Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07942g6.14ON54854826400.0
SAKL0E01012g6.14ON54455714890.0
Kwal_56.223876.14ON54355214730.0
KLTH0C11396g6.14ON55052414610.0
Suva_5.76.14ON66448814590.0
YEL060C (PRB1)6.14ON63548914480.0
Skud_5.296.14ON60850614440.0
Smik_5.276.14ON60848914410.0
TDEL0G045506.14ON56457814320.0
KLLA0D00979g6.14ON56157014220.0
NCAS0F002206.14ON69551014250.0
TBLA0A073006.14ON57340713780.0
Ecym_30186.14ON57557913540.0
NDAI0K028806.14ON70449313610.0
Kpol_1032.56.14ON68042213351e-178
CAGL0B03619g6.14ON46847213111e-177
ACR012C6.14ON54156313111e-176
KNAG0E009206.14ON53149912831e-172
KAFR0L003606.14ON50241312271e-164
Kpol_1045.756.14ON47743212241e-164
TPHA0M002306.14ON58551411731e-154
Smik_15.1726.14ON47850111021e-145
Skud_15.1646.14ON48240310951e-144
Suva_15.1786.14ON47648410921e-144
YOR003W (YSP3)6.14ON47849110821e-142
CAGL0E02651g6.14ON4854059861e-128
KAFR0B065506.14ON4564049121e-117
NCAS0D026306.14ON4514088831e-113
KNAG0F02970singletonON4203528081e-102
NDAI0I022806.14ON4824277657e-95
CAGL0L13266gsingletonON5794246533e-77
TDEL0A072806.313ON4363894564e-50
KNAG0I024706.313ON4753764506e-49
Kpol_1028.616.313ON5183184501e-48
Kpol_1018.56.313ON4653274443e-48
NCAS0D043906.313ON4923164463e-48
SAKL0A02002g6.313ON4793694436e-48
ZYRO0D08822g6.313ON4903864393e-47
TPHA0D037606.313ON6073184321e-45
NDAI0I005606.313ON4833154173e-44
KAFR0J024506.313ON4783694131e-43
Suva_3.846.313ON5273204123e-43
CAGL0L10802g6.313ON5173534123e-43
Kwal_23.61836.313ON4933134094e-43
KLTH0A06094g6.313ON4963134078e-43
Smik_3.1496.313ON4913203991e-41
AAR069W6.313ON7683114018e-41
YCR045C (RRT12)6.313ON4913123883e-40
TBLA0F039706.313ON7343003902e-39
Ecym_21056.313ON6103143854e-39
KLLA0F06028g6.313ON5083133743e-38
Skud_3.1246.313ON5403203753e-38
Kwal_33.133721.78ON3772883287e-33
TBLA0A067006.313ON4973083223e-31
KLTH0F02288g1.78ON3802922971e-28
Kpol_2000.691.78ON3863482935e-28
ZYRO0F16764g1.78ON3863082539e-23
TPHA0B045201.78ON3882822245e-19
TDEL0C062301.78ON3642942131e-17
TBLA0A054101.78ON3822851882e-14
TPHA0P017902.6ON79984780.69
NCAS0A008802.6ON83391780.72
KNAG0F007702.6ON82689780.74
NDAI0F038902.6ON83391761.2
Skud_14.1012.6ON81991751.6
ZYRO0F15598g2.6ON79087742.0
SAKL0G00440g2.6ON83687742.2
TPHA0N005805.183ON56160732.4
KNAG0A041808.463ON85656723.6
YNL238W (KEX2)2.6ON81488723.9
CAGL0M05445g8.526ON93284723.9
Ecym_64862.6ON78190714.5
Suva_14.1062.6ON80988714.6
KAFR0A080402.6ON76688715.2
KLTH0D05852g2.492ON70279706.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C07942g
         (548 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...  1021   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   578   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   572   0.0  
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   567   0.0  
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   566   0.0  
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   562   0.0  
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   560   0.0  
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   559   0.0  
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   556   0.0  
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   552   0.0  
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   553   0.0  
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   535   0.0  
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   526   0.0  
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   528   0.0  
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   518   e-178
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   509   e-177
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   509   e-176
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   498   e-172
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   477   e-164
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   476   e-164
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   456   e-154
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   429   e-145
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   426   e-144
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   425   e-144
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   421   e-142
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   384   e-128
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   355   e-117
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     344   e-113
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              315   e-102
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   299   7e-95
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   256   3e-77
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   180   4e-50
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   177   6e-49
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   177   1e-48
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   175   3e-48
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   176   3e-48
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   175   6e-48
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   173   3e-47
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   171   1e-45
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    165   3e-44
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   163   1e-43
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   163   3e-43
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   163   3e-43
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   162   4e-43
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   161   8e-43
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   158   1e-41
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   159   8e-41
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   154   3e-40
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   154   2e-39
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   152   4e-39
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   148   3e-38
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   149   3e-38
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   130   7e-33
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   128   3e-31
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   119   1e-28
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   117   5e-28
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   102   9e-23
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...    91   5e-19
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    87   1e-17
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    77   2e-14
TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {...    35   0.69 
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    35   0.72 
KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6...    35   0.74 
NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {O...    34   1.2  
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    33   1.6  
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    33   2.0  
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    33   2.2  
TPHA0N00580 Chr14 complement(124172..125857) [1686 bp, 561 aa] {...    33   2.4  
KNAG0A04180 Chr1 (567264..569834) [2571 bp, 856 aa] {ON} Anc_8.4...    32   3.6  
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    32   3.9  
CAGL0M05445g Chr13 (580648..583446) [2799 bp, 932 aa] {ON} simil...    32   3.9  
Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}...    32   4.5  
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    32   4.6  
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    32   5.2  
KLTH0D05852g Chr4 (522837..524945) [2109 bp, 702 aa] {ON} simila...    32   6.7  

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score = 1021 bits (2640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/548 (92%), Positives = 507/548 (92%)

Query: 1   MKFQKSVIPVATLAGLGSALIIPELTGSNEYEKRPERTDDVNNGESVVATSFEKGPSKDE 60
           MKFQKSVIPVATLAGLGSALIIPELTGSNEYEKRPERTDDVNNGESVVATSFEKGPSKDE
Sbjct: 1   MKFQKSVIPVATLAGLGSALIIPELTGSNEYEKRPERTDDVNNGESVVATSFEKGPSKDE 60

Query: 61  LAVFASKLTQEVQDRFAPLVVPEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQE 120
           LAVFASKLTQEVQDRFAPLVVPEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQE
Sbjct: 61  LAVFASKLTQEVQDRFAPLVVPEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQE 120

Query: 121 VSQLPEEHSFFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEM 180
           VSQLPEEHSFFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEM
Sbjct: 121 VSQLPEEHSFFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEM 180

Query: 181 VEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNV 240
           VEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNV
Sbjct: 181 VEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNV 240

Query: 241 HHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSG 300
           HHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSG
Sbjct: 241 HHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSG 300

Query: 301 SMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXX 360
           SMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQ              
Sbjct: 301 SMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQAVNAAVAAGLNFAV 360

Query: 361 XXXXEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDS 420
               EDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDS
Sbjct: 361 AAGNEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDS 420

Query: 421 STATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSDI 480
           STATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSDI
Sbjct: 421 STATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSDI 480

Query: 481 PSGTPNLLIYNXXXXXXXXXXXSKEVAQELEFNEKXXXXXXXXXXXXGSKTDAVFGQIRG 540
           PSGTPNLLIYN           SKEVAQELEFNEK            GSKTDAVFGQIRG
Sbjct: 481 PSGTPNLLIYNGGGGDLSGFWGSKEVAQELEFNEKVDLELHDLVDELGSKTDAVFGQIRG 540

Query: 541 LMDRLDII 548
           LMDRLDII
Sbjct: 541 LMDRLDII 548

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/557 (54%), Positives = 380/557 (68%), Gaps = 22/557 (3%)

Query: 1   MKFQKSVIPVATLAGLGSALIIPELTGSNEYEKRPERTDDVNNGESVVATSFEKGPSKDE 60
           MK Q +++P+A L  L +AL+IPE+  S+    +     ++N+    V  SF K     E
Sbjct: 1   MKVQSTILPIAALTTLAAALVIPEVDKSS----KDVSVKEINSDSQEVLASFAK-----E 51

Query: 61  LAVFASKLTQEVQDRFAPLVVPEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQE 120
           +   A++  +EV  + APLV       ++ +RYII+FKK   P+EI FH+E+I + H + 
Sbjct: 52  ITRAAAEKGEEV--KLAPLVSSPQPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAES 109

Query: 121 VSQLPEEHSFFEGIRLDGVYD-------SPLGGIDHTFDINGMLMGYSGYFPSKVLDVIR 173
           V++L  + SFF   +  G  D       S  GGI  +FDI  ML GY GYF  +V+D IR
Sbjct: 110 VAKLDSKDSFFAATK--GSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIR 167

Query: 174 MSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYV 233
           M+  +E +E+DS+V+  + DT+NGAPWGL+RISHRERLNLGS+NKYLYD+  G GVTSYV
Sbjct: 168 MNQWVEFIEKDSLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYV 227

Query: 234 IDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKV 293
           IDTG+NV+H  F GRA WGKT+P  D D DGNGHGTHCAGTI S  YGVAK A++VA+KV
Sbjct: 228 IDTGINVNHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKV 287

Query: 294 LRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXX 353
           LRSNGSG+MSDV+KGVE+AAQ HQ A K+ K GFKGSTANMSLGGGKSP+LD        
Sbjct: 288 LRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVK 347

Query: 354 XXXXXXXXXXXEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILS 413
                      E+QDACNTSPA+A   ITVGASTLSDDRAYFSN+GKCVD+FAPGLN+LS
Sbjct: 348 AGIHFAVAAGNENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLS 407

Query: 414 TYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFST 473
           TYIGS+++TATLSGTSMASPHVAGLL YFLSLQP SDSEF   S I+P QLKKKL+A+ST
Sbjct: 408 TYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYST 467

Query: 474 KDVLSDIPSGTPNLLIYN--XXXXXXXXXXXSKEVAQELEFNEKXXXXXXXXXXXXGSKT 531
           KDVL ++P  TPN LIYN              ++V +E    +              +KT
Sbjct: 468 KDVLYELPEDTPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKT 527

Query: 532 DAVFGQIRGLMDRLDII 548
           D +F ++R + D+L+II
Sbjct: 528 DLLFEEVRSVFDKLNII 544

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/552 (53%), Positives = 376/552 (68%), Gaps = 13/552 (2%)

Query: 1   MKFQKSVIPVATLAGLGSALIIPELTGSNEYEKRPERTDDVNNGESVVATSFEKGPSKDE 60
           MK Q + +PVA +A L SAL++PE+  +++           + GES++ +SF K  +K +
Sbjct: 1   MKLQ-TTLPVAMVAALASALVLPEVEEASKDALVAVEETAASLGESIL-SSFSKEVTK-K 57

Query: 61  LAVFASKLTQEVQDRFAPLVVPEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQE 120
            A   + +T       +PLV   +    + +RYI++FK  V P+E+ FH E++ + H Q 
Sbjct: 58  AAESGAGVT------LSPLVTARNMYDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQS 111

Query: 121 VSQLPEEHSFFEGI---RLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPL 177
           V +L    +FFE      +  +  S  GGI  +FD+NGML GY GYF  +++D IRM+PL
Sbjct: 112 VGKLDANDAFFEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPL 171

Query: 178 IEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTG 237
           +  VEQDS+VY  + DT+NGAPWGL+RISHRE+LNLGS+NKYLYD+  G GVTSYVIDTG
Sbjct: 172 VAFVEQDSMVYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTG 231

Query: 238 VNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSN 297
           +N+ H  F GRA WGKT+P  DLD+DGNGHGTHCAGTI S  YGVAK A++VAVKVLRSN
Sbjct: 232 INIDHKDFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSN 291

Query: 298 GSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXX 357
           GSGSMSDV+KGVE+AA+ HQ+AVK+ K GFKGSTANMSLGGGKSP+LD            
Sbjct: 292 GSGSMSDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIH 351

Query: 358 XXXXXXXEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIG 417
                  E+QDACN+SPA+A   ITVGASTL+DDRAYFSN+GKCVD+FAPGLN+LSTYIG
Sbjct: 352 FAVAAGNENQDACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIG 411

Query: 418 SDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSE-FDAGSSISPDQLKKKLLAFSTKDV 476
           S+++TATLSGTSMASPHVAGLL YFLSLQP SDSE F A   I+P QLKKKL+A+STK+ 
Sbjct: 412 SETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNA 471

Query: 477 LSDIPSGTPNLLIYNXXXXXXXXXXXSKEVAQELEFNEKXXXXXXXXXXXXGSKTDAVFG 536
           L D+P  T N LIYN                +  +  +               KTD ++ 
Sbjct: 472 LGDLPEDTVNYLIYNGGGQDLDDFWVKDLEEKVADAKDNTASEFESIIDALEEKTDGLYE 531

Query: 537 QIRGLMDRLDII 548
           +IR + + L+II
Sbjct: 532 EIREIFEGLNII 543

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/524 (55%), Positives = 366/524 (69%), Gaps = 24/524 (4%)

Query: 39  DDVNNGESVVATSFEKGPSKDELAVFASKLTQEVQDRFAPLVVPEDTLGVLENRYIILFK 98
           D +  GES+V +SF K  +KD     A+   + V+   +PLV        + +RYI++FK
Sbjct: 37  DVITAGESIV-SSFSKQMTKD-----AASKGESVE--LSPLVSSSGKYLAIPHRYIVVFK 88

Query: 99  KGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFF---EGIRLDGVYD----------SPLG 145
           + ++P+E+ FH++++ + HLQ V++L   H FF   E    D  ++          +  G
Sbjct: 89  QNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQRSFSAQTREG 148

Query: 146 GIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARI 205
           GI  +FD++G+L GY GYF  +++D IRM+PL++ VEQDSVV+ Q+  T+NGAPWGL+RI
Sbjct: 149 GIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQNGAPWGLSRI 208

Query: 206 SHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGN 265
           SHRE+LNLGS+NKYLYD+  G GVTSYVIDTGVNV H  F GRA WGKTIP  DLD+DGN
Sbjct: 209 SHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTIPTNDLDQDGN 268

Query: 266 GHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKP 325
           GHGTHCAGTI S  YGVAK A++VAVKVLRSNGSGSMSDV+KGVE+AA+ HQ+AVK+ K 
Sbjct: 269 GHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKENKK 328

Query: 326 GFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQDACNTSPASASGPITVGA 385
           GFKGSTANMSLGGGKSP+LD                   E+QDACN+SPASA   +TVGA
Sbjct: 329 GFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPASAENAVTVGA 388

Query: 386 STLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSL 445
           STL+DDRAYFSN+GKCVD+FAPGLN+LSTYIGSD++TATLSGTSMASPHVAGLL YFLSL
Sbjct: 389 STLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHVAGLLTYFLSL 448

Query: 446 QPGSDSE-FDAGSSISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYNXXXXXXXXXXXSK 504
           QP SDSE F A   I+P QLKKKL+A+STK+VL DIP  T N LI+N            +
Sbjct: 449 QPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGGGEGLDDFWGKE 508

Query: 505 EVAQELEFNEKXXXXXXXXXXXXGSKTDAVFGQIRGLMDRLDII 548
            V  E+E  +               KTD ++ +IR + D ++II
Sbjct: 509 SVVDEVE--DTISSEIESFIDALEEKTDVLYEEIREVFDHMNII 550

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/488 (59%), Positives = 342/488 (70%), Gaps = 25/488 (5%)

Query: 75  RFAPLVV-----PEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHS 129
           + APLV      P+    ++ NRYII+FKK V P+E  FHRE ++Q  LQ V  L  E +
Sbjct: 188 KLAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDA 247

Query: 130 FFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYT 189
           FF   R   +  S  GGI  +F+I+ +  GY GYF  +++D+IR +PL++ VE+DSVV  
Sbjct: 248 FFISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEA 307

Query: 190 QKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRA 249
              DT+N APWGLAR+SHRERLNLGS+NKYLYD+  G GVTSYVIDTGVNV+H  F  RA
Sbjct: 308 TDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRA 367

Query: 250 KWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGV 309
            WGKTIP  D D DGNGHGTHCAGTI S  YGVAK A++VAVKVLRSNGSG+MSDVLKGV
Sbjct: 368 IWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVLKGV 427

Query: 310 EWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQDA 369
           E+AA+ HQ   ++KK GFKGSTANMSLGGGKSP+LD                   E+QDA
Sbjct: 428 EYAAKAHQKQAEEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDA 487

Query: 370 CNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTS 429
           CNTSPASA   ITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSD +TATLSGTS
Sbjct: 488 CNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTS 547

Query: 430 MASPHVAGLLAYFLSLQPGSDSE-FDAGS-SISPDQLKKKLLAFSTKDVLSDIPSGTPNL 487
           MASPHVAGLL YFLSLQPGSDSE F+ G  S++P QLKKKL+ +STKD+L DIP  TPN 
Sbjct: 548 MASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNA 607

Query: 488 LIYN-------XXXXXXXXXXXSKEVAQELEFNEKXXXXXXXXXXXXGSKTDAVFGQIRG 540
           LIYN                  S    QEL  +E             GSKTD +F Q+R 
Sbjct: 608 LIYNGGGQDLSAFWNDTKKSHSSSGFKQELNLDE-----------FIGSKTDLIFEQVRD 656

Query: 541 LMDRLDII 548
           ++D+L+II
Sbjct: 657 VLDKLNII 664

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/489 (58%), Positives = 345/489 (70%), Gaps = 24/489 (4%)

Query: 73  QDRFAPLVV-----PEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEE 127
            +R APLV      P+    ++ NRYII+FK+G   +EI FH+E ++Q  LQ V  L  E
Sbjct: 158 HNRLAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAE 217

Query: 128 HSFFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVV 187
            +FF   +   +  S  GGI  +F+I+ +  GY GYF  +++D+IR +PL++ VE+DS+V
Sbjct: 218 DAFFISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIV 277

Query: 188 YTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGG 247
              + DT+N APWGLARISHRERLNLGS+NKYLYD+  G GVTSYVIDTGVN++H  F  
Sbjct: 278 EATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEK 337

Query: 248 RAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLK 307
           RA WGKTIP  D D DGNGHGTHCAGTI S  YGVAK A++VAVKVLRSNGSG+MSDV+K
Sbjct: 338 RAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVK 397

Query: 308 GVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQ 367
           GVE+AA+ HQ   ++KK GFKGSTANMSLGGGKSP+LD                   E+Q
Sbjct: 398 GVEYAAKAHQKEAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQ 457

Query: 368 DACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSG 427
           DACNTSPASA   ITVGASTLSDDRAYFSN+GKCVDVFAPGLNILSTYIGSD +TATLSG
Sbjct: 458 DACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSG 517

Query: 428 TSMASPHVAGLLAYFLSLQPGSDSE-FDAGS-SISPDQLKKKLLAFSTKDVLSDIPSGTP 485
           TSMASPHVAGLL YFLSLQPGSDSE F+ G  S++P QLKKKL+ +STKD+L DIP  TP
Sbjct: 518 TSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTP 577

Query: 486 NLLIYN------XXXXXXXXXXXSKEVAQELEFNEKXXXXXXXXXXXXGSKTDAVFGQIR 539
           N+LIYN                 S    QEL  +E             GSKTD +F Q+R
Sbjct: 578 NVLIYNGGGQDLSAFWNDTKKSHSSGFKQELNMDE-----------FIGSKTDLIFDQVR 626

Query: 540 GLMDRLDII 548
            ++D+L+II
Sbjct: 627 DILDKLNII 635

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/506 (57%), Positives = 346/506 (68%), Gaps = 29/506 (5%)

Query: 51  SFEKGPSKDELAVFASKLTQEVQDRFAPLVVPEDTLGVLENRYIILFKKGVNPQEIGFHR 110
           + EK    ++LA   S        +F P  +P+    ++ NRYII+FKKGV  +   FH+
Sbjct: 124 TLEKARHNEKLAPLVSTA------QFDPAAMPK----IIPNRYIIVFKKGVPQEATDFHK 173

Query: 111 ELIEQVHLQEVSQLPEEHSFFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLD 170
           E + Q  LQ V  L  E +FF   R   +  S  GGI  +F+I+ M  GY GYF  +++D
Sbjct: 174 ESVHQAQLQSVENLSAEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIID 233

Query: 171 VIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVT 230
           +IR +PL++ VE+DSVV     DT+N APWGLARISHRERLNLGS+NKYLYD+  G GVT
Sbjct: 234 LIRQNPLVDFVERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVT 293

Query: 231 SYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVA 290
           SYVIDTGVNV+H  F  RA WGKTIP  D D DGNGHGTHCAGTI S  YGVAK A++VA
Sbjct: 294 SYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVA 353

Query: 291 VKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXX 350
           VKVLRSNGSG+MSDV+KGVE+AA+ HQ   ++KK GFKGSTANMSLGGGKSP+LD     
Sbjct: 354 VKVLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNA 413

Query: 351 XXXXXXXXXXXXXXEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLN 410
                         E+QDACNTSPASA   ITVGASTLSDDRAYFSN+GKCVD+FAPGLN
Sbjct: 414 AVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLN 473

Query: 411 ILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSE-FDAGS-SISPDQLKKKL 468
           ILSTYIGSD +TATLSGTSMASPHVAGLL YFLSLQPGSDSE F+ G  S++P QLK KL
Sbjct: 474 ILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKL 533

Query: 469 LAFSTKDVLSDIPSGTPNLLIYN------XXXXXXXXXXXSKEVAQELEFNEKXXXXXXX 522
           + +STKD+L D+P  TPN LIYN                 S    QEL  +E        
Sbjct: 534 IHYSTKDILFDVPEDTPNALIYNGGGQDLSAFWNDTKKSHSSRFKQELNMDE-------- 585

Query: 523 XXXXXGSKTDAVFGQIRGLMDRLDII 548
                GSKTD +F Q+R ++D+L+II
Sbjct: 586 ---FIGSKTDLIFEQVRDVLDKLNII 608

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/489 (58%), Positives = 344/489 (70%), Gaps = 24/489 (4%)

Query: 73  QDRFAPLVV-----PEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEE 127
            ++ APLV      P+    ++ NRYI++FKKGV  +E+ FH+E + Q  LQ V  L  E
Sbjct: 131 NNKLAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAE 190

Query: 128 HSFFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVV 187
            +FF   R   +  S  GGI  +F+I+ +  GY GYF  +++D+IR +PL++ VE+DSVV
Sbjct: 191 DAFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVV 250

Query: 188 YTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGG 247
              + DT+N APWGLARISHRERLNLGS+NKYLYD+  G GVTSYVIDTGVN++H  F  
Sbjct: 251 EATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEK 310

Query: 248 RAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLK 307
           RA WGKTIP  D D DGNGHGTHCAGTI S  YGVAK A++VAVKVLRSNGSG+MSDV+K
Sbjct: 311 RAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVK 370

Query: 308 GVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQ 367
           GVE+AA+ HQ   ++KK GFKGSTANMSLGGGKSP+LD                   E+Q
Sbjct: 371 GVEYAAKAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQ 430

Query: 368 DACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSG 427
           DACNTSPASA   ITVGASTLSDDRAYFSN+GKCVDVFAPGLNILSTYIGSD +TATLSG
Sbjct: 431 DACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSG 490

Query: 428 TSMASPHVAGLLAYFLSLQPGSDSE-FDAGS-SISPDQLKKKLLAFSTKDVLSDIPSGTP 485
           TSMASPHVAGLL YFLSLQPGSDSE F+ G  S++P QLKKKL+ +STKD+L DIP  TP
Sbjct: 491 TSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTP 550

Query: 486 NLLIYNXXXXXXXXXXXSKEVA------QELEFNEKXXXXXXXXXXXXGSKTDAVFGQIR 539
           N LIYN             + +       EL  +E             GSKTD +F Q+R
Sbjct: 551 NFLIYNGGGQDLSAFWNDTKKSHPSGSKHELNMDE-----------FIGSKTDLLFEQVR 599

Query: 540 GLMDRLDII 548
            ++D+L+II
Sbjct: 600 DVLDKLNII 608

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/578 (53%), Positives = 381/578 (65%), Gaps = 44/578 (7%)

Query: 1   MKFQKSVIPVATLAGLGSALIIPELTGS------------------NEYEKRPERTDDVN 42
           M+F+++V+PVA LA LG+AL+IPEL G                   +   +RP+      
Sbjct: 1   MRFEQTVLPVAALASLGAALVIPELKGKVLCHGKDKALDHPKDKALDHPRERPQHRGPRR 60

Query: 43  NGESVVATSF----EKGPSKD---ELAVFASKLTQEVQDRFAPLVVPEDTLGVLENRYII 95
                           GPS +   +       +  ++ +  APL +P +      +RYI+
Sbjct: 61  GPRRGPPPPLPEGRHDGPSHEGHHDALPEHRGIVHKMGEGVAPLSIPPN---AFPHRYIV 117

Query: 96  LFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFF--EGIRLDGVYDSPLGGIDHTFDI 153
           + K   +P+EI  H E I Q  LQ V +L ++  FF  +G+R         GGI  +FD+
Sbjct: 118 VLKHS-SPEEIALHMEAITQSQLQSVGELAQDDPFFSAQGVRT-------TGGIQDSFDV 169

Query: 154 NGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNL 213
            G+L GY GYF   V+++IR SP+++ VE DS V+  + DT+NGAPWGL+RISHRERLNL
Sbjct: 170 AGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRERLNL 229

Query: 214 GSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAG 273
           GS+NKYL+D++ G GVTSYVIDTG+NV H  F GRA WGKTIP  D D DGNGHGTHCAG
Sbjct: 230 GSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHGTHCAG 289

Query: 274 TIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTAN 333
           TI S  YGVAKGAD+VAVKVLRSNGSGSMSDV+KGVE+AAQ HQ AVK KK GFKGSTAN
Sbjct: 290 TIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQSHQKAVKDKKKGFKGSTAN 349

Query: 334 MSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQDACNTSPASASGPITVGASTLSDDRA 393
           MSLGGGKSP+LD                   E+QDACNTSPA+A   +TVGASTLSDDRA
Sbjct: 350 MSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLSDDRA 409

Query: 394 YFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSE- 452
           YFSNYGKCVD+FAPGLNILSTYIGSD +TATLSGTSMASPHVAGLL YFLSLQP SDS+ 
Sbjct: 410 YFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPDSDSDF 469

Query: 453 FDAGSS-ISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYNXXXXXXXXXXXSKEVAQELE 511
           FDAGS  ++P+QLKKKL+A+STKD+L D+P  TPN LIYN             +   + E
Sbjct: 470 FDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFWDGHD---KQE 526

Query: 512 FNEK-XXXXXXXXXXXXGSKTDAVFGQIRGLMDRLDII 548
            N +             G+KTDA+F Q+R ++DRL+II
Sbjct: 527 ANTRFQDTDLQELSDNLGAKTDALFDQVRDVLDRLNII 564

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/570 (51%), Positives = 372/570 (65%), Gaps = 31/570 (5%)

Query: 1   MKFQKSVIPVATLAGLGSALIIPELTGSNEYEKRP-----ERTDDVN------NGESVVA 49
           MKF+ +++ +  L+ + +AL+IPE+   N++  +        + D++      NG+   A
Sbjct: 1   MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASSDLDKPQHHANGK---A 57

Query: 50  TSFEKGPSKDELAVFASKLTQEVQDRFAPLVVPEDTLGVLENRYIILFKKGVNPQEIGFH 109
            S  +G   D       +   +     APL    D    + NRYII+FKK  +  E+ FH
Sbjct: 58  RSKSRGRCADSKKFDKLRPVDDASAILAPLSTVNDIANKIPNRYIIVFKKDASADEVKFH 117

Query: 110 RELIEQVHLQEVSQLPEEHSFFEGIRLD----GVYDSPL-GGIDHTFDINGMLMGYSGYF 164
           +EL+   H + +  L +   FF     +    GV    L GGI  +FDI G L GY GYF
Sbjct: 118 QELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYF 177

Query: 165 PSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQ 224
             +V+D IR SPL+E VE+DS+V++   +T+N APWGLARISHRE+LNLGS+NKYLYD+ 
Sbjct: 178 TKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDD 237

Query: 225 GGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAK 284
            G GVT+YV+DTGVNV+H  F GRA WGKTIP  D D DGNGHGTHCAGTIGS  YGVAK
Sbjct: 238 AGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAK 297

Query: 285 GADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSL 344
            ADIVAVKVLRSNGSG+MSDV+KGVE+ A+ H+ AV+++K GFKGSTANMSLGGGKSP+L
Sbjct: 298 NADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPAL 357

Query: 345 DQXXXXXXXXXXXXXXXXXXEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDV 404
           D                   E+QDACNTSPA+A   ITVGASTLSD+RAYFSN+GKCVD+
Sbjct: 358 DLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDI 417

Query: 405 FAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSE-FDAGSSISPDQ 463
           F PGLNILSTYIGSD++TATLSGTSMA+PHV GLL YFLSLQP +DSE F A   I+P Q
Sbjct: 418 FGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQ 477

Query: 464 LKKKLLAFSTKDVLSDIPSGTPNLLIYN-----XXXXXXXXXXXSKEVAQELEFNEKXXX 518
           LKKKL+ FSTK+VLSD+P  T N LIYN                 KE +   EF+ +   
Sbjct: 478 LKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLI 537

Query: 519 XXXXXXXXXGSKTDAVFGQIRGLMDRLDII 548
                     SKTDA+F  +R L+D+ +II
Sbjct: 538 NSLD------SKTDAIFDDVRQLLDQFNII 561

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/510 (57%), Positives = 360/510 (70%), Gaps = 29/510 (5%)

Query: 1   MKFQKSVIPVATLAGLGSALIIPELTGSNEYEKRPERTDDVNNGESVVATSFEKGPSKDE 60
           MK +K+V+P+A LA LGSAL+IP L   ++ +K        N+   VVA   E      +
Sbjct: 1   MKIEKTVLPIAALAALGSALVIPNLAKEDK-DKLAINNKKFNDITDVVAKYSE------Q 53

Query: 61  LAVFASKLTQEVQD----RFAPLVVP-------------EDTLGVLENRYIILFKKGVNP 103
           +   A K+ + VQD    + APLV P                  ++ NRYI++FKK + P
Sbjct: 54  IIESARKIGKSVQDSVNLKMAPLVTPTPYPVVSGASANSNANSNIIPNRYIVVFKKSILP 113

Query: 104 QEIGFHRELIEQVHLQEVSQLPEEHSFFEGIRLDGVYDSPL--GGIDHTFDINGMLMGYS 161
           +E+ FH+ELI Q+ L+  ++LP++  FF       + D  +  GGI  TF+I+ +L GY 
Sbjct: 114 EEVDFHKELINQIQLESAAKLPKDDKFFSA---SAIEDESINQGGILTTFNISNLLNGYV 170

Query: 162 GYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLY 221
           GYF  +VL++IRM+PL+E VE+DS+V   + D +N APWGLARISHRERLNLGS+NKYLY
Sbjct: 171 GYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLY 230

Query: 222 DEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYG 281
           D+  G GVT YVIDTG+N  HN F  RA WGKTIP  D D DGNGHGTHCAGTI S+ YG
Sbjct: 231 DDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYG 290

Query: 282 VAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKS 341
           VAK A++VAVKVLRSNGSGSMSDV+KGVE+AA+ H  A K+KK GFKGSTANMSLGGGKS
Sbjct: 291 VAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKKGFKGSTANMSLGGGKS 350

Query: 342 PSLDQXXXXXXXXXXXXXXXXXXEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKC 401
           P+LD                   E+QDACNTSPASA   ITVGASTLSDDRAYFSN+GKC
Sbjct: 351 PTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKC 410

Query: 402 VDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISP 461
           VD+FAPGLNILSTYIG D +TATLSGTSMASPHVAGLL YFLSLQPGSDSEF   + ++P
Sbjct: 411 VDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTP 470

Query: 462 DQLKKKLLAFSTKDVLSDIPSGTPNLLIYN 491
            Q+KKKL+ +S+KDVL D+P GTPN LI+N
Sbjct: 471 AQMKKKLINYSSKDVLFDLPEGTPNKLIFN 500

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/407 (65%), Positives = 311/407 (76%), Gaps = 8/407 (1%)

Query: 88  VLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFFEGIR-LDGVYDSPLGG 146
           ++ +RYII FKK V P+EI FH++ I ++  Q ++QLP +H +F  +  LD     P+  
Sbjct: 124 IIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGLD--LQQPI-- 179

Query: 147 IDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARIS 206
           ID +F+IN +L GY GYF   V+D IR++PL++ VEQDS V   + DT+NGAPWGLARIS
Sbjct: 180 ID-SFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARIS 238

Query: 207 HRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNG 266
           HRERLNLGS+NKYL+D++ G GVT+YVIDTGVNV HN F GRA WGKTIP  D D DGNG
Sbjct: 239 HRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGNG 298

Query: 267 HGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPG 326
           HGTHCAGTI S  YGVAK A++VAVKVLRSNGSGSMSDVLKGVE+A   H   VK KK G
Sbjct: 299 HGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVEYATASHLADVKNKKSG 358

Query: 327 FKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQDACNTSPASASGPITVGAS 386
           FKGSTANMSLGGGKSPSLD                   E+QDACNTSPASA   ITVGAS
Sbjct: 359 FKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGAS 418

Query: 387 TLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQ 446
           TLSDDRAYFSN+GKCVDVFAPGLNILSTYIGSD +TATLSGTSMASPHVAGLL+YFLSLQ
Sbjct: 419 TLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFLSLQ 478

Query: 447 PGSDSEFDAGSS--ISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYN 491
           P  DSEF       I+P QLKK+L+++ TKD+L DIP  TPN+L++N
Sbjct: 479 PEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFN 525

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  526 bits (1354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/579 (48%), Positives = 368/579 (63%), Gaps = 35/579 (6%)

Query: 1   MKFQKSVIPVATLAGLGSALIIPE----------LTGSNEYEKRPE------------RT 38
           MK Q  V+PVA  + LG+ALI+P           L G   + + P             R 
Sbjct: 1   MKVQSVVLPVAVFSTLGAALILPWMDPEIRLDVGLHGRGPHGRVPPPHHHKMGEHGRGRG 60

Query: 39  DDVNNGESVVATSFEKGPSKDELAVFASKLTQEVQDRFAPLVVPEDTLGVLENRYIILFK 98
              + G SV+    E+         F    +Q+  D    L    D    + +RYI++FK
Sbjct: 61  KGHHRGSSVLLVDDEEDKVSPMFEYFEFDSSQDFVDM--KLASLSDNSRAIPHRYIVIFK 118

Query: 99  KGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFF---EGIRLDGVYDSPL-GGIDHTFDIN 154
            GV   ++G H++L+   H++ ++QL   HSFF   EG+  +G+    + GGI+  F+I 
Sbjct: 119 DGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIA 178

Query: 155 GMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLG 214
           G L GY GYF   +LD+IR S L++++EQDS+V+    +T+ GAPWGLAR+SHRERLNLG
Sbjct: 179 GSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLG 238

Query: 215 SYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGT 274
           S+NKYLYD+  G GVT+YVIDTG+N+ H +F GRA+WGKTIP+ D D DGNGHGTHCAGT
Sbjct: 239 SFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGT 298

Query: 275 IGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANM 334
           I S TYGVAK A +VAVKVLR+NG+G+MSDVL+GVE+   +H+ A     P FKGSTANM
Sbjct: 299 IASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKA--SGDPNFKGSTANM 356

Query: 335 SLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQDACNTSPASASGPITVGASTLSDDRAY 394
           SLGGGKS +L+                   E+QDACNTSPAS+   ITV ASTLSDDRAY
Sbjct: 357 SLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSDDRAY 416

Query: 395 FSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFD 454
           FSN+G CVD+FAPGLNILSTYIGSD++ ATLSGTSMASPHVAGLLAYFLSLQP S SE+ 
Sbjct: 417 FSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYY 476

Query: 455 AGSSISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYNXXXXXXXXXXXSKEVAQELE--- 511
            GSSISP+ LKKK++A+ +K++L+++P+ T N LI+N           SK    E E   
Sbjct: 477 TGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVS 536

Query: 512 --FNEKXXXXXXXXXXXXGSKTDAVFGQIRGLMDRLDII 548
               +              S + ++FG+IR  +DRLD+I
Sbjct: 537 SSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/493 (55%), Positives = 338/493 (68%), Gaps = 22/493 (4%)

Query: 75  RFAPLVVPEDTLG------------VLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVS 122
           + APL+ P  T G            +L N+YII+FK  +N  EI +H+ELI ++  Q  S
Sbjct: 215 KLAPLITP--TFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSAS 272

Query: 123 QLPEEHSFFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVE 182
           +LP  H FF     +       GGI  +F+IN +L GYSGYF  +V+D+IR++PL++ VE
Sbjct: 273 RLPPHHHFFHSTSEEEEESFRNGGIISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVE 332

Query: 183 QDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHH 242
           +DS+V T + +T+N APWGL+RISHRERLNLGS+NKYLYD+  G GVT +VIDTG+NV+H
Sbjct: 333 RDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNH 392

Query: 243 NQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSM 302
             FG RA WGKTIP+ D D DGNGHGTHCAGTI S+ YGVAK A++VAVKVLRSNGSGSM
Sbjct: 393 VDFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSM 452

Query: 303 SDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXX 362
           SDV+KGVE+AA+ H N  K KK  +KGSTANMSLGGGKSP+LD                 
Sbjct: 453 SDVIKGVEFAAETHLNNEKNKK-DYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAA 511

Query: 363 XXEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGS-DSS 421
             E+QDACN+SPASA   ITVGASTLSDDRAYFSN+G+CVDVFAPGLNILSTY+G  + +
Sbjct: 512 GNENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDN 571

Query: 422 TATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSS---ISPDQLKKKLLAFSTKDVLS 478
           TATLSGTSMASPHVAGLL YFLSLQP S S F    S   I+P+QLKKKL+A+ST D+L 
Sbjct: 572 TATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILY 631

Query: 479 DIPSGTPNLLIYNXXXXXXXXXXXSK---EVAQELEFNEKXXXXXXXXXXXXGSKTDAVF 535
           D+P GTPN LIYN            K   +  +E    +K              KTD  F
Sbjct: 632 DLPDGTPNKLIYNGAGGDISDLWNGKVQEQAHEEPAHEDKINFENLVDSDSMSGKTDLFF 691

Query: 536 GQIRGLMDRLDII 548
            QIR + ++++II
Sbjct: 692 DQIRNVFEKMNII 704

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  518 bits (1335), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 256/422 (60%), Positives = 315/422 (74%), Gaps = 17/422 (4%)

Query: 75  RFAPLVVPEDTLG---VLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFF 131
           ++APL   E+T     V+ N+YII+FKK V+ +++  H++LI +   Q  S   E  S  
Sbjct: 215 KYAPLHSMENTKYENLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDETSS-- 272

Query: 132 EGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQK 191
                     S LGGI+  F++  +  GY G+F  +++  IR+SP+++ VEQDS+V+  +
Sbjct: 273 ----------SILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANE 322

Query: 192 ADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKW 251
            DT+N APWGLARISHR+ LNLGSYNKYLYD+  G GVT+YVIDTG+N+ H +FGGRA W
Sbjct: 323 VDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVW 382

Query: 252 GKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEW 311
           GKTIP  D D DGNGHGTHCAGTI S  YGVAK A++VAVKVLRS+GSG+MSDVLKGVE+
Sbjct: 383 GKTIPENDQDVDGNGHGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKGVEY 442

Query: 312 AAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQDACN 371
           AA  HQ A+++KK GFKGSTANMSLGGGKS SLD                   E+QDACN
Sbjct: 443 AAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACN 502

Query: 372 TSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMA 431
           +SPA++   ITVGASTLSDDRAYFSN+GKCVDVFAPGLNILSTYIGSD +TATLSGTSMA
Sbjct: 503 SSPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMA 562

Query: 432 SPHVAGLLAYFLSLQPGSDSEF--DAGSSISPDQLKKKLLAFSTKDVLSDIPSGTPNLLI 489
           SPHVAGLL+YFLS+QP +DSEF     +SISP QLKKKL+A+STK++  D+P  TPNLL+
Sbjct: 563 SPHVAGLLSYFLSMQPDADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDLPEKTPNLLV 622

Query: 490 YN 491
           YN
Sbjct: 623 YN 624

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%)

Query: 1  MKFQKSVIPVATLAGLGSALIIPEL 25
          MK  K+++ VATLA LGS+L+IPE 
Sbjct: 1  MKLDKTLVSVATLATLGSSLVIPEF 25

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  509 bits (1311), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 261/472 (55%), Positives = 326/472 (69%), Gaps = 15/472 (3%)

Query: 88  VLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFFEGIRLDGVYDSPLGGI 147
           ++ ++YI++ KKGV+P+ +      +   H   +  LP+EH FF  +  +G+   P GGI
Sbjct: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGL---PRGGI 57

Query: 148 DHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISH 207
              F+IN +  G  GYFP  V+ ++  S ++E VE+DSVV+    DT+N APWGLARISH
Sbjct: 58  KDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISH 117

Query: 208 RERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGH 267
           R+RLNLG++NKYLYD  GG GVT+YVIDTG+NV H +F GRA+WGKTIP  DLD DGNGH
Sbjct: 118 RDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGH 177

Query: 268 GTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGF 327
           GTHCAGTI S  YG+AK A++VAVKVL+S+GSG+MSDV+KGVE+AAQ H    K  K  F
Sbjct: 178 GTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKESKNNKK-F 236

Query: 328 KGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQDACNTSPASASGPITVGAST 387
           KGSTANMSLGGGKSP+LD                   E+QDACNTSPASA   ITVGAST
Sbjct: 237 KGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGAST 296

Query: 388 LSDDRAYFSNYGKCVDVFAPGLNILSTYIG-SDSSTATLSGTSMASPHVAGLLAYFLSLQ 446
           LSDDRAYFSN+GKCVD+FAPGLNILSTYIG ++  TA+LSGTSMASPHVAGLL YFLSLQ
Sbjct: 297 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQ 356

Query: 447 PGSDSEFDAGSS--ISPDQLKKKLLAFSTKDVLSDIPS-GTPNLLIYNXX-------XXX 496
           P SDSEF   S   ++P QLKKKL+A+STK+VL+D+P   +PNLLIYN            
Sbjct: 357 PDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNS 416

Query: 497 XXXXXXSKEVAQELEFNEKXXXXXXXXXXXXGSKTDAVFGQIRGLMDRLDII 548
                 S E  ++    E              + TD++FGQ+R L+D+++II
Sbjct: 417 TSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  509 bits (1311), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 269/563 (47%), Positives = 355/563 (63%), Gaps = 37/563 (6%)

Query: 1   MKFQKSVIPVATLAGLGSALIIPELTGSNEYEKRPERTDDVNNGESVVATSFEKGPSKDE 60
           MK Q++V P   L    + LI+P+                    E VVA +      + +
Sbjct: 1   MKLQRAVWPAVALTTAQALLILPQA-----------------EDELVVAEA-----HRGQ 38

Query: 61  LAVFASKLTQEVQ----DRFAPLVVPEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQV 116
           L  + ++  QE +    ++ +PL   +D    + ++YI++F++GV+ +E  FH EL+E  
Sbjct: 39  LVQWMARENQERKAQGAEQQSPLFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAA 98

Query: 117 HLQEVSQLPEEHSFFEGIRLDG-----VYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDV 171
           H + V++L E+H+FF   R +            GGI+  F +   L GY GYF   ++ +
Sbjct: 99  HAESVARLDEQHAFFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGL 158

Query: 172 IRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTS 231
           +R +P +  VE+DS+V+     T+NGAPWGLAR+SHRE+LN GS+NKYLYD+  G GVTS
Sbjct: 159 LRSNPHVHFVEEDSMVFASDFTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTS 218

Query: 232 YVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAV 291
           YVIDTG+N+ H  F  RA WGKTIP  D D DGNGHGTHCAGTI S TYGVAK A++VAV
Sbjct: 219 YVIDTGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGVAKKANVVAV 278

Query: 292 KVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXX 351
           KVLRSNG+GSMSDVL+GVE+A + H+ A ++   GFKGSTANMSLGGG+S +LD      
Sbjct: 279 KVLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQALDLAVDAA 338

Query: 352 XXXXXXXXXXXXXEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNI 411
                        E+QDACNTSPA++   ITVGASTL+DDRAYFSN+G+CVD+FAPG+NI
Sbjct: 339 VDAGIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNI 398

Query: 412 LSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAF 471
           LSTYIGSD++ ATLSGTSMASPHVAGLL YFLSLQP  DSEF    +ISP+ LKKK++ F
Sbjct: 399 LSTYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDF 458

Query: 472 STKDVLSDIPSGTPNLLIYNXXXXXXXXXXXSK-EVAQELEFN-----EKXXXXXXXXXX 525
            TKD LS +P+ T N+LIYN           +K +     +F      E           
Sbjct: 459 GTKDALSSLPARTANVLIYNGGGADLSDFWGNKPKKVSGPKFTYADDEEAMGSDLDRLIH 518

Query: 526 XXGSKTDAVFGQIRGLMDRLDII 548
              S TDA+F   R ++DR++II
Sbjct: 519 ELESSTDAMFSGFRTILDRMNII 541

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  498 bits (1283), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 269/499 (53%), Positives = 330/499 (66%), Gaps = 26/499 (5%)

Query: 1   MKFQKSVIPVATLAGLGSALIIPELT---GSNEYEKRPERTDDVNNGESVVATSFEKGPS 57
           MK  + V+    L  +  AL++PE+    G ++ E    R D   +G          GP 
Sbjct: 1   MKITQPVLWAVALNRVAEALVLPEIRDERGVSQGEHGGRRHDVEEHGRR---GRPHHGPK 57

Query: 58  KDELAVFASKLTQEVQDR--FAPLVVP---EDTLGVLENRYIILFKKGVNPQEIGFHREL 112
            ++      K  +E  D    APL  P           N+YIILFK+GV  ++I  H++L
Sbjct: 58  HEKDEHRPCKHGKEAHDEEELAPLYTPGSALSASSSRSNKYIILFKEGVTAEQISAHKQL 117

Query: 113 IEQVHLQEVSQLPEEHSFFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVI 172
           ++QV L E S +  +     GI  D V DS        FD+ G+L GY       VL+++
Sbjct: 118 LQQV-LLETSDVSAQ-----GIVAD-VLDS--------FDLEGVLSGYVAELSPMVLELV 162

Query: 173 RMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSY 232
           R SP +++VEQDS V+T + DT+N APWGLARISHR+ L+LGS+NKYLYD+  G GV SY
Sbjct: 163 RRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSY 222

Query: 233 VIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVK 292
           +IDTG+NV H +F GRA+WGKTIP  D DEDGNGHGTHCAGTI S  YGVAK A+++AVK
Sbjct: 223 IIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVK 282

Query: 293 VLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXX 352
           VLRSNGSGSMSDV+ GVE+AA+ H +  K     FKGSTANMSLGGGKSPSLD+      
Sbjct: 283 VLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAV 342

Query: 353 XXXXXXXXXXXXEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNIL 412
                       E+QDACNTSPA++   ITVGASTLSDDRAYFSN+G CVD+FAPGLNIL
Sbjct: 343 KLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNIL 402

Query: 413 STYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFS 472
           STY GSD +TATLSGTSMASPHVAGLL YFLSLQP   S+F   + I+P+QLKKKLL +S
Sbjct: 403 STYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYS 462

Query: 473 TKDVLSDIPSGTPNLLIYN 491
           TK VL D+P  TPN LIYN
Sbjct: 463 TKGVLFDLPEDTPNALIYN 481

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  477 bits (1227), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 243/413 (58%), Positives = 301/413 (72%), Gaps = 9/413 (2%)

Query: 84  DTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFFEGIRLD-GVYDS 142
           D   ++ +RYII+FK GV+ ++I FH+ELI  +HLQ+ S    +  F E ++ D  V +S
Sbjct: 53  DAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSND--FTEYLQTDINVPES 110

Query: 143 ---PLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAP 199
               LGGI   FDI+ +L GY  Y   ++L  IR++PLI  +E D++V+T   +T+N AP
Sbjct: 111 MRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAP 170

Query: 200 WGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGD 259
           WGLARISHRE LNL ++NKYLYD+  G  V +YVIDTGV+V+H +F  RA WGKTIP  D
Sbjct: 171 WGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLND 230

Query: 260 LDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNA 319
            D DGNGHGTH AGTIGS  YGVAK  +I+AVKVLRSNGSGSMSDV+KGVE+A   H   
Sbjct: 231 QDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLER 290

Query: 320 VKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQDACNTSPASASG 379
           +K +K   KGS ANMSLGGGKSP+LD                   E+Q+ACN+SPASA  
Sbjct: 291 MKNEK-NLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQ 349

Query: 380 PITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGS-DSSTATLSGTSMASPHVAGL 438
            +TVGAST+SD+RAYFSN+G+CVD+FAPGLNILSTYIG+ D  TATLSGTSMASPHVAGL
Sbjct: 350 AVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGL 409

Query: 439 LAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYN 491
           LAY+LSLQP   SEF +  +IS  QLKKKL+ ++TKDVL D+P GTPN+LIYN
Sbjct: 410 LAYYLSLQPEKSSEF-STRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYN 461

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  476 bits (1224), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 242/432 (56%), Positives = 300/432 (69%), Gaps = 8/432 (1%)

Query: 64  FASKLTQEVQDRFAPLVVPEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQ 123
           F   L    + R A L+ P     V+   YI++F +GV   EI  H E + Q+ LQ V+ 
Sbjct: 12  FCHALVLPEEVRPASLITPNSE--VIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTD 69

Query: 124 LPEEHSFFE-GIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVE 182
           LP +H FF      D   +  LGG+   F I   L GY+G F  +V++ +R+SPL++ +E
Sbjct: 70  LPYDHEFFTISTSSDVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIE 129

Query: 183 QDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHH 242
           +DS+V+T +A T+  APWGLARISHR RLNL ++NKYLYD+ GG GV +YVIDTG+N+ +
Sbjct: 130 RDSMVHTTEATTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITN 189

Query: 243 NQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSM 302
             FGGRA WGKTIPAG+ + DGNGHGTH AGTI S  YGVAK   + AVKVLRSNG+GSM
Sbjct: 190 VDFGGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSM 249

Query: 303 SDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXX 362
           SDVLKGVE+    HQ  V     GFKGS ANMSLGGGKS SLD                 
Sbjct: 250 SDVLKGVEYVVGAHQRDV--GTAGFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAA 307

Query: 363 XXEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSST 422
             E+QDACNTSPA+A   ITVGASTLSD RAYFSN+G+CV +FAPGLNILSTYIGS  +T
Sbjct: 308 GNENQDACNTSPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDAT 367

Query: 423 ATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDA---GSSISPDQLKKKLLAFSTKDVLSD 479
           ATLSGTSMASPH+AGL+AYFLSLQP   S+F +    ++I+PDQLKKK++AF TK+ L D
Sbjct: 368 ATLSGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRD 427

Query: 480 IPSGTPNLLIYN 491
           +P+ TPN++ YN
Sbjct: 428 LPANTPNVIAYN 439

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  456 bits (1173), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 258/514 (50%), Positives = 330/514 (64%), Gaps = 36/514 (7%)

Query: 1   MKFQKSVIPVATLAGLGSALIIPELTGSNEYEKRPERTDD-VNNGESVVATSFEKGPSKD 59
           MK Q +++     A +  AL+IP L   ++   R    D   NN  +V A       +  
Sbjct: 35  MKLQNTLVSAVIAASVAEALVIPAL---DQGRGRGHALDHGPNNNNNVPAFMMRAAAAPA 91

Query: 60  ELAVFASKLTQEV---------QDRFAPLVVPEDT-LGVLE-NRYIILFKKGVNPQEIGF 108
                   +T ++           R   L    D  +G  + +RYII+FKKGV  +++  
Sbjct: 92  SAMEMVKDVTDQILAYYQHASPASRGLELAALHDNGVGTADHDRYIIVFKKGVFKEQVDQ 151

Query: 109 HRELIEQV--HLQEVSQLPEEHSFFEGIR--LDGVYDSPLGGIDHTFDINGMLMGYSGYF 164
           H +++  +   L E  Q P        +R   D V D        TF++ G   GY    
Sbjct: 152 HLKMMSALFRRLSE-EQRPAAAPGASALRDGFDRVMD--------TFEVAGAFSGYIATV 202

Query: 165 PS-KVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLY-D 222
            S K++D IR++PL++ VE+DSVV++   +T+N APWGLARISHRE LNLG++NKYLY  
Sbjct: 203 ASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHREGLNLGNFNKYLYAS 261

Query: 223 EQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGV 282
              G GVT+YV+DTG++V H +FG RAKWGKTIP  D D DGNGHGTHCAGTIGS  YGV
Sbjct: 262 NSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGV 321

Query: 283 AKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDH----QNAVKQKKPGFKGSTANMSLGG 338
           AKGA++VAVKVLRS+GSG+MSDVLKGVEW A +H    + + K K   +KG+TANMSLGG
Sbjct: 322 AKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGG 381

Query: 339 GKSPSLDQXXXXXXXXXXXXXXXXXXEDQDACNTSPASASGPITVGASTLSDDRAYFSNY 398
           GKSP+LDQ                  E+QDACN+SPA+A   ITVGASTLSDDRAYFSNY
Sbjct: 382 GKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGASTLSDDRAYFSNY 441

Query: 399 GKCVDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDA-GS 457
           GKCVD+FAPGLNILSTYIG++ +TATLSGTSMASPHVAGLL Y LSLQP   SEF    S
Sbjct: 442 GKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNS 501

Query: 458 SISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYN 491
            ++P Q+KKK++ ++TK+ L+D+P+ TPN LIYN
Sbjct: 502 ELTPLQMKKKIIDYATKNALADLPADTPNKLIYN 535

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  429 bits (1102), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 230/501 (45%), Positives = 310/501 (61%), Gaps = 43/501 (8%)

Query: 1   MKFQKSVIPVATLAGLGSALIIPELTGSNEYEKRPERTDDVNNGESVVATSFEKGPSKDE 60
           MKF  +++P+   A     +IIPE    +E  +  + TDD  N +S+             
Sbjct: 1   MKFS-TILPI-LWASCNLCMIIPEF---DEIVRFTQITDDSRNTKSL------------- 42

Query: 61  LAVFASKLTQEVQDRFAPLVVPEDTLGVLEN---------RYIILFKKGVNPQEIGFHRE 111
                  L Q+    F         +G L+N         RYI++F + ++ + I  HR+
Sbjct: 43  -----KNLRQQYSGGF--------LMGGLDNTHKTELIPYRYIVVFNEDISIKSIESHRK 89

Query: 112 LIEQVHLQEVSQLPEEHSFFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDV 171
           ++++ H   VS+L E+  F E +      D  LGGID +FDING+  GY+GYF  ++L++
Sbjct: 90  MVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLGGIDSSFDINGLFRGYAGYFTDEILNL 149

Query: 172 IRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTS 231
           +   PLI+ +EQ+S V       +  APWGL RISHRE+   G   +YLY++  G GVTS
Sbjct: 150 VSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRISHREKAKYGQDLEYLYEDAAGRGVTS 209

Query: 232 YVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAV 291
           YV+DTG++  H  F GRA WG  IP  D   D NGHGTHCAG IGS  YGVAK   +VAV
Sbjct: 210 YVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAV 269

Query: 292 KVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXX 351
           KVLRSNG G++SDV+KG+E+ A++H  + ++K   FKGSTAN+SLG  KS +++      
Sbjct: 270 KVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAA 329

Query: 352 XXXXXXXXXXXXXEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNI 411
                        E++DAC +SPA A   ITVGAST SDDRA+FSN+G CVDVFAPG+NI
Sbjct: 330 VDSGVHFAIAAGNENEDACLSSPAGAQKSITVGASTFSDDRAFFSNWGTCVDVFAPGINI 389

Query: 412 LSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSE-FDAGSSISPDQLKKKLLA 470
           +STYIGS ++T +LSGTSMA+PHVAG+L+YFLSLQP  DSE FD  +++SP +LK+K+L 
Sbjct: 390 MSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFD--NALSPQELKEKVLK 447

Query: 471 FSTKDVLSDIPSGTPNLLIYN 491
           FST  VL DI   TPN LIYN
Sbjct: 448 FSTHGVLGDIGDNTPNRLIYN 468

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  426 bits (1095), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 205/403 (50%), Positives = 275/403 (68%), Gaps = 1/403 (0%)

Query: 89  LENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFFEGIRLDGVYDSPLGGID 148
           L  RYII+F + +  + I  H ++I++     VS++ E+ SF   +      +   GGID
Sbjct: 69  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGID 128

Query: 149 HTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHR 208
            +FDING+  GY+GYF  +V++++   PL++ +E +S V    +  +  APWGL RISHR
Sbjct: 129 ISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHR 188

Query: 209 ERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHG 268
           ER   G   +YLY++  G+GVTSYV+DTG++  H  F GRAKWG  IP  D   D NGHG
Sbjct: 189 ERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHG 248

Query: 269 THCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFK 328
           THCAG IGS  +GVAK  +I+AVKVLRSNG G++SDV+KG+E+ A++H  + K++   FK
Sbjct: 249 THCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSKKRGSKFK 308

Query: 329 GSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQDACNTSPASASGPITVGASTL 388
           GSTAN+SLG  KSP+++                   ED+DAC +SPA A   ITVGAST 
Sbjct: 309 GSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 368

Query: 389 SDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPG 448
           SDDRA+FSN+G CVDVFAPG+NI+STYIGS ++T +LSGTSMA+PHVAG+L+Y LSLQP 
Sbjct: 369 SDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPA 428

Query: 449 SDSEFDAGSSISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYN 491
            DSEF    ++SP QLK+K+L FST+ VL D+   TPN L+YN
Sbjct: 429 QDSEFFY-DTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYN 470

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  425 bits (1092), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 227/484 (46%), Positives = 308/484 (63%), Gaps = 23/484 (4%)

Query: 8   IPVATLAGLGSALIIPELTGSNEYEKRPERTDDVNNGESVVATSFEKGPSKDELAVFASK 67
           + +A  AG G  +IIP   G +E     E  +D  N +       ++G  + E   F   
Sbjct: 6   VLLALCAGCGVCMIIP---GLDEIVYLTESIEDFRNAKG------QEGLGQQETGNF--- 53

Query: 68  LTQEVQDRFAPLVVPEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEE 127
               +Q+   P VV +     L  RYII F +  + + I  H+ +I++V  + VS+L ++
Sbjct: 54  ---HLQE---PKVVYKAE--SLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKD 105

Query: 128 HSFFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVV 187
            +FF  +      D   GGID  FDING+  GY+GYF  +V+  +   P+I+ +EQ+S V
Sbjct: 106 DAFF--VSTSAPSDLQFGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTV 163

Query: 188 YTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGG 247
               +  +  APWGL RISHRE+   G   +YLY++  G GVTSYV+DTG++++H  F G
Sbjct: 164 KVTNSTFQEEAPWGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEG 223

Query: 248 RAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLK 307
           RA WG  IP  D   D NGHGTHCAG IGS  +GV K  ++VAVKVLRSNG G++SDV+K
Sbjct: 224 RAVWGAVIPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIK 283

Query: 308 GVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQ 367
           G+E+  +DH ++ K+  P FKGSTAN+SLG  KSP+++                   ED+
Sbjct: 284 GIEYVVKDHIDSSKKGGPKFKGSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDE 343

Query: 368 DACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSG 427
           DAC +SPA A   ITVGAST SDDRA+FS++G CVDVFAPG+NILSTYIGS +++ +LSG
Sbjct: 344 DACLSSPAGAEKSITVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSG 403

Query: 428 TSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSDIPSGTPNL 487
           TSMA+PHVAG+L+YFLSLQP SDSEF   S++SP QLK+K++ FST+ VL D+   TPN 
Sbjct: 404 TSMAAPHVAGILSYFLSLQPSSDSEF-FDSTVSPQQLKEKIINFSTQGVLGDVGEDTPNR 462

Query: 488 LIYN 491
           LIYN
Sbjct: 463 LIYN 466

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  421 bits (1082), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 226/491 (46%), Positives = 303/491 (61%), Gaps = 23/491 (4%)

Query: 1   MKFQKSVIPVATLAGLGSALIIPELTGSNEYEKRPERTDDVNNGESVVATSFEKGPSKDE 60
           MKF  +++P+   A     +IIP+  G   + +  + T  V  GE +     + G    E
Sbjct: 1   MKFS-TILPI-LWANCCLCMIIPDFDGIVRFIENIDGTRSVRAGEGL--GQHDPGNFHTE 56

Query: 61  LAVFASKLTQEVQDRFAPLVVPEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQE 120
               A K        F P             RY+I+F + ++ Q+I  H +++++ H   
Sbjct: 57  HQHVAHKT------EFLPY------------RYVIVFNEDISLQQIQSHMQVVQKDHSTS 98

Query: 121 VSQLPEEHSFFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEM 180
           V +L E  +F+  I       S  GGID+ FDING+  GY+GYF  +++ +I   P+I+ 
Sbjct: 99  VGKLTENDAFWRVISSSVSSKSQFGGIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKF 158

Query: 181 VEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNV 240
           VEQ++ V    +  +  APWGL R+SHRE+   G   +YLY++  G GVTSYV+DTG++ 
Sbjct: 159 VEQETTVKISNSSLQEEAPWGLHRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDT 218

Query: 241 HHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSG 300
            H  F GRA+WG  IPA D   D NGHGTHCAG IGS  +GVAK   IVAVKVLRSNG G
Sbjct: 219 EHEDFEGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEG 278

Query: 301 SMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXX 360
           ++SDV+KG+E+  ++H  + K+K   FKGSTAN+SLG  KS +++               
Sbjct: 279 TVSDVIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAI 338

Query: 361 XXXXEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDS 420
               ED+DAC +SPA A   ITVGAST SDDRA+FSN+G CVDVFAPG+NI+STYIGS +
Sbjct: 339 AAGNEDEDACLSSPAGAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN 398

Query: 421 STATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSDI 480
           +T +LSGTSMASPHVAG+L+YFLSLQP  DSEF    + SP +LK+K+L FST+ VL DI
Sbjct: 399 ATLSLSGTSMASPHVAGILSYFLSLQPAPDSEF-FNDAPSPQELKEKVLKFSTQGVLGDI 457

Query: 481 PSGTPNLLIYN 491
              TPN LIYN
Sbjct: 458 GDDTPNKLIYN 468

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  384 bits (986), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 199/405 (49%), Positives = 263/405 (64%), Gaps = 5/405 (1%)

Query: 88  VLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFFEGIRLDGVYDSPLGGI 147
           ++ NRYI+LFK  V  +EI  H   IE+++   +    ++  F +  + + +    +G +
Sbjct: 73  IIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSI--FLQDSDFGKATQYNDISTRGIG-L 129

Query: 148 DHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISH 207
            H F I   + GY GYF       I  SPL+E+VE DS+V       +   PWGL RIS 
Sbjct: 130 QHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQ 189

Query: 208 RERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGH 267
           RE+L +     Y YD++GG    ++VIDTG+ V H  F GRA WGKTI   D D D NGH
Sbjct: 190 REKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGH 249

Query: 268 GTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGF 327
           GTHCAGTI S  YG+AK A+++AVKVLRS+GSGSMSDV++GVE+  + + N +K+ K   
Sbjct: 250 GTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAY-NDLKKTKSNL 308

Query: 328 KGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQDACNTSPASASGPITVGAST 387
           KG+  NMSLG  KS +L++                  E  DACN+SPASA  PITVG ST
Sbjct: 309 KGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWSPITVGGST 368

Query: 388 LSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQP 447
           LSDD A+FSNYG+CVD+FAPG+NI+STYIGS ++T +LSGTSM+SPHVAG+LAY+LSLQP
Sbjct: 369 LSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQP 428

Query: 448 GSDSEF-DAGSSISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYN 491
              S+F    S+ISP  LKKK+L ++T   LS +P+ T NLL+YN
Sbjct: 429 DHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYN 473

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  355 bits (912), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 182/404 (45%), Positives = 257/404 (63%), Gaps = 19/404 (4%)

Query: 88  VLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFFEGIRLDGVYDSPLGGI 147
           +++++YI++FK      E        +++H +++    + +S+    + D  + S L   
Sbjct: 59  IIKDQYIVIFKNSAMMAE--------KELHFKQLKNFIKTYSYEWDEKDD--HKSNL--- 105

Query: 148 DHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISH 207
            + F I   L GY    P + L ++R  P+++++E DS V+  K   +   PWGL+RIS 
Sbjct: 106 -NIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQ 164

Query: 208 RERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGH 267
           R R+ +G    Y YD+     VT+YV+DTG+ + H QF GRA+WGKTI   D+DED +GH
Sbjct: 165 RPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGH 224

Query: 268 GTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGF 327
           GTH AG I S  +GVAK  ++VAVKVLRSNG G MSDVLKG+E+   DH     + K   
Sbjct: 225 GTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHS----KNKNYS 280

Query: 328 KGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQDACNTSPASASGPITVGAST 387
           KGS  N+SLG  KSP+L                    E+ DAC TSPA A   ITVGAS 
Sbjct: 281 KGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASI 340

Query: 388 LSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQP 447
            SD+RA+FSN+G+CVDVFAPG+N++STYIGSD++T +LSGTS A+P+ AGL+AY+LSLQP
Sbjct: 341 FSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAYYLSLQP 400

Query: 448 GSDSEFDAGSSISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYN 491
             DS +  G  ++P +LK+K++AF +KDVL ++P  TPN++IYN
Sbjct: 401 DKDSGYFTG-EMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYN 443

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  344 bits (883), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 186/408 (45%), Positives = 251/408 (61%), Gaps = 26/408 (6%)

Query: 89  LENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFFEGIRLDGVYDSPLGGID 148
           + N+YI+LFK               +   +Q  + L   +S+        +   P   I 
Sbjct: 53  IPNQYIVLFKS--------------DTTDIQRETHLATLNSWL-------LNTDPQYTIL 91

Query: 149 HTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHR 208
           H+F +   L GY+   P +++  +   P+I+ +EQDS V+      +  +PWGLARIS R
Sbjct: 92  HSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQR 151

Query: 209 ERLNLGSYNKYLYDEQGGSGVT-SYVIDTGVNVHHNQFGGRAKWGKTI-PAGDLDEDGNG 266
           ERL L     Y YD+ G S  T  Y++DTG+N +HN+F GRAKWG    P     ED NG
Sbjct: 152 ERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENG 211

Query: 267 HGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDH-QNAVKQKKP 325
           HGTHCAG IGS  YGVAK   ++AVKVL + G G MS V++G+E+  Q H Q+  KQ + 
Sbjct: 212 HGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQT 271

Query: 326 GFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQDACNTSPASASGPITVGA 385
           GFKGS  N+SLG GKSP+L +                  ED DAC+TSPA +   +TVGA
Sbjct: 272 GFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGA 331

Query: 386 STLSDDRAYFSNYGKCVDVFAPGLNILSTYIG-SDSSTATLSGTSMASPHVAGLLAYFLS 444
           S+ SDDR +FSN+G CVDVFAPG+NI+STYIG  ++ T +LSGTSM++P V GL+AYFLS
Sbjct: 332 SSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLS 391

Query: 445 LQPGSDSEFDAG-SSISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYN 491
           LQP + S+F  G +S +P QLK K+++FST+ VL +IP GTPN ++YN
Sbjct: 392 LQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYN 439

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  315 bits (808), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 158/352 (44%), Positives = 227/352 (64%), Gaps = 8/352 (2%)

Query: 143 PLGGIDHTFDINGMLMGYS-GYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWG 201
           PL   +  F I   L+G++   FP   +  +   P +EMVE +S VY      +   PWG
Sbjct: 70  PLAQFEQ-FHIADELIGFTVKNFPFHNVYFLLQIPFVEMVETNSKVYALNVTVQEDVPWG 128

Query: 202 LARISHRERLNLGSYNKYLYDEQGGSG-VTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDL 260
           L R+S R+R+ +G    Y YD +G +  V  Y++DTG+ V H +F GRA+WGKTI   D 
Sbjct: 129 LMRLSQRDRVRIGDEQVYRYDTRGSAKDVNVYILDTGIQVDHEEFEGRARWGKTIAWNDP 188

Query: 261 DEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAV 320
           D D NGHGTHCAG +G +TYGVAK A+++AVKVL + G G MSDV++G+E+A  +H   +
Sbjct: 189 DRDDNGHGTHCAGIVGGATYGVAKEANLIAVKVLHATGDGEMSDVIRGIEFAVNEH---L 245

Query: 321 KQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQDACNTSPASASGP 380
            + +   +GS  N+SLG G+SP+L +                  ED +AC +SPA+  G 
Sbjct: 246 TRNQDEVRGSIINLSLGAGESPALQRVVTAALNKGVHFAVAAGNEDDNACYSSPANIDGV 305

Query: 381 ITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIG-SDSSTATLSGTSMASPHVAGLL 439
           +TVG ST SDDRA+FSN+G C+DVFAPG+N+ S+Y+G + + T +LSGTS ++PHVAGL+
Sbjct: 306 VTVGGSTFSDDRAFFSNWGPCIDVFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLM 365

Query: 440 AYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYN 491
           AY LSL+P + S+F    S +P QLK+KL++ +T+  L ++P  T NL+I+N
Sbjct: 366 AYLLSLEPDTKSQFHTAWS-NPAQLKQKLVSLATEGKLFEVPDDTANLMIFN 416

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  299 bits (765), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 179/427 (41%), Positives = 248/427 (58%), Gaps = 24/427 (5%)

Query: 78  PLVVPED--TLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFFEGIR 135
           P ++P        + ++YI+LF+      +I    + +        S L EE +  +   
Sbjct: 50  PFIIPTHGPQKNFIPDQYIVLFENDTTDLQISRFEQFL--------SSLIEEDN--QKYN 99

Query: 136 LDGVYDSPLGGIDHTFDINGMLMG--YSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKAD 193
           ++  Y   L     + D  GM++      +      ++     +I+++E+DS V+  K  
Sbjct: 100 VNDNYSKVLSRFQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFT 159

Query: 194 TENGAPWGLARISHRERLNLGSYNKYLYDEQG-GSGVTSYVIDTGVNVHHNQFGGRAKWG 252
           T+  + WGL+RIS R  L L     Y YD+ G G GV  Y++DTG+N +H +F GRA WG
Sbjct: 160 TQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWG 219

Query: 253 KTIPAGDLD-EDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEW 311
            ++P  +   ED NGHGTHCAG IGS TYGVAK  +++AVKVL   G GSMSDV+ G+E+
Sbjct: 220 VSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEF 279

Query: 312 AAQDHQNAVKQ------KKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXE 365
            A  H N              FKGS  N+SLG  KSPSLD                   E
Sbjct: 280 VANSHTNKTNNISSSSSVHSEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNE 339

Query: 366 DQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIG-SDSSTAT 424
           D+DAC TSPA +   ITVGAS+ SDDRA+FSN+G CVDVFAPG+NI STYIG +++ T +
Sbjct: 340 DEDACMTSPADSPAVITVGASSFSDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLS 399

Query: 425 LSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSDIPSGT 484
           LSG+SM+SP V+GL AY+LSLQP   S+F   S ++PDQLK+K++ FST  +L ++P  T
Sbjct: 400 LSGSSMSSPFVSGLTAYYLSLQPDVSSQF-HDSLMTPDQLKRKIIDFSTNGMLKELPLDT 458

Query: 485 PNLLIYN 491
            N L+YN
Sbjct: 459 ANKLVYN 465

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  256 bits (653), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 146/424 (34%), Positives = 233/424 (54%), Gaps = 13/424 (3%)

Query: 77  APLVVP-----EDTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFF 131
           APLV P     E    ++  RYI++FK      EI  H + + ++ L+    L     FF
Sbjct: 52  APLVAPLGENDEIQNNIVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFF 111

Query: 132 EGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQK 191
              R        LGG+ +TFDI     GY GYF  +V++ IR   +++ VE DS++    
Sbjct: 112 HHTRDKEFSTEELGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILTIDD 171

Query: 192 ADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKW 251
            +T++ + W LARISHR +L L ++N+Y +D  GG  + +Y++DTGV   H  +  R   
Sbjct: 172 KETDSNSHWHLARISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIERTIR 231

Query: 252 GKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEW 311
           G  I   + + D NGHGT  AG +G    GVA+ A ++ VKVL   G G++S+++KG+ +
Sbjct: 232 GIVITPNEDERDMNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSF 291

Query: 312 AAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQDACN 371
              +H +  + +K G  G+    S+ G KS SL+                   +  +ACN
Sbjct: 292 V--NHHHPQRIEKNGVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACN 349

Query: 372 TSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTAT----LSG 427
           +SPAS+S PITV   +++D+     N+G CVD++ PG  + +TY   + +  T    ++G
Sbjct: 350 SSPASSSKPITVAGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTG 409

Query: 428 TSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSDIPSGTPNL 487
           +S A+  VAGLLAYF SLQPG  +  D    ++P++LK++L+ F TK  L+++   +PN+
Sbjct: 410 SSAAAAQVAGLLAYFASLQPGLGTP-DV-IPLTPEELKERLIDFGTKGKLTNLERMSPNI 467

Query: 488 LIYN 491
           + +N
Sbjct: 468 IAFN 471

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  180 bits (456), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 131/389 (33%), Positives = 186/389 (47%), Gaps = 48/389 (12%)

Query: 131 FEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLI-EMVEQDSVVYT 189
           F+  RL  +       +  TF   G     S   P  ++D IR SPL+ E+V     V  
Sbjct: 38  FKSARLQSIKSFFDCKVRRTFSF-GSFRALSIDVPRDLVDRIRRSPLVAEVVPNIQFVAY 96

Query: 190 QKADTE------------NGAPWGLARISHRERLNL----------GSYNKYLYDEQGGS 227
            + D E             GAP  L+R+S R +L            GS+N Y  ++  G 
Sbjct: 97  DEHDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQLPYDFEEEDDNYEGSFNYYYDNKHRGD 156

Query: 228 GVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGAD 287
           G+ +Y+IDTG+   H +FGGRA +G+ +  G+   DGNGHGTH AG +GSS YGVAK   
Sbjct: 157 GINAYIIDTGIYKEHAEFGGRAVFGEDL-TGEGPGDGNGHGTHVAGIVGSSKYGVAKDIT 215

Query: 288 IVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQX 347
           +V VK L + G G+++ V+  +E+A    +++        KG   N+SLG  ++  ++Q 
Sbjct: 216 LVEVKALTAKGQGNLTTVISAMEFAVNHCRSSEG------KGCVINLSLGAIRNSVINQA 269

Query: 348 XXXXXXXXXXXXXXXXXEDQDACNTSPASASGPITVGA-STLSDDRAYFSNYGKCVDVFA 406
                             + +AC  SPASA   ITVGA    +D  A FSN+G CVD+FA
Sbjct: 270 VKAAHEAGIVVVVAAGNSNINACLNSPASAPEAITVGAFDDRTDSIAKFSNWGSCVDIFA 329

Query: 407 PGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKK 466
           PG+ + S            SGTSMASP + GL A  L          D G  +  D++K 
Sbjct: 330 PGVRVKSLASAPHLKPILFSGTSMASPSITGLAAILL----------DEG--VPYDKIKD 377

Query: 467 KLLAFSTKDVLSD----IPSGTPNLLIYN 491
            +L  +T DV          GTPN + +N
Sbjct: 378 YILKMATNDVFQRRTLVFKPGTPNRVAFN 406

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  177 bits (450), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 136/376 (36%), Positives = 183/376 (48%), Gaps = 52/376 (13%)

Query: 145 GGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMV---------EQDSV---VYTQKA 192
           G I+  F I G L G +      VLD I+  P ++ V         E D+V    +  K 
Sbjct: 50  GKINKRFQI-GELKGLTMNLSHDVLDKIKRHPFVKEVVPNIMVKAFEGDAVEDESWLPKM 108

Query: 193 DTENGAPWGLARISHRERLNLGSYNK--------YLYDEQG-GSGVTSYVIDTGVNVHHN 243
             + GAP  LARIS R +L     NK        Y YD    G+   +Y++DTGV   H 
Sbjct: 109 KRQRGAPRHLARISRRMQLPYDMNNKTRYRDSFNYYYDRWAQGATTRAYILDTGVMRDHK 168

Query: 244 QFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMS 303
           +F  R ++G T   G+ + D NGHGTH AG +GS T+GVAK   +V VK L + G+G++ 
Sbjct: 169 EFEDRVEFG-TDCTGEGEGDLNGHGTHVAGLVGSKTFGVAKHVQLVDVKCLDALGAGTLV 227

Query: 304 DVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXX 363
            +L  +E+A QD Q     +         NMSLG  KS  L+Q                 
Sbjct: 228 SILSALEFAVQDCQEHEDSQ------CVLNMSLGSVKSNILNQAINEVEKKGIVVVVAAG 281

Query: 364 XEDQDACNTSPASASGPITVGASTLSDDR----AYFSNYGKCVDVFAPGLNILSTYIGSD 419
             + +AC TSP+SA+G ITVGA    DDR    A FSN+G CVD+FAPG+N+ S      
Sbjct: 282 NFNMNACWTSPSSATGAITVGA---FDDRFDTIAKFSNWGPCVDIFAPGVNVASLVNRDW 338

Query: 420 SSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSD 479
            S    SGTSMASP V G++A  L          D G  + P+ ++  L   +T  V   
Sbjct: 339 PSFVKYSGTSMASPIVCGMVALLL----------DDG--VPPEDIRDYLQELATDGVFKK 386

Query: 480 ----IPSGTPNLLIYN 491
                  GTPN ++YN
Sbjct: 387 RTLVFKPGTPNSVLYN 402

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  177 bits (450), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 127/318 (39%), Positives = 166/318 (52%), Gaps = 38/318 (11%)

Query: 193 DTENGAPWGLARISHRERLNLGSYNK--------YLYDEQ-GGSGVTSYVIDTGVNVHHN 243
           + + GAP  L RIS R +L     N+        Y Y++Q  GS + +Y++DTG+   H 
Sbjct: 152 NVQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHP 211

Query: 244 QFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMS 303
            F  R   G  +  G+   D NGHGTH AG +GS T+GVAK   +V VKVL   GSG+++
Sbjct: 212 DFENRVIVGADM-TGEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLT 270

Query: 304 DVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXX 363
            VL G+++A  DH   +++ +   K   ANMSLG  ++  ++                  
Sbjct: 271 TVLSGIQFAV-DHCRLMRETQG--KQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAG 327

Query: 364 XEDQDACNTSPASASGPITVGASTLSDDR----AYFSNYGKCVDVFAPGLNI--LSTYIG 417
             +  AC TSPASA   ITVGA    DDR    AYFSN+G CVD+FAPG+ I  LS    
Sbjct: 328 NSNVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPE 384

Query: 418 SDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVL 477
           S     T SGTSMASP VAGL A  L          D G  + P  +K KLL  STKDV 
Sbjct: 385 SHHKHVTHSGTSMASPVVAGLAAILL----------DKG--VEPFDVKDKLLHLSTKDVF 432

Query: 478 SDI----PSGTPNLLIYN 491
           + +      GTPN + YN
Sbjct: 433 NKLTLFFKYGTPNKIAYN 450

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  175 bits (444), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 119/327 (36%), Positives = 171/327 (52%), Gaps = 47/327 (14%)

Query: 186 VVYTQKADTENGAPWGLARISHRERL-----NLGSYNK---YLYDEQ-GGSGVTSYVIDT 236
           + Y+ K   +  AP  L+R+S R +L     N+  Y+    Y +D +  GS V +Y+IDT
Sbjct: 106 LTYSDKIIIQREAPRHLSRLSRRGQLPYDINNIDRYDNAFDYYFDAKYQGSSVNAYIIDT 165

Query: 237 GVNVHHNQFGGRAKWGKTIPAGDLDEDG----NGHGTHCAGTIGSSTYGVAKGADIVAVK 292
           G+   H +F GR K+     A DL ++G    NGHGTH AG +GS T+GVAK  +I+ VK
Sbjct: 166 GIYKEHPEFEGRVKF-----AIDLTQEGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVK 220

Query: 293 VLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXX 352
            L   G G +S +LK +E+  +  + +V +K        AN+S G  ++  +D+      
Sbjct: 221 ALDKKGQGQLSTILKALEFTIRHCKESVDKK------CVANLSFGAIRTAIIDEAIKEAH 274

Query: 353 XXXXXXXXXXXXEDQDACNTSPASASGPITVGASTLSDDR----AYFSNYGKCVDVFAPG 408
                        + DAC  SPAS+   ITVGA    DDR    A FSN+G CVDVFAPG
Sbjct: 275 NAGIVLVVAAGNSNIDACWNSPASSKDVITVGA---FDDRTETIARFSNWGSCVDVFAPG 331

Query: 409 LNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKL 468
           + + S    + S    LSGTSMASP V+G+ A  L          D G  ++P  +K K+
Sbjct: 332 VKVKSLSHINGSDVLLLSGTSMASPSVSGIAAILL----------DKG--LNPKFVKSKI 379

Query: 469 LAFSTKDVLSD----IPSGTPNLLIYN 491
           +  STK++       I   TPNL+++N
Sbjct: 380 IESSTKNIFHQGTIMIKPNTPNLIVFN 406

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  176 bits (446), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 120/316 (37%), Positives = 167/316 (52%), Gaps = 46/316 (14%)

Query: 197 GAPWGLARISHRERLNLGSYNK--------YLYDEQG-GSGVTSYVIDTGVNVHHNQFGG 247
           GAP  LAR+S R++L     +K        Y YD++  G+ V +Y+ID+G+ + H +F G
Sbjct: 131 GAPRHLARLSRRKQLPYDFEDKEAYLDSLKYFYDKRSQGASVNAYIIDSGIYLEHEEFNG 190

Query: 248 RAKWGKTIPAGDLDEDG----NGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMS 303
           RA     IP  DL  +G    NGHGTH AG +GS +YGVAK   ++ +KVL   G GS++
Sbjct: 191 RA-----IPGIDLTGEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNRLGQGSLA 245

Query: 304 DVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXX 363
            VL G+E+A +  Q   K+ +       AN+SLG  ++  L++                 
Sbjct: 246 MVLGGIEFAVKHCQETSKKGR-----CVANLSLGSMRTAILNKAIKAAIDAGLVVVVAAG 300

Query: 364 XEDQDACNTSPASASGPITVGASTLSDDR----AYFSNYGKCVDVFAPGLNILSTYIGSD 419
             + +AC  SPASA   ITVGA    DDR    A FSN+G+C+D+FAPG+ I S  I  D
Sbjct: 301 NNNLNACWYSPASAPEAITVGA---FDDRIDAIAKFSNWGQCLDIFAPGVVIKSLSIFKD 357

Query: 420 SSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSD 479
               T SGTSMASP VAGL A  L+L  G          +S +++K  +L   T +V   
Sbjct: 358 KEDVTYSGTSMASPTVAGLAA--LTLDQG----------VSAEEVKDYILEMGTDNVFHR 405

Query: 480 ----IPSGTPNLLIYN 491
                  GTPN + +N
Sbjct: 406 RSLLFKPGTPNKICFN 421

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  175 bits (443), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 126/369 (34%), Positives = 180/369 (48%), Gaps = 45/369 (12%)

Query: 147 IDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVV------------YTQKADT 194
           I  TF   G   G++  FP   ++ ++ +PL+  V  +SV             Y+++   
Sbjct: 52  ISKTFSF-GKFEGFTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKV 110

Query: 195 ENGAPWGLARISHRERLNL----GSYNK--YLYDEQ-GGSGVTSYVIDTGVNVHHNQFGG 247
           +  AP  LAR+S R  L      G Y +  Y YD +  G  V +Y+IDTG+   H   GG
Sbjct: 111 QEDAPRHLARLSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGG 170

Query: 248 RAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLK 307
           RA +G  +  G+   D NGHGTH AG +GS T+GVAK  ++V VK L + G G+++ V+ 
Sbjct: 171 RAYFGADM-VGEGPGDYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVIS 229

Query: 308 GVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQ 367
            +E++          KK G     AN+SLG  ++  L+Q                   + 
Sbjct: 230 SIEFSVN------HCKKSGML-CVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNV 282

Query: 368 DACNTSPASASGPITVGA-STLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLS 426
           +AC  SPASA   ITVGA    +D  A FSN+G CVDVFA G+ ++S            S
Sbjct: 283 NACWNSPASAISAITVGAFDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVAYS 342

Query: 427 GTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSD----IPS 482
           GTSMASP VAGL A  L             S I P  +K+K++  +T++V          
Sbjct: 343 GTSMASPSVAGLAAVLLD------------SGIDPPDIKQKIIDLATENVFQKRTLVFKP 390

Query: 483 GTPNLLIYN 491
           GTPN + +N
Sbjct: 391 GTPNRIAFN 399

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  173 bits (439), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 130/386 (33%), Positives = 179/386 (46%), Gaps = 61/386 (15%)

Query: 147 IDHTFDINGMLMGYSGYFPSKVLDVIRMSPL-------IEMVEQDSVVYTQKA------- 192
           I HTF   G   G +      V++ IR +PL       I+    D V+  Q+        
Sbjct: 52  ISHTFSF-GSFRGITVDISQDVVEKIRNNPLVADLVPNIQFKAFDDVLGVQELQQNYHGD 110

Query: 193 --DTENG-----------APWGLARISHRERLNLG---------SYNKYLYDEQGGSGVT 230
             D E+G           AP  LAR+S R  L            S+N Y Y    G  + 
Sbjct: 111 NLDDEDGFNPFKVKVQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNIN 170

Query: 231 SYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVA 290
           +Y+IDTG+   H  F GRA +G+    G+   D NGHGTH AG +GSS +GVAK  +++ 
Sbjct: 171 AYIIDTGIYKEHKDFCGRAIFGRDF-TGEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIE 229

Query: 291 VKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXX 350
           VK L + G G+++ V+  VE+A          K  G KG  AN+SLG  ++  ++Q    
Sbjct: 230 VKALNNRGQGNLTTVISAVEFAVN------HCKSSGKKGCVANLSLGAVRNSVINQAIKA 283

Query: 351 XXXXXXXXXXXXXXEDQDACNTSPASASGPITVGA-STLSDDRAYFSNYGKCVDVFAPGL 409
                          + +AC  SPASA   ITVGA    +D  A FSN+G CVD+FA G+
Sbjct: 284 AHEAGLIIVVAAGNSNINACWNSPASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFASGV 343

Query: 410 NILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLL 469
            + S            SGTSMASP V GL+A  L          D G  + P+ +K KL+
Sbjct: 344 KVKSLSAFPPHKPIAFSGTSMASPSVTGLVAILL----------DKG--VEPENIKAKLV 391

Query: 470 AFSTKDVLSD----IPSGTPNLLIYN 491
             +T D+L         GTPN + +N
Sbjct: 392 ELATHDLLQRRTLFFKPGTPNRIAFN 417

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  171 bits (432), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 119/318 (37%), Positives = 163/318 (51%), Gaps = 38/318 (11%)

Query: 192 ADTENGAPWGLARISHRERL--------NLGSYNKYLYDE--QGGSGVTSYVIDTGVNVH 241
            D + GAP  L ++S R +L            +  Y YD   QG + V  Y+IDTGV   
Sbjct: 147 VDIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVV-YIIDTGVYKE 205

Query: 242 HNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGS 301
           H +FG R  +G     G+   D NGHGTH AG IGS T+GVAK   +  VKVL   G G+
Sbjct: 206 HKEFGNRVHFGGDF-IGEGKGDYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGN 264

Query: 302 MSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXX 361
           ++ VL+G+E+A     N   +++P  K    NMSLG  ++P +++               
Sbjct: 265 LTSVLEGIEFAV---NNCKLKQQPMGKNCVINMSLGTIRNPIINEAIKEAFLSGITPVVA 321

Query: 362 XXXEDQDACNTSPASASGPITVGASTLSDDR----AYFSNYGKCVDVFAPGLNILSTYIG 417
               +  AC TSPAS++  ITVGA    DDR    A FSN+G+CVD+FAPG+ I S    
Sbjct: 322 AGNNNFSACWTSPASSNFAITVGA---MDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNR 378

Query: 418 SDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVL 477
              +    SGTSMASP VAGL+A  +                  D++K+KL+  S+K + 
Sbjct: 379 MLENGVIHSGTSMASPIVAGLVAILME------------KGYKCDEIKQKLIDDSSKSIF 426

Query: 478 SDI----PSGTPNLLIYN 491
           S +      GTPN +IYN
Sbjct: 427 SKLTLFFKYGTPNRVIYN 444

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  165 bits (417), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 116/315 (36%), Positives = 158/315 (50%), Gaps = 39/315 (12%)

Query: 194 TENGAPWGLARISHRERL-----NLGSYN---KYLYDE-QGGSGVTSYVIDTGVNVHHNQ 244
            +NGAP  LAR+S R  L     +  +YN    Y Y +   G+ V +Y+ID+G++++  +
Sbjct: 128 VQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDVNAYIIDSGIDINQEE 187

Query: 245 FGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSD 304
           F GRA  G  +  G+   D NGHGTH AG +GS TYGVAK   +V VK L   GSGS+  
Sbjct: 188 FEGRATHGLDL-TGEGPGDRNGHGTHVAGLVGSKTYGVAKNVTLVEVKALDRQGSGSLIT 246

Query: 305 VLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXX 364
           V+  +E+   +H    K KK       AN+SLG    P L++                  
Sbjct: 247 VISALEFVV-NHCGKSKSKK-----CVANLSLGAFMMPLLNEAIKATVDSGVVVVVAAGN 300

Query: 365 EDQDACNTSPASASGPITVGASTLSDDR----AYFSNYGKCVDVFAPGLNILSTYIGSDS 420
            + DAC  SPAS    ITVGA    DDR    A FSN+G CVD+FAPG+ I S  I  + 
Sbjct: 301 GNIDACWCSPASEKSAITVGA---FDDRIDTIAKFSNWGSCVDIFAPGVAISSLSIKDNQ 357

Query: 421 STATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSD- 479
            +   SGTSMASP VAG+++  L          D G  +  + ++  L   +T DV    
Sbjct: 358 KSVEFSGTSMASPQVAGIVSILL----------DQG--VENEDIRDYLFELATDDVFQKR 405

Query: 480 ---IPSGTPNLLIYN 491
                  TPN + +N
Sbjct: 406 TLLFKPRTPNRITFN 420

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  163 bits (413), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 126/369 (34%), Positives = 182/369 (49%), Gaps = 55/369 (14%)

Query: 155 GMLMGYSGYFPSKVLDVIRMSPLI---------EMVEQDSVVYTQKAD-----TENGAPW 200
           G+ M  +     K+++ ++ +PL+         +  E D +   Q  +      ++ AP 
Sbjct: 65  GITMNIAHNKKQKIMEKLKQNPLVADIVPNILFKAFENDELNNEQTQEYVSHVVQSEAPR 124

Query: 201 GLARISHRERL-----NLGSYNK---YLY-DEQGGSGVTSYVIDTGVNVHHNQFGGRAKW 251
            LARIS R++L     N+ SY K   Y Y  E  G+ V +Y++D+GV+ +   F GR ++
Sbjct: 125 HLARISRRDKLPYDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTDFEGRVEF 184

Query: 252 GKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEW 311
           G     GD + D NGHGTH AG +GS TYGVAKG  +V VK L   G G++  VL  +E+
Sbjct: 185 GFDF-TGDGEGDSNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLITVLSAIEF 243

Query: 312 AAQD-HQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQDAC 370
           A  D H++  K+         AN+SLG  K+  +++                   + +AC
Sbjct: 244 AVNDCHEHPEKR-------CVANLSLGSFKNAIINKAIQAATEDGVVMVVAAGNFNINAC 296

Query: 371 NTSPASASGPITVGASTLSDDR----AYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLS 426
            TSPASA   ITVGA    DDR    A FSN+G CVD++APG+ + S          + S
Sbjct: 297 WTSPASAEEAITVGA---FDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPMVKNISYS 353

Query: 427 GTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSD----IPS 482
           GTSMASP V G +A  L          D G  I  D +K  L+  +T DV          
Sbjct: 354 GTSMASPIVCGQVAILL----------DKG--IPNDDIKSTLIKMATDDVFQKRTLLFKP 401

Query: 483 GTPNLLIYN 491
            TPN +++N
Sbjct: 402 NTPNRVLFN 410

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  163 bits (412), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 113/320 (35%), Positives = 158/320 (49%), Gaps = 38/320 (11%)

Query: 190 QKADTENGAPWGLARISHRERLNL---------GSYNKYLYDEQGGSGVTSYVIDTGVNV 240
           Q    +  AP  LARIS   +L             +N Y  DE  G GV +Y++DTG++ 
Sbjct: 156 QNVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAYIMDTGIHA 215

Query: 241 HHNQFGGRAKWGKTIPAGDLDEDG----NGHGTHCAGTIGSSTYGVAKGADIVAVKVLRS 296
            H +F  R      I   DL ++G    NGHGTH AG +GS T+G AK   +V VKVL  
Sbjct: 216 EHPEFEDR-----VIQGVDLTKEGFGDENGHGTHVAGLVGSRTFGAAKKVSLVEVKVLGK 270

Query: 297 NGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXX 356
           +GSG  S+VL G+E+     ++  K  +P  K   AN+SLG  +SP ++           
Sbjct: 271 DGSGEASNVLSGLEFIV---EHCTKVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGI 327

Query: 357 XXXXXXXXEDQDACNTSPASASGPITVGA-STLSDDRAYFSNYGKCVDVFAPGLNILSTY 415
                    + DA   SPASA   ITVGA     D  A FSN+G CV++FAPG+ I S  
Sbjct: 328 VFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLS 387

Query: 416 IGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKD 475
             +D+ +  LSGTSM++P V G+ A  LS              I P+ + +++   ST++
Sbjct: 388 HLNDNESLVLSGTSMSTPIVTGVAAVLLS------------KGIEPELIAQEIEYLSTRN 435

Query: 476 VLSD----IPSGTPNLLIYN 491
           V           TPN ++YN
Sbjct: 436 VFHRRTLFFKPSTPNQILYN 455

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  163 bits (412), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 117/353 (33%), Positives = 167/353 (47%), Gaps = 60/353 (16%)

Query: 179 EMVEQDSVVYTQKADTENGAPWGLARISHRERLNL---------GSYNKYLYDEQGGSGV 229
           +M + +  + ++   T++ AP  LAR+S R +L             +N Y Y    G  V
Sbjct: 144 DMPQVNGKLLSRYIKTQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSV 203

Query: 230 TSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIV 289
            +YV+D+GV + H  F GRA +G          D NGHGTH AG IGS TYGV+K  +I+
Sbjct: 204 NAYVLDSGVMIDHCDFEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNII 263

Query: 290 AVKVLRSNGSGSMSDVLKGVE----------------------WAAQD-HQNAVKQKKPG 326
            VKVL S GSG++  V+ G+E                      W ++D H + V+ K+  
Sbjct: 264 DVKVLDSVGSGTLDTVMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKR-- 321

Query: 327 FKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQDACNTSPASASGPITVGAS 386
                 N+SLG  +S  +++                   + +AC TSPAS +  ITVGA 
Sbjct: 322 ---CVINLSLGTFRSTIINEAIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA- 377

Query: 387 TLSDDR----AYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYF 442
              DDR    A FSN+G CVD+FAPG+ + S            +GTSMA+P V GL+A  
Sbjct: 378 --FDDRIDSIAKFSNWGNCVDIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALL 435

Query: 443 LSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSD----IPSGTPNLLIYN 491
           L             S I P Q+KK+L   +T ++          GTPN + +N
Sbjct: 436 LD------------SGIKPTQIKKRLNELATDNIFPRRTLLFKPGTPNRIAFN 476

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  162 bits (409), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 114/313 (36%), Positives = 156/313 (49%), Gaps = 40/313 (12%)

Query: 195 ENGAPWGLARISHRERLNLGSYN--------KYLYDEQ-GGSGVTSYVIDTGVNVHHNQF 245
           +  AP  LARIS R  L     N         Y YD+   G+ V +YVIDTG+   H QF
Sbjct: 133 QKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKEHRQF 192

Query: 246 GGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDV 305
            GRAK+G  +  G+   D NGHGTH AG IGS  YGVAK   ++ VK L + G G+++ V
Sbjct: 193 QGRAKFGADL-VGEGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGNLTSV 251

Query: 306 LKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXE 365
           +  +E+      N  ++ K   +G  AN+SLG  ++  L+Q                   
Sbjct: 252 ISAIEFTV----NHCRKSK---RGCVANLSLGSFRNSVLNQAVEAALEAGVVVVVAAGNS 304

Query: 366 DQDACNTSPASASGPITVGASTLSDDR----AYFSNYGKCVDVFAPGLNILSTYIGSDSS 421
           + +AC +SPAS+   I+VGA    DDR    A FSN+G CVD+FAPG+ I S        
Sbjct: 305 NANACWSSPASSLSAISVGA---FDDRTDTIARFSNWGNCVDLFAPGVKIASLSNIPPFK 361

Query: 422 TATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSD-- 479
           +   SGTSMASP V G++A  L             S I P  +K++L+  +T  V     
Sbjct: 362 SVAYSGTSMASPLVTGMVAVLLD------------SGIHPFDIKEELINTATDSVFHKRA 409

Query: 480 --IPSGTPNLLIY 490
                GTPN + +
Sbjct: 410 LLFKPGTPNRVAF 422

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  161 bits (407), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 112/313 (35%), Positives = 155/313 (49%), Gaps = 40/313 (12%)

Query: 195 ENGAPWGLARISHRERL-----NLG----SYNKYLYDEQGGSGVTSYVIDTGVNVHHNQF 245
           +  AP  LARIS R  L     N+     +++ Y  DE  G+ V +YVIDTG+   H Q 
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 246 GGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDV 305
            GRAK+G  +  G+   D NGHGTH AG IGS  +GVAK   ++ VK L + G G+++ V
Sbjct: 195 EGRAKFGADL-VGEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 306 LKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXE 365
           +  +E+        V   +   +G  AN+SLG  ++  L+Q                   
Sbjct: 254 ISAIEF-------TVNHCRKSRRGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNS 306

Query: 366 DQDACNTSPASASGPITVGASTLSDDR----AYFSNYGKCVDVFAPGLNILSTYIGSDSS 421
           + +AC +SPAS+   ITVGA    DDR    A FSN+G CVD+FAPG+ I S        
Sbjct: 307 NANACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFK 363

Query: 422 TATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSD-- 479
               SGTSMASP V+G++A  L             S I P  +K +L+  +T  V     
Sbjct: 364 PVAFSGTSMASPIVSGMVANLLD------------SGIHPFDIKTELIDLATDSVFHKRT 411

Query: 480 --IPSGTPNLLIY 490
                GTPN + +
Sbjct: 412 LLFKPGTPNRVAF 424

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  158 bits (399), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 112/320 (35%), Positives = 157/320 (49%), Gaps = 38/320 (11%)

Query: 190 QKADTENGAPWGLARISHRERLNL---------GSYNKYLYDEQGGSGVTSYVIDTGVNV 240
           Q    ++ AP  LARIS   +L             +N Y  D+  G  V +Y++DTG+  
Sbjct: 120 QNITYQSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFA 179

Query: 241 HHNQFGGRAKWGKTIPAGDLDEDG----NGHGTHCAGTIGSSTYGVAKGADIVAVKVLRS 296
            H +F  R      I   DL ++G    NGHGTH AG +GS TYG AK  ++V VKVL  
Sbjct: 180 DHPEFEDR-----VIQGIDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGK 234

Query: 297 NGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXX 356
           +GSG  S+VL G+E+     ++  +  +P  K   AN+SLG  +SP ++           
Sbjct: 235 DGSGEASNVLSGLEFIV---EHCTRVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGI 291

Query: 357 XXXXXXXXEDQDACNTSPASASGPITVGA-STLSDDRAYFSNYGKCVDVFAPGLNILSTY 415
                    + DA   SPASA   ITVGA     D  A FSN+G CV++FAPG+ I S  
Sbjct: 292 VFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLS 351

Query: 416 IGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKD 475
             + + T  LSGTSM++P V G+ A  LS              I P+ + ++L   ST++
Sbjct: 352 HLNFNDTLVLSGTSMSTPIVTGVAAVLLS------------KGIEPEMIAQELEYLSTRN 399

Query: 476 VLSD----IPSGTPNLLIYN 491
           V           TPN ++YN
Sbjct: 400 VFHRRTLFFKPSTPNQILYN 419

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  159 bits (401), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 117/311 (37%), Positives = 159/311 (51%), Gaps = 43/311 (13%)

Query: 198 APWGLARISHRERLNLG-------SYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAK 250
           AP  LAR   R  L          ++N Y  +E  G GV  YV+D+G+   H +F GRA 
Sbjct: 431 APRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHPEFDGRAH 490

Query: 251 WG----KTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVL 306
           +G    K  P GDL    NGHGTH AG +GS T+G+AK A+I  +KV+  +G GS S+++
Sbjct: 491 FGIDTTKEGP-GDL----NGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTSNII 545

Query: 307 KGVEWAAQDHQNAVKQKKPGFKGSTANMSLGG---GKSPSLDQXXXXXXXXXXXXXXXXX 363
            GVE+A +  Q + K+         ANMSLGG   G S +LD                  
Sbjct: 546 AGVEFAVKHCQQSGKR-------CVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAG 597

Query: 364 XEDQDACNTSPASASGPITVGA-STLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSST 422
              + AC  SPA     ITVGA    SD  A FSNYGKCVD+FAPG+ + S      ++ 
Sbjct: 598 NSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSPSNTM 657

Query: 423 ATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSD--- 479
             L+GTSM++P  AG++A  L          D G  I P ++K  LL+ STK +      
Sbjct: 658 RVLNGTSMSAPITAGVVAVLL----------DQG--IEPHEVKDHLLSISTKGLFHKRRL 705

Query: 480 IPSGTPNLLIY 490
           + S TP+  ++
Sbjct: 706 VSSRTPDRALF 716

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  154 bits (388), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 110/312 (35%), Positives = 153/312 (49%), Gaps = 38/312 (12%)

Query: 198 APWGLARISHRERLNL---------GSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGR 248
           AP  LARIS   +L             +N Y   +  G  V +Y++DTG+   H +F  R
Sbjct: 128 APRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYIMDTGIFADHPEFEDR 187

Query: 249 AKWGKTIPAGDLDEDG----NGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSD 304
                 I   DL ++G    NGHGTH AG +GS TYG AK  ++V VKVL  +GSG  S+
Sbjct: 188 -----VIQGIDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKRVNLVEVKVLGKDGSGEASN 242

Query: 305 VLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXX 364
           VL G+E+     ++  K  +P  K   AN+SLG  +SP ++                   
Sbjct: 243 VLSGLEFIV---EHCTKVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGN 299

Query: 365 EDQDACNTSPASASGPITVGA-STLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTA 423
            + DA   SPASA   ITVGA     D  A FSN+G CV++FAPG+ I S    + + T 
Sbjct: 300 FNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYNDTL 359

Query: 424 TLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSD---- 479
            LSGTSM++P V G+ A  LS              I P+ + +++   ST++V       
Sbjct: 360 ILSGTSMSTPIVTGVAAILLS------------KGIEPEMIAQEIEYLSTRNVFHRRTLF 407

Query: 480 IPSGTPNLLIYN 491
               TPN ++YN
Sbjct: 408 FKPSTPNQILYN 419

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  154 bits (390), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 106/300 (35%), Positives = 148/300 (49%), Gaps = 40/300 (13%)

Query: 191 KADTENGAPWGLARISHRERL--NLGSYNK------YLYDEQ-GGSGVTSYVIDTGVNVH 241
           K   + GAP  LARIS R++L  N  + N+      Y YD+   G GV +YVIDTG+   
Sbjct: 283 KFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILKE 342

Query: 242 HNQFGGRAKWGKTIP---AGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNG 298
           H  F  R ++G  +    AGDL    NGHGTH AG IGS TYGV K   I+ VK +   G
Sbjct: 343 HKDFEDRVEFGTDLTGEGAGDL----NGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTG 398

Query: 299 SGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXX 358
           S  +S +++ +E+   D  + V +     K    NMSLG      +++            
Sbjct: 399 STQLSHIIEAIEYTVNDCNSRVDK-----KACVVNMSLGSFYVKVINEAVESAIAEGVVF 453

Query: 359 XXXXXXEDQDACNTSPASASGPITVGASTLSDDR----AYFSNYGKCVDVFAPGLNILST 414
                  + DAC +SP S+   ITVGA    DDR    A FSN+G+CVD+FA G+ + S 
Sbjct: 454 VVAAGNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVEVKSL 510

Query: 415 YIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTK 474
                      SGTSMASP V G ++  LS              + P+ ++++++  STK
Sbjct: 511 SSQVPYKYIKYSGTSMASPIVCGFVSILLS------------QGVKPNDVQEEMVKLSTK 558

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  152 bits (385), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 115/314 (36%), Positives = 158/314 (50%), Gaps = 41/314 (13%)

Query: 195 ENGAPWGLARISHRERLNLGS-------YNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGG 247
           ++GAP  LAR   R  L   +       +N Y   E  G  V  Y++D+G++  H +F G
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 248 RAKWGKTIP---AGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSD 304
           RA +G        GDL    NGHGTH AG +GS TYG AK A I  VKV+  +G GS S+
Sbjct: 330 RAVFGIDTTNEGPGDL----NGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSN 385

Query: 305 VLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGG---GKSPSLDQXXXXXXXXXXXXXXX 361
           ++ GVE+A +  Q + K+         ANMSLGG   G S +LD                
Sbjct: 386 IIAGVEFAVKHCQQSGKK-------CVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVA 437

Query: 362 XXXEDQDACNTSPASASGPITVGA-STLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDS 420
                + AC  SPA     ITVGA    SD  A FSNYGKCVD+FAPG+ + S      +
Sbjct: 438 AGNSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYN 497

Query: 421 STATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSD- 479
           +   L+GTSM++P  AG++A  L          D G  +  + +K++L+  STK V    
Sbjct: 498 TVRVLNGTSMSAPITAGVVAVLL----------DQG--VKHEDVKERLIDLSTKGVFHRR 545

Query: 480 --IPSGTPNLLIYN 491
             + S TP+  ++N
Sbjct: 546 RLVSSRTPDRTLFN 559

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  148 bits (374), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 119/313 (38%), Positives = 159/313 (50%), Gaps = 40/313 (12%)

Query: 194 TENGAPWGLARISHRERL------NLGSYNKYLY-DEQGGSGVTSYVIDTGVNVHHNQFG 246
           +++ AP  LARIS R +L      +  S  KY Y +E  G GV  YV+D+GVN  H  F 
Sbjct: 153 SQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHPDFE 212

Query: 247 GRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVL 306
           GRA  G     G+   D  GHGTH AG IGS TYGVAK  +IV VKVL S G G++++++
Sbjct: 213 GRAMKGIDT-TGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTVTNII 271

Query: 307 KGVEWAAQDHQNAVKQKKPGFKGSTANMSLGG-GKSPSLDQXXXXXXXXXXXXXXXXXXE 365
           +G+E+    +Q   K++K        NMSLG  G    LD+                   
Sbjct: 272 EGLEYVV--NQCIGKKRK-----CVINMSLGAPGTHSILDKAVSAVIEEGVVVVVAGGNS 324

Query: 366 DQDACNTSPASASGPITVGASTLSDDR----AYFSNYGKCVDVFAPGLNILSTYIGSDSS 421
             +AC  SPA     ITV A    DDR    A FSN+G C+D++APG+N+ S        
Sbjct: 325 GLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKSLS-NKGRG 380

Query: 422 TATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSD-- 479
           T  LSGTSMASP VAG  A +L          D G+   P +++K L   +T+ V     
Sbjct: 381 TFVLSGTSMASPIVAGAAAIYL----------DQGA--DPAEVRKILSKTATRGVFKKRA 428

Query: 480 --IPSGTPNLLIY 490
             +   TPN ++Y
Sbjct: 429 IAVRPRTPNKVLY 441

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  149 bits (375), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 110/320 (34%), Positives = 154/320 (48%), Gaps = 38/320 (11%)

Query: 190 QKADTENGAPWGLARISHRERLNL---------GSYNKYLYDEQGGSGVTSYVIDTGVNV 240
           Q    ++ AP  LARIS   +L             +N Y  D+  G  V +Y++DTG+  
Sbjct: 169 QNITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIMDTGIFS 228

Query: 241 HHNQFGGRAKWGKTIPAGDLDEDG----NGHGTHCAGTIGSSTYGVAKGADIVAVKVLRS 296
            H +F  R      I   DL ++G    NGHGTH AG +GS TYG AK  ++V VKVL  
Sbjct: 229 DHPEFEDRV-----IQGIDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGK 283

Query: 297 NGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXX 356
           +GSG  S+VL G+E+     ++  +  +P  K   AN+SLG  +SP ++           
Sbjct: 284 DGSGEASNVLSGLEFIV---EHCTRVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGI 340

Query: 357 XXXXXXXXEDQDACNTSPASASGPITVGA-STLSDDRAYFSNYGKCVDVFAPGLNILSTY 415
                    + DA   SPASA   ITVGA     D  A FSN+G CV++FAPG+ I S  
Sbjct: 341 VFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLS 400

Query: 416 IGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKD 475
             +   T  LSGTSM++P V G+ A  LS              I P  + +++   ST++
Sbjct: 401 HLNYEDTLILSGTSMSTPIVTGVAAVLLS------------KGIEPALIAQEIEYLSTRN 448

Query: 476 VLSD----IPSGTPNLLIYN 491
           V           T N ++YN
Sbjct: 449 VFHRRTLFFKPSTANQILYN 468

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  130 bits (328), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 91/288 (31%), Positives = 150/288 (52%), Gaps = 12/288 (4%)

Query: 162 GYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLY 221
           G FP ++L+ +     I  +  D ++   +   +  AP  LAR+S +  L  GS   Y+Y
Sbjct: 60  GDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAHLARLSQKSTLR-GSDGTYIY 118

Query: 222 DEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDE-DGNGHGTHCAGTIGSSTY 280
              GG+GV  Y++DTG++  H +  GR +    + +  +   D +GHGT  AG IGS+T+
Sbjct: 119 HSNGGNGVDVYLLDTGIDDLHPELEGRVQKIADLTSNPVSHGDPHGHGTAVAGVIGSATF 178

Query: 281 GVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGK 340
           G AK  ++  V+V  S G+ ++  V++ +E A++    +V Q+      S   +     K
Sbjct: 179 GSAKKCNLFDVRVADSTGNATLIGVIRALEHASK--LASVTQRP-----SVVVIPFTMRK 231

Query: 341 SPSLDQXXXXXXXXXXXXXXXXXXE-DQDACNTSPASASGPITVGA--STLSDDRAYFSN 397
           +  L+                     +Q+AC++SPASA G +T+G+   T  D  A F+N
Sbjct: 232 NVILNSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASAYGALTIGSIDVTKGDSLAPFTN 291

Query: 398 YGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSL 445
           YG C+D FA G+NI S   G   S    SGTS+++   +G++AY++SL
Sbjct: 292 YGDCIDTFAAGVNITSLTTGDYESNTQYSGTSISAGIASGVVAYYMSL 339

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  128 bits (322), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 97/308 (31%), Positives = 148/308 (48%), Gaps = 29/308 (9%)

Query: 191 KADTENGAPWGLARISHRERLNLGS---YNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGG 247
           K  T+  AP  L+R S   +L   S   YN Y   +  G+ VT YV+D+G+ + H +F G
Sbjct: 141 KYSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEG 200

Query: 248 RAKWGKTIPAGDLDE----DGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMS 303
           R      + A D  +    D  GHGT  AG IGS TYGVAK  +++ +KVL + G G++ 
Sbjct: 201 R-----ILEAYDFTDSGVGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVF 255

Query: 304 DVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXX 363
            +L+G+++  +  +               N SLG      L++                 
Sbjct: 256 SILQGLQFITKHCEENTN------GNCIINASLGAINIQILNKAFEEVHNAGIPVICAAG 309

Query: 364 XEDQDACNTSPASASGPITVGASTLSDDR-AYFSNYGKCVDVFAPGLNILSTYIGSDSST 422
               +AC  +PA + G  TVG+    DD  A FSN+G+CVD+ APG+ + +    +   +
Sbjct: 310 NNAVNACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGS 369

Query: 423 ATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSI-SPDQLKKKLLAFSTKDVLSDIP 481
              SGTS+++P V GL A  LS     ++ +D    + S D L+ K          S +P
Sbjct: 370 RESSGTSVSTPIVTGLAAILLSKGVPKENLYDEIRKMGSRDLLRNK--------EFSRLP 421

Query: 482 SGTPNLLI 489
            GTPNL++
Sbjct: 422 -GTPNLIV 428

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  119 bits (297), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 91/292 (31%), Positives = 150/292 (51%), Gaps = 17/292 (5%)

Query: 162 GYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLGS---YNK 218
           G FP ++L+    S  I  +  D  +   +   +  AP  LAR+S +  L  G+      
Sbjct: 60  GEFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQQHAPNHLARLSQKSSLRGGNGSDNGA 119

Query: 219 YLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDE-DGNGHGTHCAGTIGS 277
           Y+Y    G+GV  Y++DTG++  H  F GR +      +  +   D +GHGT  AG IGS
Sbjct: 120 YIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQKAADFSSDPVATGDPHGHGTAVAGVIGS 179

Query: 278 STYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLG 337
           S +GVAK  ++  V+V  S G  S+  VL+ +E A++    A   K+P    S   + L 
Sbjct: 180 SVFGVAKKCNLFDVRVANSTGHASLIGVLRALEHASKL---AAVTKRP----SLITIPLE 232

Query: 338 GGKSPSLDQXXXXXXXXXXX-XXXXXXXEDQDACNTSPASASGPITVGASTLS--DDRAY 394
             ++  L+                    E++ AC+ SPA A G +T+G+  ++  D  A 
Sbjct: 233 MPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVSPAGAYGALTIGSIDVARNDALAP 292

Query: 395 FSNYGKCVDVFAPGLNILSTYIGSD-SSTATLSGTSMASPHVAGLLAYFLSL 445
           F+N+ +CVD+F  G+++ +  +G D SS   LSGTS+++   +GL+AY++S+
Sbjct: 293 FTNFAECVDLFTAGVDVAT--LGLDHSSEHHLSGTSISAGVASGLVAYYMSI 342

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  117 bits (293), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 101/348 (29%), Positives = 165/348 (47%), Gaps = 38/348 (10%)

Query: 119 QEVSQLPEE---HSFFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMS 175
           + V QL  E   +SF E   L+ + D P+  I     I     G+SG F  +V+  +   
Sbjct: 25  EYVVQLTSETSLNSFLESNSLNNL-DEPVDKIV----IGSDFHGFSGEFEDEVMSELYGD 79

Query: 176 PLIEMVEQDSVVYTQKADTENGAPWGLARISH---RERLNLGSYNKYLYDEQGGSGVTSY 232
           P +  +  D ++Y Q+   +N AP  LAR+S+     R++  + N +++    G GV  Y
Sbjct: 80  PRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNSRVSAKNENAFIFHSHAGIGVDVY 139

Query: 233 VIDTGVNVHHNQFGGRA------KWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGA 286
           ++D+G++  H  F  R            IP GD     +GHGT  AG + S T+GV K A
Sbjct: 140 IVDSGIDSQHPAFMNRHISKLIDLTDNPIPVGD----PHGHGTAIAGLVTSDTFGVMKKA 195

Query: 287 DIVAVKVLRSNGSG-SMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLD 345
           ++  V+V+ +  +G  +S +LK +E+  ++H  A        + S A +     K+  L+
Sbjct: 196 NLFDVRVVDAESNGVKLSKLLKSLEF-IENHSRAT------MRPSVAVLPFSMSKNAILN 248

Query: 346 QXXXXXXXXXXXXXXXXXXEDQDACNTSPASASGPITVGASTLSDDR-----AYFSNYGK 400
                              +   ACN SPASA    ++ +    D R     A FSNYG+
Sbjct: 249 S-AIESMPNSIAIVVPAGNQHHMACNFSPASARNSQSILSVGSLDYRSSIEIASFSNYGE 307

Query: 401 CVDVFAPGLNILSTYIGSDSS---TATLSGTSMASPHVAGLLAYFLSL 445
           CVDVF  G+ + + +  ++S     + +SGTSM+    AG + Y++SL
Sbjct: 308 CVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAIAAGTVGYYMSL 355

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  102 bits (253), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 89/308 (28%), Positives = 139/308 (45%), Gaps = 29/308 (9%)

Query: 155 GMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLG 214
           G    ++G F   +L  +   P +  + +D  +  Q+   +N AP  L  +S    L   
Sbjct: 52  GSFRAFTGDFSGPILQKLYNDPNVLAISRDGSLKLQEIVLQNNAPSHLVGLSSISPL--- 108

Query: 215 SYNKYLYDEQGGSGVTSYVIDTGVNVHH------NQFGGRAKWGKTIPAGDLDEDGNGHG 268
           S+  ++Y   GG+GV  Y++DTG+++ H      N           +P G    D  GHG
Sbjct: 109 SHQPFIYRSNGGNGVDVYLLDTGIDIKHPNLSKLNILRMADLTQSPVPQG---TDPQGHG 165

Query: 269 THCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFK 328
           T  AG I S T+GV K  ++V V+V  SNG   +S +L+ +    Q H      K+P   
Sbjct: 166 TAMAGIIASETFGVLKKCNLVDVRVADSNGDVKLSTILQALTL-TQRHIEGT--KRPSV- 221

Query: 329 GSTANMSLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQDACNTSPASAS----GPITVG 384
                + +  G +P L +                    QDA N SPA+ +      I VG
Sbjct: 222 -VVIPLEVEDGNNPILTEAIASFDQSVPIIIPAGNNA-QDALNFSPANVNPKPKNIIVVG 279

Query: 385 ASTLSDDRAYFSNYGKCVDVFAPGLNI-------LSTYIGSDSSTATLSGTSMASPHVAG 437
           +  ++++   F+NYG  VDVF  G  I       L +   S+S T  +SGTS +S   AG
Sbjct: 280 SVDVNNNPTKFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSNSLTRQVSGTSASSAITAG 339

Query: 438 LLAYFLSL 445
           ++ Y++SL
Sbjct: 340 VIGYYMSL 347

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score = 90.9 bits (224), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 130/282 (46%), Gaps = 55/282 (19%)

Query: 195 ENGAPWGLARISHRERLNLGSY----NKYLYDEQGGSGVTSYVIDTGVNVHH-----NQF 245
           +  AP  L R++ ++ +    Y    N+Y++ +  G+GV  Y++DTG+++ H     N  
Sbjct: 97  QTDAPKHLGRLT-KDSIKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQNNI 155

Query: 246 GGRAKWGKT-IPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGS-GSMS 303
                   + IP+GD     NGHGT  AG I S  +GV K A++V V+V+ +N    +MS
Sbjct: 156 HKLIDLTTSPIPSGDF----NGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMS 211

Query: 304 DVLKGVEWAAQDHQNAVK----------QKKPGFKGSTANMSLGGGKSPSLDQXXXXXXX 353
            VL  +    +  Q  ++          +K    + +  N+S    K P +         
Sbjct: 212 RVLSALSLIEKHEQKTMRPSIIVLPFQTEKNTILESAIENIS---KKIPVI--------- 259

Query: 354 XXXXXXXXXXXEDQDACNTSPA---SASGPITVGASTLSDDRAY-----FSNYGKCVDVF 405
                      + Q+AC  SP      S  + VG+   S+++ Y     FSNYG CVD++
Sbjct: 260 ------IPAGNKHQNACKLSPMGIKKLSNVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIY 313

Query: 406 APGLNILSTYIGSDSSTATL---SGTSMASPHVAGLLAYFLS 444
             G++I +    S+     +   +GTS +   VAG++ Y++S
Sbjct: 314 TSGVDISTLKTSSNGGKELIHNVTGTSYSCGIVAGVVGYYMS 355

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 130/294 (44%), Gaps = 27/294 (9%)

Query: 161 SGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYL 220
           +G F  + L+ +     +  + +D  +  Q+   + G+P  L+++S        S   + 
Sbjct: 57  AGEFSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLS--------SGGSFT 108

Query: 221 YDEQGGSGVTSYVIDTGVNVHH------NQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGT 274
           +D   G+ V  YV DTG++  H      N           +P G    D +GHGT  AG 
Sbjct: 109 FDPVSGNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPVPRG---ADPHGHGTMMAGL 165

Query: 275 IGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANM 334
           I S T+GV K   +V V+V   +G   +S ++KG+  +     +A   K+P    S   +
Sbjct: 166 IASETFGVLKSCSLVDVRVADKDGEVKLSTLMKGISASV---AHARFTKRP----SVFVL 218

Query: 335 SLGGGKSPSLDQXXXXXXXXXXXXXXXXXXEDQDACNTSPASASGPITVGASTLSDDRAY 394
            +  GK   +                    +  DAC+ SP +    + +G+    +  A 
Sbjct: 219 PMTIGKKNHILDNFLQAIPKDIAIVLPAGNQQTDACDLSPPNDHNILVIGSLDRDNRLAD 278

Query: 395 FSNYGKCVDVFAPGLNIL---STYIGSDSSTATLSGTSMASPHVAGLLAYFLSL 445
           FSNYG CVDV+  G +IL   ST  G++    + +GTS +    AG++ Y +S+
Sbjct: 279 FSNYGNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVGYHMSM 332

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 78/285 (27%), Positives = 120/285 (42%), Gaps = 34/285 (11%)

Query: 178 IEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTG 237
           I  +  D  +  Q+   +  AP  L ++   E       N+++YD   G+GV  Y+ DTG
Sbjct: 80  IAAISIDRQLEPQEMIVQKDAPRHLTKLLETE----AGDNEFVYDSTAGNGVDIYIFDTG 135

Query: 238 VNVHHNQFGGRAKWGKTIPAGD----LDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKV 293
           +    N  G  A     +P        D++   HGT  +G IGS  +GV K  +++ V V
Sbjct: 136 I--ARNSPGLSASRIHDMPGMPGPPIRDQEILEHGTAMSGLIGSPAFGVLKKCNLIDVNV 193

Query: 294 LRSNGSGSMSDVLKGVEWAAQ--DHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQXXXXX 351
              NG   MS VLKG+    Q   H N         + S  N S    K+  L+      
Sbjct: 194 GDENGKVFMSKVLKGLNLVQQHVKHTN---------RPSVINFSYCTLKNAILNSAFDNF 244

Query: 352 XXXXXXXXXXXXXEDQDACNTSPASAS---GPITVGASTLSDD---RAYFSNYGKCVDVF 405
                        + Q  C+ SP         +  G+  ++DD    + FSNYG CV  +
Sbjct: 245 PRDVPIAVAAGNYK-QPGCSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSY 303

Query: 406 APGLNILSTYI------GSDSSTATLSGTSMASPHVAGLLAYFLS 444
           APG  +L+  I       S  +   +SGTS +S   AG++ Y+++
Sbjct: 304 APGEGLLTFGIPDTSRPNSRDTVIIISGTSGSSALGAGVIGYYMA 348

>TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {ON}
           Anc_2.6 YNL238W
          Length = 799

 Score = 34.7 bits (78), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 38/84 (45%), Gaps = 19/84 (22%)

Query: 226 GSGVTSYVIDTGVNVHHN------QFGGRAKW----GKTIPAGDLDEDGNGHGTHCAGTI 275
           G GV + ++D G++  HN       F     W     K +P   L +D   HGT CAG I
Sbjct: 163 GKGVVAAIVDDGLD--HNSEDLKDNFCEEGSWDFNENKKLPTPKLIDDY--HGTRCAGEI 218

Query: 276 GS-----STYGVAKGADIVAVKVL 294
            +        GVA GA +  +++L
Sbjct: 219 AAVKNEYCGLGVAYGAKVAGIRIL 242

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 34.7 bits (78), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 16/91 (17%)

Query: 218 KYLYDEQGGSGVTSYVIDTGVNVHHNQ----FGGRAKW----GKTIPAGDLDEDGNGHGT 269
           +  Y+   G+G+ + ++D GV+  ++     F     W       +P   L +D   HGT
Sbjct: 183 QLWYENVTGTGIVAAIVDDGVDYDNDNIKDNFSREGSWDFNDNGPLPKPKLKDDY--HGT 240

Query: 270 HCAGTIGSST------YGVAKGADIVAVKVL 294
            CAG I +S        GVA  A +  +++L
Sbjct: 241 RCAGEIAASKNNGICGVGVAYDAKVAGIRIL 271

>KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6
           YNL238W
          Length = 826

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 39/89 (43%), Gaps = 16/89 (17%)

Query: 220 LYDEQGGSGVTSYVIDTGVNVHH----NQFGGRAKW----GKTIPAGDLDEDGNGHGTHC 271
            Y    GSGV   ++D GV+  +    + F     W      T+P   L +D   HGT C
Sbjct: 164 WYGNVTGSGVVVAIVDDGVDYENPDIADNFCAEGSWDFNDNTTLPKPRLADDY--HGTRC 221

Query: 272 AGTIGSST------YGVAKGADIVAVKVL 294
           AG I +S        GVA  + +  +++L
Sbjct: 222 AGEIAASKNNGFCGIGVAYNSKVSGLRIL 250

>NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {ON}
           Anc_2.6 YNL238W
          Length = 833

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 39/91 (42%), Gaps = 16/91 (17%)

Query: 218 KYLYDEQGGSGVTSYVIDTGVNVHH----NQFGGRAKW----GKTIPAGDLDEDGNGHGT 269
           K  Y+   G G+   ++D G++  +    + F     W       +P   L +D   HGT
Sbjct: 172 KLWYENITGEGIVVAIVDDGLDYENPDLKDNFSAEGSWDFNDNTQLPKPRLADDY--HGT 229

Query: 270 HCAGTIGSST------YGVAKGADIVAVKVL 294
            CAG I ++        GVA  A +  +++L
Sbjct: 230 RCAGEIAATKDNGFCGIGVAYNAKVAGIRIL 260

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 39/91 (42%), Gaps = 16/91 (17%)

Query: 218 KYLYDEQGGSGVTSYVIDTGVNVHH----NQFGGRAKW----GKTIPAGDLDEDGNGHGT 269
           K  Y+   G+GV + ++D G++  +    + F     W       +P   L +D   HGT
Sbjct: 158 KLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY--HGT 215

Query: 270 HCAGTIGSST------YGVAKGADIVAVKVL 294
            CAG I +         GV   A I  +++L
Sbjct: 216 RCAGEIAAKKGNNFCGVGVGYNAKISGIRIL 246

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 38/87 (43%), Gaps = 15/87 (17%)

Query: 221 YDEQGGSGVTSYVIDTGVNVH----HNQFGGRAKW----GKTIPAGDLDEDGNGHGTHCA 272
           Y+   G GV + ++D G++       + F     W       +P   LD+D   HGT CA
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPKPRLDDDY--HGTRCA 211

Query: 273 GTIGS-----STYGVAKGADIVAVKVL 294
           G I +        GVA  A +  +++L
Sbjct: 212 GEIAAVPNDFCAVGVAFNAKLSGIRIL 238

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 38/87 (43%), Gaps = 15/87 (17%)

Query: 221 YDEQGGSGVTSYVIDTGVNVHH----NQFGGRAKW----GKTIPAGDLDEDGNGHGTHCA 272
           Y+   G GV + ++D G++  +    + F     W       +P   L +D   HGT CA
Sbjct: 185 YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDY--HGTRCA 242

Query: 273 GTIG-----SSTYGVAKGADIVAVKVL 294
           G I      +   GVA  A +  +++L
Sbjct: 243 GEIAAVKNDACGVGVAYNAKVAGIRIL 269

>TPHA0N00580 Chr14 complement(124172..125857) [1686 bp, 561 aa] {ON}
           Anc_5.183 YJL025W
          Length = 561

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 33/60 (55%)

Query: 80  VVPEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFFEGIRLDGV 139
           ++P+  +  L N Y+ L + G  P E  F+R LI+  +  E++   + H +FEG+ L  +
Sbjct: 215 LLPKQWVEGLPNFYLGLLEGGAPPHEGQFYRVLIKLAYRIELNGFLDTHFYFEGLLLKLI 274

>KNAG0A04180 Chr1 (567264..569834) [2571 bp, 856 aa] {ON} Anc_8.463
           YDR239C
          Length = 856

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 222 DEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGS 277
           DE       S ++ +GVNV H +   R  + K +P G  D++ N H T+  G + S
Sbjct: 690 DENSNPDFNSKLLQSGVNVDHTKEFHRF-FNKDLPLGSDDDEFNEHDTNADGDLRS 744

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 38/88 (43%), Gaps = 16/88 (18%)

Query: 221 YDEQGGSGVTSYVIDTGVNVHH----NQFGGRAKW----GKTIPAGDLDEDGNGHGTHCA 272
           Y+   G+GV + ++D G++  +    + F     W       +P   L +D   HGT CA
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY--HGTRCA 218

Query: 273 GTIGSST------YGVAKGADIVAVKVL 294
           G I +         GV   A I  +++L
Sbjct: 219 GEIAAKKGNNFCGVGVGYNAKISGIRIL 246

>CAGL0M05445g Chr13 (580648..583446) [2799 bp, 932 aa] {ON} similar
           to uniprot|P38308 Saccharomyces cerevisiae YBR203w
          Length = 932

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 39/84 (46%), Gaps = 7/84 (8%)

Query: 13  LAGLGSALIIPELTGSNEYEKRPE--RTDDVNNGESVVATSFEKGPSKDELAVFASKLTQ 70
           L G  +A II    GS   E  PE    DD NNGE+ +A  F   P K+ +     ++TQ
Sbjct: 848 LHGSETADIITTDQGSVLPEDVPEDNNADDTNNGENTIAQPFSNDP-KERIE----RITQ 902

Query: 71  EVQDRFAPLVVPEDTLGVLENRYI 94
           E+  R   L   +    + EN Y+
Sbjct: 903 EIVARLKDLRGSDLRRNIGENNYV 926

>Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}
           similar to Ashbya gossypii ABL203W
          Length = 781

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 40/90 (44%), Gaps = 15/90 (16%)

Query: 221 YDEQGGSGVTSYVIDTGVNVH----HNQFGGRAKW----GKTIPAGDLDEDGNGHGTHCA 272
           Y+   G GV + ++D G++       + F     W       +P   L +D   HGT CA
Sbjct: 154 YNNITGHGVVAAIVDDGLDYESEDLKDNFCAEGSWDFNANTALPKPILGDDN--HGTRCA 211

Query: 273 GTIGSST-----YGVAKGADIVAVKVLRSN 297
           G I ++       GVA  A +  +++L ++
Sbjct: 212 GEIAAAKNKVCGVGVAYNAKVSGIRILSAD 241

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 38/88 (43%), Gaps = 16/88 (18%)

Query: 221 YDEQGGSGVTSYVIDTGVNVHH----NQFGGRAKW----GKTIPAGDLDEDGNGHGTHCA 272
           Y+   G+GV + ++D G++  +    + F     W       +P   L +D   HGT CA
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY--HGTRCA 218

Query: 273 GTIGSST------YGVAKGADIVAVKVL 294
           G I +         GV   A I  +++L
Sbjct: 219 GEIAAKKGNDFCGVGVGYNAKISGIRIL 246

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 37/88 (42%), Gaps = 16/88 (18%)

Query: 221 YDEQGGSGVTSYVIDTGVNVHH----NQFGGRAKW----GKTIPAGDLDEDGNGHGTHCA 272
           Y    G GV + V+D G++  +    + F     W       +P   L +D   HGT CA
Sbjct: 152 YQNITGKGVVAAVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPKPTLADDY--HGTRCA 209

Query: 273 GTI------GSSTYGVAKGADIVAVKVL 294
           G I      G    GVA  A +  +++L
Sbjct: 210 GEIAAVKNNGICGIGVAYDAKVAGIRIL 237

>KLTH0D05852g Chr4 (522837..524945) [2109 bp, 702 aa] {ON} similar
           to uniprot|P49956 Saccharomyces cerevisiae YMR078C CTF18
           Subunit of a complex with Ctf8p that shares some
           subunits with Replication Factor C and is required for
           sister chromatid cohesion may have overlapping functions
           with Rad24p in the DNA damage replication checkpoint
          Length = 702

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 5/79 (6%)

Query: 6   SVIPVATLAGLGSALIIPELTGS-NEYEKRPERTDDVNNGESVVATSFEKGPSKDELAVF 64
           SV+P+A            ++ G  NE++ R    +D+ N ES+V ++F + P   ++ + 
Sbjct: 461 SVVPMAFFHLFSDIANKDDVRGKVNEFDHR----EDLRNNESIVLSTFRRAPPTLKIFMN 516

Query: 65  ASKLTQEVQDRFAPLVVPE 83
            S L  EV      ++VP+
Sbjct: 517 KSSLALEVLPLLDYIIVPD 535

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.133    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,204,036
Number of extensions: 2346267
Number of successful extensions: 4592
Number of sequences better than 10.0: 78
Number of HSP's gapped: 4540
Number of HSP's successfully gapped: 84
Length of query: 548
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 433
Effective length of database: 40,294,809
Effective search space: 17447652297
Effective search space used: 17447652297
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)