA+V
Sbjct: 249  EHSLINLKFLAQGGTAVGTGLNTRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIV 308

Query: 949  EASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQ 1128
            EASGA+ T+A SLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQ
Sbjct: 309  EASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQ 368

Query: 1129 VCVQVFGNHSAITFAGASGQFELNVFKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANR 1308
            VC Q+ GN+  I FAG  GQFELNVFKPVM            D S SFR+HCV+GI+AN 
Sbjct: 369  VCAQIIGNNQTIIFAGTQGQFELNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANE 428

Query: 1309 ENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVV 1488
            E IA L+++SLMLVTALNPKIGYD A+KVAKNAHK GITLKESA+QL  LT  EFD WVV
Sbjct: 429  ERIADLMNKSLMLVTALNPKIGYDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVV 488

Query: 1489 PEHMIGPK 1512
            PE MIGPK
Sbjct: 489  PEKMIGPK 496

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
            YPL262W
          Length = 498

 Score =  701 bits (1810), Expect = 0.0
 Identities = 351/464 (75%), Positives = 395/464 (85%)
 Frame = +1

Query: 124  QEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVN 303
            QE RVETD+FGEI VPAD+YWGAQTQRSF+NF+IGG RE++PE VV AFGILKK+ ATVN
Sbjct: 35   QEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFGILKKSAATVN 94

Query: 304  EANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLG 483
            E  G LD  +A  IK AADEVA GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIELLG
Sbjct: 95   ENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIELLG 154

Query: 484  GKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFAD 663
            G+LGSK VHPNNH+N SQSSNDTFPTVMHIAA   I   L+P L  LKD+LQ K EEF+ 
Sbjct: 155  GELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSS 214

Query: 664  IVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKI 843
            IVKIGRTHLQDATPLTLGQEFSGYVQQV NGI+RV+S+L  L  LAQGGTAVGTGLNTK+
Sbjct: 215  IVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKV 274

Query: 844  GWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGS 1023
            G+ + VA EV+KETG+ F+TAPNKFEALAAHDA+VEASGALNTLA SLFKIAQDIRYLGS
Sbjct: 275  GFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGS 334

Query: 1024 GPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNV 1203
            GPRCGYGEL LP NEPGSSIMPGKVNPTQNEA+TQVCVQV GN+S ITFAG+ GQFELNV
Sbjct: 335  GPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNV 394

Query: 1204 FKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDA 1383
            +KP+M            DAS SFR+HC++ ++AN++ I + L++SLMLVTALNPKIGYDA
Sbjct: 395  YKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVTALNPKIGYDA 454

Query: 1384 ASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPKP 1515
            A+KVAKNAH   ITLKESAL+L +LT +EFD WV+PE+MI PKP
Sbjct: 455  AAKVAKNAHHKNITLKESALELGVLTEKEFDEWVIPENMISPKP 498

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
            Anc_6.13 YPL262W
          Length = 475

 Score =  681 bits (1756), Expect = 0.0
 Identities = 334/482 (69%), Positives = 401/482 (83%)
 Frame = +1

Query: 70   SKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMP 249
            SKTP ++ S            RVETD+FGEIKVP++KYWGAQTQRSF+NF+IGG+RE++P
Sbjct: 5    SKTPSNESS-----------FRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIP 53

Query: 250  EAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQ 429
              ++ AFGILKK+ A VN++ G LDP +A  I +A+DEV  GKL DHFPLVVFQTGSGTQ
Sbjct: 54   LPIIKAFGILKKSAAIVNQSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQ 113

Query: 430  SNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLP 609
            +NMNANEVISNRA EL+G +LGSK +HPNNH+N SQSSNDTFP+VMHIAAVL +  +L+P
Sbjct: 114  TNMNANEVISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIP 173

Query: 610  NLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSL 789
             LT LK+SL  K++E+A+IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R++++L  L
Sbjct: 174  QLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHL 233

Query: 790  KLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALN 969
            K LAQGGTAVGTGLNTK+G+ + +A EV+KETGIDF+TAPNKFEALAAHDA+V AS A+ 
Sbjct: 234  KFLAQGGTAVGTGLNTKVGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAIT 293

Query: 970  TLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFG 1149
            T+A SLFKIAQDIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEA+TQV +Q+ G
Sbjct: 294  TVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMG 353

Query: 1150 NHSAITFAGASGQFELNVFKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLL 1329
            N+  I  AG+ GQFELNV+KP+M            DA +SF++HCVDG++AN + I + L
Sbjct: 354  NNQTIVMAGSQGQFELNVYKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENL 413

Query: 1330 HESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGP 1509
            H+SLMLVTALNPKIGYDAASK+AKNAH   ITLKESAL+L +LT EEFD WV+PE+MIGP
Sbjct: 414  HKSLMLVTALNPKIGYDAASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGP 473

Query: 1510 KP 1515
            KP
Sbjct: 474  KP 475

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
            YPL262W
          Length = 465

 Score =  664 bits (1714), Expect = 0.0
 Identities = 324/463 (69%), Positives = 390/463 (84%)
 Frame = +1

Query: 121  LQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATV 300
            + E R+E D FGE++VPA+KYWGAQTQR+  NF IGG+RERMPE ++ A+GILKK+ A V
Sbjct: 1    MPETRIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIV 60

Query: 301  NEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELL 480
            NE+ G LDPK++ AI++AADEVA G L +HFPLVVFQTGSGTQ+NMN NEVISNRAIE+L
Sbjct: 61   NESLGTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEIL 120

Query: 481  GGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFA 660
            GG+LGSK+VHPNNH+N SQS+ND+FPT MHI+AV  +   LLP L  L+D+L+ KS EF 
Sbjct: 121  GGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFN 180

Query: 661  DIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTK 840
             IVKIGRTHLQDATPLTLGQEFSGYVQQV NGI RV+++L +LK +AQGGTAVGTG+NTK
Sbjct: 181  KIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTK 240

Query: 841  IGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLG 1020
              +   VA +++ ETGI+F+TAPNKFEALA+HDA+VE SGALNTLA SLFKI+QDIR+LG
Sbjct: 241  KDFDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLG 300

Query: 1021 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELN 1200
            SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+ Q C+QV GN+SAITFAGASGQFELN
Sbjct: 301  SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELN 360

Query: 1201 VFKPVMXXXXXXXXXXXXDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYD 1380
             +KP+M            D+  SFR+HC+ GI+AN + I KLL+ESLMLVTALNPKIGYD
Sbjct: 361  TYKPLMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYD 420

Query: 1381 AASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGP 1509
            AA+ +AK+AHKNG+TLKE+AL+  +LTAE+FD W+VPE M+ P
Sbjct: 421  AATAIAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
            YPL262W
          Length = 500

 Score =  664 bits (1712), Expect = 0.0
 Identities = 337/500 (67%), Positives = 397/500 (79%)
 Frame = +1

Query: 10   LSSNVLKNSCVCQVSSPRLTSKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPADKYWG 189
            +S N+ +N   CQ    R  S TP+S     H+    LQ  R ETD+FGEI+VPA+KYWG
Sbjct: 13   VSLNIFRN---CQ----RSFSITPVS-----HSIAD-LQGTRTETDSFGEIQVPANKYWG 59

Query: 190  AQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAADEVA 369
            AQTQRSF NF+IGG+RERMPE ++ AFG  KKA A VN + G LD  L  AI QAA+EV+
Sbjct: 60   AQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNSLGTLDDTLKDAIVQAAEEVS 119

Query: 370  SGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSND 549
             G L +HFPLVVFQTGSGTQSNMNANEVISNRAIELLGG LGSK VHPNNH+N SQSSND
Sbjct: 120  QGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSND 179

Query: 550  TFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFS 729
            TFPTVMHIAA+  IT  LLPNL  L+++L  K++EF  I+KIGRTHLQDATPLTLGQEFS
Sbjct: 180  TFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFS 239

Query: 730  GYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAP 909
            GY QQ+ N IKR+E  L  L+ +AQGGTAVGTGLNTKIG+AE  A +++ +T + F T+P
Sbjct: 240  GYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSP 299

Query: 910  NKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMP 1089
            NKFE+LAAHDA+V    +LNTLA SLFKI+QDIRYL SGPRCGYGELS+PENEPGSSIMP
Sbjct: 300  NKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMP 359

Query: 1090 GKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKPVMXXXXXXXXXXXXDASYS 1269
            GKVNPTQNEA+ Q CVQV GN+S I+FAGASGQFELN +KP+M            DA +S
Sbjct: 360  GKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANLLSSTRLLSDAIFS 419

Query: 1270 FRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESALQL 1449
            F +HC  GIQAN++ I +LLHESLMLVT+LNPKIGYDAASKVAKNAH  GITLK+SAL+L
Sbjct: 420  FNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASKVAKNAHHKGITLKQSALEL 479

Query: 1450 NILTAEEFDHWVVPEHMIGP 1509
            +IL++++FD WV PE+M+GP
Sbjct: 480  DILSSKQFDEWVRPENMLGP 499

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
            highly similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018C ARG4 Argininosuccinate lyase catalyzes the final
            step in the arginine biosynthesis pathway
          Length = 461

 Score = 60.5 bits (145), Expect = 5e-09
 Identities = 75/298 (25%), Positives = 121/298 (40%), Gaps = 1/298 (0%)
 Frame = +1

Query: 259  VHAFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNM 438
            V+  G+ K    T +E +     K+   +KQ   E + G          F   +  +   
Sbjct: 43   VYTSGLQKIGLLTEDELS-----KIHAGLKQIEQEWSDGS---------FVREADDEDIH 88

Query: 439  NANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLT 618
             ANE    R  E++G  +  K       ++  +S ND   T M I     +   +LP L+
Sbjct: 89   TANE---RRLGEIIGRGIAGK-------VHTGRSRNDQVATDMRIYCRDILNGTVLPALS 138

Query: 619  ALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLL 798
            +L   + +++EE  D++  G THLQ A P+      S Y        KR++  ++ L + 
Sbjct: 139  SLIKVILQRAEEEIDVLMPGYTHLQRAQPIRWAHWLSCYATYFTEDYKRLQQIVERLNVS 198

Query: 799  AQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ-TAPNKFEALAAHDAVVEASGALNTL 975
              G  A+        G    +  E     G++F     N   A+A  D VVE     +  
Sbjct: 199  PLGAGALA-------GHPYGIDREFL-AAGLNFNGVIGNSLTAVADRDFVVEIMFWGSLF 250

Query: 976  AVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFG 1149
               + + A+D+  + S    G+ +LS      GSS+MP K NP   E L     +VFG
Sbjct: 251  MNHISRFAEDL-IIYSTAEFGFIQLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 306

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1.354
            YHR018C
          Length = 462

 Score = 60.5 bits (145), Expect = 5e-09
 Identities = 68/261 (26%), Positives = 107/261 (40%), Gaps = 1/261 (0%)
 Frame = +1

Query: 373  GKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDT 552
            G++K  +    F      +    ANE    R  E++G  +  K       ++  +S ND 
Sbjct: 68   GEIKKEWDEDKFVRHPNDEDIHTANE---RRLGEIIGRDIAGK-------VHTGRSRNDQ 117

Query: 553  FPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSG 732
              T + I     + + L P +T+L + L K++EE  DI+  G THLQ A P+      S 
Sbjct: 118  CVTDLRIYCRDVLNEKLFPGMTSLIEVLIKRAEEEIDILMPGYTHLQRAQPIRWSHWLSS 177

Query: 733  YVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ-TAP 909
            Y       +KR++  L+       G  A+        G    +  E   E G+ F     
Sbjct: 178  YATYFTEDLKRLKQILERFNKSPLGAGALA-------GHPYGIDREFLAE-GLGFDGVIG 229

Query: 910  NKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMP 1089
            N   A++  D VVE           + + A+D+  + S    G+ +LS      GSS+MP
Sbjct: 230  NSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-VIYSTAEFGFIKLS-DAYSTGSSLMP 287

Query: 1090 GKVNPTQNEALTQVCVQVFGN 1152
             K N    E L     +VFG+
Sbjct: 288  QKKNADSLELLRGKSGRVFGD 308

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa] {ON}
            complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 57.4 bits (137), Expect = 5e-08
 Identities = 69/242 (28%), Positives = 97/242 (40%), Gaps = 1/242 (0%)
 Frame = +1

Query: 442  ANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTA 621
            ANE    R  EL+G  +  K       ++  +S ND   T + I     I   LLP+L +
Sbjct: 89   ANE---RRLGELIGTDISGK-------VHTGRSRNDQCVTDLRIYCRDIIQDKLLPSLKS 138

Query: 622  LKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLA 801
            L   L K+ E    I+  G THLQ A P+      S Y        KR++  LD L +  
Sbjct: 139  LIQVLVKRGEGEIGILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQLLDRLNVSP 198

Query: 802  QGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ-TAPNKFEALAAHDAVVEASGALNTLA 978
             G  A+        G    +  E     G+ F     N   A++  D VVE         
Sbjct: 199  LGAGALA-------GHPYGIDREFL-ANGLGFNGVIGNSLVAVSDRDFVVELLFWGTLFM 250

Query: 979  VSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHS 1158
              + + A+D+  + S    G+  LS      GSS+MP K N    E L     +VFGN S
Sbjct: 251  NHISRFAEDL-IIYSTAEFGFITLS-DAYSTGSSLMPQKKNSDSLELLRGKSGRVFGNLS 308

Query: 1159 AI 1164
             +
Sbjct: 309  GL 310

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
            YHR018C
          Length = 463

 Score = 57.0 bits (136), Expect = 6e-08
 Identities = 66/242 (27%), Positives = 100/242 (41%), Gaps = 1/242 (0%)
 Frame = +1

Query: 442  ANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTA 621
            ANE    R  E++G K+  K       ++  +S ND   T + I     ++  LL NL  
Sbjct: 91   ANE---RRLGEIIGTKISGK-------VHTGRSRNDQCVTDLRIYCREYLSDKLLKNLET 140

Query: 622  LKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLA 801
            L + L  ++EE  + +  G THLQ A P+      S Y        KR+    + L    
Sbjct: 141  LINVLINRAEEEIEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERLNKSP 200

Query: 802  QGGTAVGTGLNTKIGWAENVAAE-VAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLA 978
             G  A+        G    +  E +A++ G D     N   A++  D VVE         
Sbjct: 201  LGAGALA-------GHPYGIDREYLAEKLGFD-SVIGNSLVAVSDRDFVVEILFWSTLFM 252

Query: 979  VSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHS 1158
              + + A+D+  + S    G+ +LS      GSS+MP K N    E L     +VFGN S
Sbjct: 253  NHISRFAEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGNLS 310

Query: 1159 AI 1164
             +
Sbjct: 311  GL 312

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
            highly similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018c ARLY
          Length = 461

 Score = 56.6 bits (135), Expect = 8e-08
 Identities = 72/301 (23%), Positives = 117/301 (38%), Gaps = 1/301 (0%)
 Frame = +1

Query: 259  VHAFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNM 438
            V+  G+ K    T +E       K+   +K   +E   GK   H            +S+ 
Sbjct: 45   VYTAGLTKLGLITESEL-----AKIHSGLKDIENEWDEGKFVRH------------ESDE 87

Query: 439  NANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLT 618
            + +     R  EL+G  +  K       ++  +S ND   T M I     + + + P + 
Sbjct: 88   DIHTANERRLGELIGRDIAGK-------VHTGRSRNDQVVTDMRIYCREILNEKIFPAMK 140

Query: 619  ALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLL 798
            +L + L  ++E+  DI+  G THLQ A P+      S Y       +KR+E   + L   
Sbjct: 141  SLINVLVNRAEKEIDILMPGYTHLQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERLNKS 200

Query: 799  AQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ-TAPNKFEALAAHDAVVEASGALNTL 975
              G  A+        G    +  +   E G+ F     N   A++  D VVE        
Sbjct: 201  PLGSGALA-------GHPYGIDRQFLAE-GLGFNGVIGNSLVAVSDRDFVVELMFWATLF 252

Query: 976  AVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNH 1155
               + + ++D+  + S    G+ +LS      GSS+MP K N    E L     +VFG  
Sbjct: 253  MNHVSRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGEL 310

Query: 1156 S 1158
            S
Sbjct: 311  S 311

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
            YHR018C
          Length = 462

 Score = 56.6 bits (135), Expect = 8e-08
 Identities = 77/292 (26%), Positives = 117/292 (40%), Gaps = 1/292 (0%)
 Frame = +1

Query: 280  KKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVIS 459
            K  TA +N+ N   D +L+  I    D++ S    D F           +    ANE   
Sbjct: 43   KVYTAGLNKINLITDDELS-KIHAGLDQIKSEWDDDKFV-----RHPSDEDIHTANE--- 93

Query: 460  NRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQ 639
             R  E++G  +  K       ++  +S ND   T M I     + + LLP +  L   L 
Sbjct: 94   RRLGEIIGRHIAGK-------VHTGRSRNDQVVTDMRIYCRDILNEKLLPFMADLIKVLV 146

Query: 640  KKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAV 819
            K++E   D +  G THLQ A P+      S Y        KR++  L+ L +   G  A+
Sbjct: 147  KRAENEIDTLMPGYTHLQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVSPLGAGAL 206

Query: 820  GTGLNTKIGWAENVAAEVAKETGIDF-QTAPNKFEALAAHDAVVEASGALNTLAVSLFKI 996
                    G    +  E   E G++F     N   A++  D VVE           + + 
Sbjct: 207  A-------GHPYGIDREFLAE-GLNFGGVIGNSLVAVSDRDFVVELMFWGTLFMNHISRF 258

Query: 997  AQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGN 1152
            A+D+  + S    G+ +LS      GSS+MP K N    E L     +VFG+
Sbjct: 259  AEDL-IIYSTAEFGFVKLS-DSYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] {ON}
            Anc_1.354 YHR018C
          Length = 462

 Score = 56.2 bits (134), Expect = 1e-07
 Identities = 65/240 (27%), Positives = 98/240 (40%), Gaps = 1/240 (0%)
 Frame = +1

Query: 442  ANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTA 621
            ANE    R  E++G  +  K       ++  +S ND   T + I     + + L P LT+
Sbjct: 91   ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPALTS 140

Query: 622  LKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLA 801
            L   L K+ EE  DI+  G THLQ A P+      S Y       + R++  L       
Sbjct: 141  LIQVLIKRGEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLNRLKQILVRFNKSP 200

Query: 802  QGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ-TAPNKFEALAAHDAVVEASGALNTLA 978
             G  A+        G    +  E   E G++F     N   A++  D VVE         
Sbjct: 201  LGAGALA-------GHPYGIDREFLAE-GLEFNGVIGNSLVAVSDRDFVVELMFWSTLFM 252

Query: 979  VSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHS 1158
              + + A+D+  + S    G+ +L+      GSS+MP K N    E L     +VFG+ S
Sbjct: 253  NHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLS 310

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
            highly similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018C ARG4 Argininosuccinate lyase catalyzes the final
            step in the arginine biosynthesis pathway
          Length = 464

 Score = 55.8 bits (133), Expect = 1e-07
 Identities = 64/240 (26%), Positives = 98/240 (40%), Gaps = 1/240 (0%)
 Frame = +1

Query: 442  ANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTA 621
            ANE    R  E++G ++  K       ++  +S ND   T M I     + + LLP L A
Sbjct: 92   ANE---RRLGEIIGREISGK-------VHTGRSRNDQVATDMRIYCRDILNEVLLPALQA 141

Query: 622  LKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLA 801
                L  +++E  D++  G THLQ A P+      S Y         R++  ++ L    
Sbjct: 142  FIKVLTTRAKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKSP 201

Query: 802  QGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ-TAPNKFEALAAHDAVVEASGALNTLA 978
             G  A+        G    +  E     G+ FQ    N   A++  D VVE         
Sbjct: 202  LGAGALA-------GHPYGIDREFLAR-GLGFQGVIGNSLTAVSDRDFVVEIMFWGTLFM 253

Query: 979  VSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHS 1158
              + + ++D+  + S    G+ +LS      GSS+MP K NP   E L     +VFG  S
Sbjct: 254  NHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNPDSLELLRGKAGRVFGELS 311

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
            YHR018C
          Length = 465

 Score = 55.5 bits (132), Expect = 2e-07
 Identities = 62/238 (26%), Positives = 97/238 (40%), Gaps = 1/238 (0%)
 Frame = +1

Query: 442  ANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTA 621
            ANE    R  E++G  +  K       ++  +S ND   T + I     +   L P+L A
Sbjct: 91   ANE---RRLGEIIGRNIAGK-------VHTGRSRNDQCVTDLRIYCRDLLNDKLFPDLQA 140

Query: 622  LKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLA 801
            L D + K+ +E  D++  G THLQ A P+      S Y        KR+   +D +    
Sbjct: 141  LVDVMIKRGKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDFKRLRQIMDRINQSP 200

Query: 802  QGGTAVGTGLNTKIGWAENVAAE-VAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLA 978
             G  A+        G    +  E +A   G D     N   A++  D +VE         
Sbjct: 201  LGAGALA-------GHPYGIDREFLAAGLGFD-GVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 979  VSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGN 1152
              + + A+D+  + S    G+ +L+      GSS+MP K N    E L     +VFG+
Sbjct: 253  NHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
            YHR018C (REAL)
          Length = 463

 Score = 54.3 bits (129), Expect = 4e-07
 Identities = 64/238 (26%), Positives = 94/238 (39%), Gaps = 1/238 (0%)
 Frame = +1

Query: 442  ANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTA 621
            ANE    R  EL+G  +  K       ++  +S ND   T + I     +   L P +  
Sbjct: 91   ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDSLFPAMKG 140

Query: 622  LKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLA 801
            L D L K++E   DI+  G THLQ A P+      S Y        KR+   L  L    
Sbjct: 141  LVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLVQILHRLNQSP 200

Query: 802  QGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTA-PNKFEALAAHDAVVEASGALNTLA 978
             G  A+        G    +  E   E G+ F +   N   A++  D +VE         
Sbjct: 201  LGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 979  VSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGN 1152
              + + A+D+  +      G+ +LS      GSS+MP K N    E L     +VFG+
Sbjct: 253  NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
            YHR018C (REAL)
          Length = 463

 Score = 53.9 bits (128), Expect = 6e-07
 Identities = 65/238 (27%), Positives = 94/238 (39%), Gaps = 1/238 (0%)
 Frame = +1

Query: 442  ANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTA 621
            ANE    R  EL+G  +  K       ++  +S ND   T + I     +   L P L  
Sbjct: 91   ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNGTLFPALKG 140

Query: 622  LKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLA 801
            L D L K++E   DI+  G THLQ A P+      S Y        KR+   L  L    
Sbjct: 141  LVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSP 200

Query: 802  QGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTA-PNKFEALAAHDAVVEASGALNTLA 978
             G  A+        G    +  E   E G+ F +   N   A++  D +VE         
Sbjct: 201  LGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 979  VSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGN 1152
              + + A+D+  +      G+ +LS      GSS+MP K N    E L     +VFG+
Sbjct: 253  NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.354
            YHR018C
          Length = 464

 Score = 53.9 bits (128), Expect = 6e-07
 Identities = 67/261 (25%), Positives = 107/261 (40%), Gaps = 1/261 (0%)
 Frame = +1

Query: 373  GKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDT 552
            GK+K+ +    F      +    ANE    R  E++G  +  K       ++  +S ND 
Sbjct: 69   GKIKEEWENNTFIRLPSDEDIHTANE---RRLGEIIGTGIAGK-------VHTGRSRNDQ 118

Query: 553  FPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSG 732
              T M I     +T +LL  L  L   + +++ E  DI+  G THLQ A P+      S 
Sbjct: 119  VATDMRIYCRDILTNNLLTYLKELISVICRRANEEMDILMPGYTHLQRAQPIRWSHWLSF 178

Query: 733  YVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAE-VAKETGIDFQTAP 909
            Y        KR++  L  L +   G  A+        G    +  E +A++ G       
Sbjct: 179  YATYFTEDYKRLQEILARLNVSPLGAGALA-------GHPYGIDREFLAQDLGFS-GVIG 230

Query: 910  NKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMP 1089
            N   A++  D VVE     +     + + ++D+  + S    G+ +LS      GSS+MP
Sbjct: 231  NSLVAVSDRDFVVEIMFWGSLFMNHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMP 288

Query: 1090 GKVNPTQNEALTQVCVQVFGN 1152
             K N    E L     +VFG+
Sbjct: 289  QKKNADSLELLRGKSGRVFGD 309

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
            YHR018C
          Length = 466

 Score = 53.9 bits (128), Expect = 6e-07
 Identities = 63/263 (23%), Positives = 106/263 (40%), Gaps = 1/263 (0%)
 Frame = +1

Query: 373  GKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDT 552
            G++K  +    F+     +    ANE    R  E++G  +  K       ++  +S ND 
Sbjct: 68   GEIKKEWDNGTFKRHPNDEDIHTANE---RRLGEIIGTHIAGK-------VHTGRSRNDQ 117

Query: 553  FPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSG 732
              T + I     + + LLP +  L   + K++E   DI+  G THLQ A P+      S 
Sbjct: 118  CVTDLRIYCRDILVEKLLPFMIDLVQVITKRAENEIDILMPGYTHLQRAQPIRWSHWLSS 177

Query: 733  YVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAE-VAKETGIDFQTAP 909
            Y        KR++  L+ L     G  A+        G    +  + ++ E G +     
Sbjct: 178  YATYFTEDYKRLKQVLERLNKCPLGAGAIA-------GHPYGIDRQYLSDELGFN-SIIG 229

Query: 910  NKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMP 1089
            N   A++  D +V+           + + ++D+  + S    G+ +LS      GSS+MP
Sbjct: 230  NSLVAVSDRDFIVDIMFWSTLFMNHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMP 287

Query: 1090 GKVNPTQNEALTQVCVQVFGNHS 1158
             K N    E L     +VFG  S
Sbjct: 288  QKKNADSLELLRGKSGRVFGQLS 310

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
            similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018C ARG4 Argininosuccinate lyase catalyzes the final
            step in the arginine biosynthesis pathway
          Length = 462

 Score = 52.8 bits (125), Expect = 1e-06
 Identities = 65/261 (24%), Positives = 103/261 (39%), Gaps = 1/261 (0%)
 Frame = +1

Query: 373  GKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDT 552
            G++K  +    F      +    ANE    R  E++G  +  K       ++  +S ND 
Sbjct: 68   GEIKKEWDEDKFVRHPNDEDIHTANE---RRLGEIIGRDIAGK-------VHTGRSRNDQ 117

Query: 553  FPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSG 732
              T M I     + + LLP L  L   + K++E+    +  G THLQ A P+      S 
Sbjct: 118  VVTDMRIFCRDTVNEKLLPGLKELVSVMVKRAEKEIGYLMPGYTHLQRAQPIRWSHWLSS 177

Query: 733  YVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAE-VAKETGIDFQTAP 909
            Y       +KR+   L+       G  A+        G    +  E +A+E G       
Sbjct: 178  YATYFTEDLKRLRQLLERFNQSPLGAGALA-------GHPYGIDREFLAEELGFQ-GVIG 229

Query: 910  NKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMP 1089
            N   A++  D VVE           + + A+D+  + S    G+ +L+      GSS+MP
Sbjct: 230  NSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMP 287

Query: 1090 GKVNPTQNEALTQVCVQVFGN 1152
             K N    E L     +VFG+
Sbjct: 288  QKKNADSLELLRGKSGRVFGD 308

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
            similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 52.8 bits (125), Expect = 1e-06
 Identities = 65/267 (24%), Positives = 103/267 (38%), Gaps = 1/267 (0%)
 Frame = +1

Query: 361  EVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQS 540
            E +SGK ++H            +    ANE    R  EL+G  +  K       ++  +S
Sbjct: 73   EWSSGKFEEH---------PDDEDIHTANE---RRLGELIGTAVAGK-------VHTGRS 113

Query: 541  SNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQ 720
             ND   T M I     + + +LP +++    L  ++ E  D++  G THLQ A P+    
Sbjct: 114  RNDQVATDMRIYCREILNEKILPAVSSFIRVLINRAREEVDVLMPGYTHLQRAQPIRWSH 173

Query: 721  EFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ 900
              S Y         R+   ++ L    Q     G       G      AE     GI   
Sbjct: 174  WLSCYATYFTEDYNRLRQVVERLN---QSPLGAGALAGHPYGIDRKYLAEQLGFNGI--- 227

Query: 901  TAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPE-NEPGS 1077
               N   A++  D V+E     +     + + A+D+    +     +G ++L +    GS
Sbjct: 228  -IGNSLVAVSDRDFVIEIMFWGSLFMNHISRFAEDLIIYSTAE---FGFINLADAYSTGS 283

Query: 1078 SIMPGKVNPTQNEALTQVCVQVFGNHS 1158
            S+MP K NP   E L     +VFG  S
Sbjct: 284  SLMPQKKNPDSLELLRGKSGRVFGQLS 310

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
            YHR018C (REAL)
          Length = 463

 Score = 52.4 bits (124), Expect = 2e-06
 Identities = 62/238 (26%), Positives = 96/238 (40%), Gaps = 1/238 (0%)
 Frame = +1

Query: 442  ANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTA 621
            ANE    R  E++G  +  K       ++  +S ND   T + I     +  +L P L  
Sbjct: 91   ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDNLFPALKG 140

Query: 622  LKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLA 801
            L D L K+++   +I+  G THLQ A P+      S Y        KR++  L  L    
Sbjct: 141  LVDVLIKRAKGEINILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLDQILHRLNQSP 200

Query: 802  QGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTA-PNKFEALAAHDAVVEASGALNTLA 978
             G  A+        G    +  E   E G+ F +   N   A++  D +VE         
Sbjct: 201  LGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSMVAVSDRDFIVELMFWGTLFM 252

Query: 979  VSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGN 1152
              + + A+D+  +      G+ +LS      GSS+MP K N    E L     +VFG+
Sbjct: 253  NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 52.4 bits (124), Expect = 2e-06
 Identities = 56/215 (26%), Positives = 88/215 (40%), Gaps = 1/215 (0%)
 Frame = +1

Query: 508  HPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTH 687
            H +  ++  +S ND   T M +     +   + P L  L   L  ++ E  D++  G TH
Sbjct: 103  HISGKVHTGRSRNDQVATDMRLYCREMLQDKVEPALFELIKVLLHRAREEIDVLMPGYTH 162

Query: 688  LQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAA 867
            LQ A P+      S Y        KR++  +  L     G  A+        G    +  
Sbjct: 163  LQRAQPIRWSHWLSCYATYFVEDFKRLKEVIARLNQSPLGAGALA-------GHPYGIDR 215

Query: 868  E-VAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYG 1044
            E +A E G D     N   A++  D VVE     +     + ++A+D+  + S    G+ 
Sbjct: 216  EYLACELGFD-GVIGNSMTAVSDRDFVVEIMSWGSLFMNHISRLAEDL-IIYSTAEFGFV 273

Query: 1045 ELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFG 1149
            +L+      GSS+MP K NP   E L     +VFG
Sbjct: 274  KLA-DAYSTGSSLMPQKRNPDSLELLRGKSGRVFG 307

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
            ARG4Argininosuccinate lyase, catalyzes the final step in
            the arginine biosynthesis pathway
          Length = 463

 Score = 52.0 bits (123), Expect = 2e-06
 Identities = 63/238 (26%), Positives = 94/238 (39%), Gaps = 1/238 (0%)
 Frame = +1

Query: 442  ANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTA 621
            ANE    R  EL+G  +  K       ++  +S ND   T + I     +   L P L  
Sbjct: 91   ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDIVNDTLFPALKG 140

Query: 622  LKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLA 801
            L + L K++E   D++  G THLQ A P+      S Y        KR+   L  L    
Sbjct: 141  LVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSP 200

Query: 802  QGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTA-PNKFEALAAHDAVVEASGALNTLA 978
             G  A+        G    +  E   E G+ F +   N   A++  D +VE         
Sbjct: 201  LGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 979  VSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGN 1152
              + + A+D+  +      G+ +LS      GSS+MP K N    E L     +VFG+
Sbjct: 253  NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa] {ON}
            highly similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018C ARG4 Argininosuccinate lyase catalyzes the final
            step in the arginine biosynthesis pathway
          Length = 465

 Score = 48.1 bits (113), Expect = 4e-05
 Identities = 66/280 (23%), Positives = 115/280 (41%), Gaps = 3/280 (1%)
 Frame = +1

Query: 328  KLAVAIKQAADEVASGK--LKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSK 501
            K  +  ++  DE+  G   ++  +    F    G +    ANE    R  E++G  +  K
Sbjct: 53   KAGLLTQEELDEIHRGLEIIRGEWASNSFVEKDGDEDIHTANE---RRLGEIIGRHIAGK 109

Query: 502  SVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGR 681
                   ++  +S ND   T M I    A+  ++   L  L  ++ +++E+  D +  G 
Sbjct: 110  -------VHTGRSRNDQVATDMRIYCREALD-NMAKILKDLVGAILQRAEQEIDALMPGY 161

Query: 682  THLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENV 861
            THLQ A P+      + Y        KR++   + L +   G  A+        G    +
Sbjct: 162  THLQRAQPIRWSHWLNLYATYFTEDFKRLKQIRERLNVSPLGCGALA-------GHPYGI 214

Query: 862  AAE-VAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCG 1038
              E +A+  G D     N  +A++  D VVE     +     + + ++D+  + S     
Sbjct: 215  DREHIAERLGFD-GVIGNSLQAVSDRDFVVEILFWCSLFMNHISRFSEDL-IIYSTAEFN 272

Query: 1039 YGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHS 1158
            + +LS      GSS+MP K NP   E L     +VFG+ S
Sbjct: 273  FVKLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGSLS 311

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa] {ON}
            YHR018C (ARG4) - argininosuccinate lyase [contig 260]
            FULL
          Length = 465

 Score = 47.4 bits (111), Expect = 7e-05
 Identities = 65/277 (23%), Positives = 110/277 (39%), Gaps = 2/277 (0%)
 Frame = +1

Query: 328  KLAVAIKQAADEVASGK--LKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSK 501
            K+ +  +Q   E+  G   ++  +    F    G +    ANE    R  E++G  +  K
Sbjct: 53   KVGLLTEQELSEIHRGLEIIRGEWASNSFVEKDGDEDIHTANE---RRLGEIIGRHIAGK 109

Query: 502  SVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGR 681
                   ++  +S ND   T M I    A+  +L   L  L  ++ ++SE+  D +  G 
Sbjct: 110  -------VHTGRSRNDQVATDMRIYCREALD-NLAKILEDLIGAILQRSEQEIDALMPGY 161

Query: 682  THLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENV 861
            THLQ A P+      + Y        KR++   + L +   G  A+        G    +
Sbjct: 162  THLQRAQPIRWSHWLNLYATYFTEDFKRLKQIRERLNVSPLGCGALA-------GHPYGI 214

Query: 862  AAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGY 1041
              E   E         N  +A++  D VVE     +     + + ++D+  + S     +
Sbjct: 215  DREFLAERLGFSDVIGNSLQAVSDRDFVVEIMFWCSLFMNHISRFSEDL-IIYSTAEFNF 273

Query: 1042 GELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGN 1152
             +LS      GSS+MP K NP   E L     +VFG+
Sbjct: 274  VKLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGS 309

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
            (REAL)
          Length = 482

 Score = 44.3 bits (103), Expect = 6e-04
 Identities = 47/186 (25%), Positives = 82/186 (44%), Gaps = 14/186 (7%)
 Frame = +1

Query: 601  LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 780
            ++P L  + + L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++  E   
Sbjct: 128  IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 781  DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGID------FQTAPNKF 918
            + + L    GT        A+  G + K+   E + A V +  G D       QT   K 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDARVTELLGFDKVYPVTGQTYSRKI 244

Query: 919  EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 1098
            +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245  D--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 1099 NPTQNE 1116
            NP + E
Sbjct: 294  NPMRCE 299

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
            highly similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359w ADE13
          Length = 482

 Score = 43.9 bits (102), Expect = 8e-04
 Identities = 47/186 (25%), Positives = 81/186 (43%), Gaps = 14/186 (7%)
 Frame = +1

Query: 601  LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 780
            ++P L  + + L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++  E   
Sbjct: 128  VIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 781  DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 918
            + + L    GT        A+  G + K+   E +   V +  G D       QT   K 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVTELLGFDTVYPVTGQTYSRKI 244

Query: 919  EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 1098
            +        ++    L++ A S  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245  D--------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 1099 NPTQNE 1116
            NP + E
Sbjct: 294  NPMRCE 299

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
            (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 43.1 bits (100), Expect = 0.001
 Identities = 41/175 (23%), Positives = 75/175 (42%), Gaps = 3/175 (1%)
 Frame = +1

Query: 601  LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 780
            L+P L  + D L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128  LIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 781  DSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETG---IDFQTAPNKFEALAAHDAVVE 951
            + + L    GT    G    +  +++   E   +     + F T         +    ++
Sbjct: 188  NDIGLRGVKGTTGTQGSFLALFHSDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 952  ASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1116
                L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 248  VLAPLSSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCE 299

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
            (REAL)
          Length = 482

 Score = 43.1 bits (100), Expect = 0.001
 Identities = 44/183 (24%), Positives = 80/183 (43%), Gaps = 11/183 (6%)
 Frame = +1

Query: 601  LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 780
            ++P L  + + L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++  E   
Sbjct: 128  IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFERAR 187

Query: 781  DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVA---KETGIDFQTAPNKFEAL 927
            + + L    GT        A+  G + K+   +    E+    K   +  QT   K +  
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKID-- 245

Query: 928  AAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 1107
                  ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246  ------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 1108 QNE 1116
            + E
Sbjct: 297  RCE 299

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
            ADE13Adenylosuccinate lyase, catalyzes two steps in the
            'de novo' purine nucleotide biosynthetic pathway;
            expression is repressed by adenine and activated by Bas1p
            and Pho2p; mutations in human ortholog ADSL cause
            adenylosuccinase deficiency
          Length = 482

 Score = 43.1 bits (100), Expect = 0.001
 Identities = 44/183 (24%), Positives = 80/183 (43%), Gaps = 11/183 (6%)
 Frame = +1

Query: 601  LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 780
            ++P L  + + L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++  E   
Sbjct: 128  IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 781  DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVA---KETGIDFQTAPNKFEAL 927
            + + L    GT        A+  G + K+   +    E+    K   +  QT   K +  
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKID-- 245

Query: 928  AAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 1107
                  ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246  ------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 1108 QNE 1116
            + E
Sbjct: 297  RCE 299

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
            Anc_4.197 YLR359W
          Length = 482

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 47/186 (25%), Positives = 79/186 (42%), Gaps = 14/186 (7%)
 Frame = +1

Query: 601  LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 780
            ++P L  + D L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128  IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDLRNFVRAR 187

Query: 781  DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 918
            + L L    GT        A+  G + K+   E +   V +  G D       QT   K 
Sbjct: 188  NDLGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVTELLGFDTVYPVTGQTYSRKI 244

Query: 919  EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 1098
            +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245  D--------IDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 1099 NPTQNE 1116
            NP + E
Sbjct: 294  NPMRCE 299

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
            (REAL)
          Length = 482

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 44/183 (24%), Positives = 79/183 (43%), Gaps = 11/183 (6%)
 Frame = +1

Query: 601  LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 780
            ++P L  + + L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++  E   
Sbjct: 128  IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 781  DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVA---KETGIDFQTAPNKFEAL 927
            + + L    GT        A+  G + K+   +    E+    K   +  QT   K +  
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKID-- 245

Query: 928  AAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 1107
                  ++    L++ A +  K+A DIR L +       E    + + GSS M  K NP 
Sbjct: 246  ------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPM 296

Query: 1108 QNE 1116
            + E
Sbjct: 297  RCE 299

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa] {ON}
            highly similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
            in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 42.0 bits (97), Expect = 0.003
 Identities = 46/183 (25%), Positives = 80/183 (43%), Gaps = 11/183 (6%)
 Frame = +1

Query: 601  LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 780
            L+P L  + + L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128  LIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 781  DSLKLLAQGGTAVGT---------GLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAA 933
            + + L    GT  GT         G + K+   +   AE+     + F T         +
Sbjct: 188  NDIGLRGVKGT-TGTQASFLTLFHGDHDKVEALDKRVAEL-----LGFSTVYPVTGQTYS 241

Query: 934  HDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPT 1107
                ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  K NP 
Sbjct: 242  RKIDIDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNPM 296

Query: 1108 QNE 1116
            + E
Sbjct: 297  RCE 299

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
            YLR359W
          Length = 482

 Score = 42.0 bits (97), Expect = 0.003
 Identities = 44/182 (24%), Positives = 79/182 (43%), Gaps = 10/182 (5%)
 Frame = +1

Query: 601  LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 780
            ++P L  + D L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128  VIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 781  DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAH 936
            + + L    GT        A+  G + K+   +    E+     + F T         + 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTEL-----LGFDTVYPVTGQTYSR 242

Query: 937  DAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQ 1110
               ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  K NP +
Sbjct: 243  KIDIDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNPMR 297

Query: 1111 NE 1116
             E
Sbjct: 298  CE 299

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
            (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 41.6 bits (96), Expect = 0.004
 Identities = 41/180 (22%), Positives = 77/180 (42%), Gaps = 8/180 (4%)
 Frame = +1

Query: 601  LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 780
            ++P L  + D L K + E+ D+  +G TH Q A   T+G+  + ++Q++   ++      
Sbjct: 128  IIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVRAR 187

Query: 781  DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAH 936
            + + L    GT        A+  G + K+   +    E+     + F T         + 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDDDKVEALDKRVVEL-----LGFDTVYPVTGQTYSR 242

Query: 937  DAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1116
               ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243  KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
            YLR359W
          Length = 482

 Score = 41.2 bits (95), Expect = 0.006
 Identities = 42/180 (23%), Positives = 76/180 (42%), Gaps = 8/180 (4%)
 Frame = +1

Query: 601  LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 780
            ++P L  + D L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128  IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 781  DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAH 936
            + + L    GT        A+  G + K+   +    E+     + F T         + 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTEL-----LGFDTVYPVTGQTYSR 242

Query: 937  DAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1116
               ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243  KIDIDVLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCE 299

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4.197
            YLR359W
          Length = 482

 Score = 41.2 bits (95), Expect = 0.006
 Identities = 42/180 (23%), Positives = 77/180 (42%), Gaps = 8/180 (4%)
 Frame = +1

Query: 601  LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 780
            ++P L  + D L K + ++ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128  VIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVRAR 187

Query: 781  DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAH 936
            + + L    GT        A+  G + K+   +    E+     + F T         + 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTEL-----LGFDTVYPVTGQTYSR 242

Query: 937  DAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1116
               ++    L++ A S  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243  KIDIDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
            Ashbya gossypii ABL006C
          Length = 482

 Score = 40.4 bits (93), Expect = 0.010
 Identities = 52/209 (24%), Positives = 90/209 (43%), Gaps = 16/209 (7%)
 Frame = +1

Query: 601  LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 780
            L+P L  + + L   + ++ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128  LIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 781  DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 918
            + +      GT        A+  G + K+   E +   VA+ +G D       QT   K 
Sbjct: 188  NDIGFRGVKGTTGTQASFLALFHGDHDKV---EALDKRVAELSGFDIIYPVTGQTYSRKV 244

Query: 919  EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPG 1092
            +        ++  G L++ A +  K+A DIR L +       EL  P   ++ GSS M  
Sbjct: 245  D--------IDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMAY 291

Query: 1093 KVNPTQNEALTQVCVQVFGNHSAITFAGA 1179
            K NP + E   +VC      H    ++GA
Sbjct: 292  KRNPMRCE---RVC--SLARHLGSLYSGA 315

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
            highly similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
            in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 40.4 bits (93), Expect = 0.010
 Identities = 41/180 (22%), Positives = 75/180 (41%), Gaps = 8/180 (4%)
 Frame = +1

Query: 601  LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 780
            ++P L  + D L K +  + D+  +G TH Q A   TLG+  + ++Q +   ++  +   
Sbjct: 128  IIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDRAR 187

Query: 781  DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAH 936
            + + L    GT        A+  G + K+   +    E+     + F+T         + 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKVEELDQRVTEL-----LGFETVYPVTGQTYSR 242

Query: 937  DAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1116
               ++    L + A +  K+A DIR L +       E    + + GSS M  K NP + E
Sbjct: 243  KIDIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE 299

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] {ON}
            Anc_4.197 YLR359W
          Length = 482

 Score = 40.4 bits (93), Expect = 0.010
 Identities = 47/186 (25%), Positives = 80/186 (43%), Gaps = 14/186 (7%)
 Frame = +1

Query: 601  LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 780
            L+P L  + + L K +    D+  +G TH Q A   TLG+  + ++Q++   ++  E   
Sbjct: 128  LIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 781  DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 918
            + + L    GT        A+  G + K+   E +   V +  G D       QT   K 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDHNKV---EKLDERVVELLGFDTVYPVTGQTYSRKI 244

Query: 919  EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 1098
            +        ++A   L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245  D--------IDAFAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 1099 NPTQNE 1116
            NP + E
Sbjct: 294  NPMRCE 299

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
            similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
            in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 39.3 bits (90), Expect = 0.023
 Identities = 41/180 (22%), Positives = 77/180 (42%), Gaps = 8/180 (4%)
 Frame = +1

Query: 601  LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 780
            L+P L  + + L + + E+ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128  LIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 781  DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAH 936
            + + L    GT        A+  G + K+   +    E+     + F T         + 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTEL-----LGFDTVYPVTGQTYSR 242

Query: 937  DAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1116
               ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243  KIDIDVLAPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKRNPMRCE 299

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] {ON}
            Anc_4.197 YLR359W
          Length = 482

 Score = 39.3 bits (90), Expect = 0.023
 Identities = 45/186 (24%), Positives = 79/186 (42%), Gaps = 14/186 (7%)
 Frame = +1

Query: 601  LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 780
            ++P L  + + L   + E+ D+  +G TH Q A   TLG+  + ++Q++   ++  E   
Sbjct: 128  VIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 781  DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 918
            + + L    GT        A+  G + K+   E +   V +  G D       QT   K 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVVELLGFDTVYPVTGQTYSRKI 244

Query: 919  EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 1098
            +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245  D--------IDVVSPLVSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 1099 NPTQNE 1116
            NP + E
Sbjct: 294  NPMRCE 299

>ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR359W
            (ADE13)
          Length = 482

 Score = 36.2 bits (82), Expect = 0.21
 Identities = 43/186 (23%), Positives = 79/186 (42%), Gaps = 14/186 (7%)
 Frame = +1

Query: 601  LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 780
            ++P L  + + L K + E+ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128  IIPKLVNVINRLSKFACEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 781  DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDF------QTAPNKF 918
            + + L    GT        A+  G + ++   E +   V +  G D       QT   K 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDHDRV---EALDKRVTELLGFDIVYPVTGQTYSRKI 244

Query: 919  EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 1098
            +        ++  G+ ++   +  K+A DIR L +       E    + + GSS M  K 
Sbjct: 245  D--------IDILGSGSSFEATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKR 293

Query: 1099 NPTQNE 1116
            NP + E
Sbjct: 294  NPMRCE 299

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
            Anc_4.197 YLR359W
          Length = 482

 Score = 36.2 bits (82), Expect = 0.21
 Identities = 39/180 (21%), Positives = 76/180 (42%), Gaps = 8/180 (4%)
 Frame = +1

Query: 601  LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 780
            ++P L  + + L   + ++ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128  IIPKLVNVINRLSDFALKYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 781  DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAH 936
            + + L    GT        A+  G + K+   +    E+     + F T         + 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTEL-----LGFDTVYPVTGQTYSR 242

Query: 937  DAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1116
               ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243  KIDIDVLSPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKRNPMRCE 299

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
            similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
            in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 35.8 bits (81), Expect = 0.28
 Identities = 40/180 (22%), Positives = 76/180 (42%), Gaps = 8/180 (4%)
 Frame = +1

Query: 601  LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 780
            L+P L  + + L + + ++ D+  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128  LIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 781  DSLKLLAQGGT--------AVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAH 936
            + + L    GT        A+  G + K+   +    E+     + F T         + 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTEL-----LGFDTVYPVTGQTYSR 242

Query: 937  DAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1116
               ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243  KIDIDVLAPLCSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCE 299

>SAKL0A01430g Chr1 complement(136728..137636) [909 bp, 302 aa] {ON}
            similar to uniprot|P53727 Saccharomyces cerevisiae
            YNR027W BUD17 Protein involved in bud-site selection
            diploid mutants display a random budding pattern instead
            of the wild-type bipolar pattern
          Length = 302

 Score = 31.6 bits (70), Expect = 4.9
 Identities = 30/137 (21%), Positives = 59/137 (43%), Gaps = 10/137 (7%)
 Frame = +1

Query: 637  QKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTA 816
            + K++E  DI++ G   L     L      +GY+  V +G+K +  T+  L    +  T+
Sbjct: 54   KSKAQELRDIIEKG---LLQGLELKYDAVLTGYLPDV-DGLKAISETVSRL---CESDTS 106

Query: 817  VGTGLNTKIGWAENVAAEVAKET----------GIDFQTAPNKFEALAAHDAVVEASGAL 966
            +   ++  +G  +N    V +ET          G  F T PN+FE     D  +    +L
Sbjct: 107  IKWVVDPVLG--DNGKLYVPEETVPIYRKILECGSVFLTTPNQFEMETLTDVKITDCASL 164

Query: 967  NTLAVSLFKIAQDIRYL 1017
             +  +   ++   ++Y+
Sbjct: 165  RSSLIKFHQLYPTVKYV 181

>NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106
          Length = 816

 Score = 31.6 bits (70), Expect = 6.5
 Identities = 24/89 (26%), Positives = 34/89 (38%)
 Frame = +1

Query: 430 SNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLP 609
           S  + + +++N  I +L  K   K   PNN I M        PT+M   A      D+L 
Sbjct: 446 SKGSESRLLTNETINILIPKR-KKDGKPNNKIVMKDGKKRIVPTLMTTVATSKSESDILT 504

Query: 610 NLTALKDSLQKKSEEFADIVKIGRTHLQD 696
             T  K    K       I  IG +  +D
Sbjct: 505 KPTLKKKQPSKGGSTLLGISSIGSSGFED 533

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.130    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 134,802,816
Number of extensions: 2901880
Number of successful extensions: 8061
Number of sequences better than 10.0: 64
Number of HSP's gapped: 8046
Number of HSP's successfully gapped: 64
Length of query: 506
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 392
Effective length of database: 40,409,475
Effective search space: 15840514200
Effective search space used: 15840514200
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 35 (18.1 bits)