Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07920g6.15ON29329312261e-171
KLTH0C11352g6.15ON2681797671e-101
Kwal_56.223996.15ON2741827601e-100
SAKL0E01056g6.15ON2691867531e-99
NCAS0D026606.15ON2611817355e-97
KAFR0A050606.15ON2691807341e-96
NDAI0I022506.15ON2711937243e-95
CAGL0E02673g6.15ON2631807201e-94
Kpol_1045.746.15ON2571957154e-94
Suva_15.1796.15ON2591767078e-93
KLLA0D01023g6.15ON2681797019e-92
ACR011C6.15ON2531796973e-91
Skud_15.1656.15ON2571766886e-90
YOR004W (UTP23)6.15ON2541806852e-89
Smik_15.1736.15ON2511766842e-89
KNAG0F028806.15ON2691906827e-89
TDEL0G045406.15ON2451816791e-88
Ecym_30196.15ON2661786462e-83
TPHA0J002806.15ON2711916402e-82
TBLA0A072906.15ON2591776122e-78
Kwal_55.200895.392ON1891461795e-15
KLTH0E02860g5.392ON1891461795e-15
ZYRO0A06754g5.392ON1891461761e-14
Kpol_1055.185.392ON1891461752e-14
TDEL0E023305.392ON1891461733e-14
NDAI0C045505.392ON1891461725e-14
AEL102W5.392ON1891461691e-13
CAGL0M01056g5.392ON1891461691e-13
NCAS0F030905.392ON1891461691e-13
SAKL0G07766g5.392ON1891461672e-13
TPHA0D023105.392ON1891461672e-13
Ecym_74695.392ON1891461663e-13
KAFR0D042805.392ON1891461654e-13
KNAG0C052705.392ON1891461645e-13
Suva_2.5095.392ON1891461646e-13
Skud_4.6065.392ON1891461647e-13
Smik_4.5995.392ON1891461647e-13
YDR339C (FCF1)5.392ON1891461638e-13
TBLA0H017505.392ON1891461621e-12
KLLA0A07018g5.392ON1891431568e-12
Suva_13.418.821ON165130721.7
NCAS0G030202.246ON46295667.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C07920g
         (293 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   476   e-171
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   300   e-101
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   297   e-100
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   294   1e-99
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   287   5e-97
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   287   1e-96
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   283   3e-95
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   281   1e-94
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   280   4e-94
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   276   8e-93
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   274   9e-92
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   273   3e-91
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   269   6e-90
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   268   2e-89
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   268   2e-89
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   267   7e-89
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   266   1e-88
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   253   2e-83
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   251   2e-82
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   240   2e-78
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    74   5e-15
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    74   5e-15
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    72   1e-14
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    72   2e-14
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    71   3e-14
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    71   5e-14
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    70   1e-13
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    70   1e-13
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    70   1e-13
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    69   2e-13
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    69   2e-13
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    69   3e-13
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    68   4e-13
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    68   5e-13
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    68   6e-13
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    68   7e-13
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    68   7e-13
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    67   8e-13
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    67   1e-12
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    65   8e-12
Suva_13.41 Chr13 complement(62311..64194,64223..67294) [4956 bp,...    32   1.7  
NCAS0G03020 Chr7 complement(554838..556226) [1389 bp, 462 aa] {O...    30   7.0  

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  476 bits (1226), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 240/293 (81%), Positives = 240/293 (81%)

Query: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60
           MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120
           ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA
Sbjct: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120

Query: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180
           SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK
Sbjct: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180

Query: 181 TTPSVENELESESQXXXXXXXXXXXXXXLSVRXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           TTPSVENELESESQ              LSVR                            
Sbjct: 181 TTPSVENELESESQPPAKKRKGPKGPNPLSVRKKQKKPEQQGQGQGQEQEQEHESEREHE 240

Query: 241 DAGXXXXXXXXXXXGSHEDGDGQENSAGEVEAEDRPQEDRPQEDRPQGDQNSD 293
           DAG           GSHEDGDGQENSAGEVEAEDRPQEDRPQEDRPQGDQNSD
Sbjct: 241 DAGKKKRRRRRKHKGSHEDGDGQENSAGEVEAEDRPQEDRPQEDRPQGDQNSD 293

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  300 bits (767), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 161/179 (89%)

Query: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60
           MRQKRAKSY+KQMLVYN+ F+FREPYQVL+DDQ+V D  ++ +DLV GL+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60

Query: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120
           ITQCC+QA+Y TKNQDAIEL KSFERRRCNHPPKEAKPP EC+QSVV+VNG+NKHRYVVA
Sbjct: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120

Query: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGL 179
           SQD ++R+KLR+VPGVPLI+M+RSVMVMEPLS+AS   +   E+EKL KGLNDPK AGL
Sbjct: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGL 179

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  297 bits (760), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 138/182 (75%), Positives = 158/182 (86%)

Query: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60
           MRQKRAKSY+KQMLVYN+ F+FREPYQVL+DDQ+V D  K+ +DLV GLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120
           ITQCC+QA+Y T +Q+AIEL KSFERRRCNHPPKEAKPP EC+QSVVNVNG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120

Query: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180
           +Q+  +R  LRKVPGVPL+ M+RSVMVMEPLS+AS  V+ + EREKL KGLNDPK AGL 
Sbjct: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180

Query: 181 TT 182
            T
Sbjct: 181 LT 182

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  294 bits (753), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 137/186 (73%), Positives = 160/186 (86%)

Query: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60
           MRQKRAKSY+KQMLVYN+ F+FREPYQVL+DDQ+V    KS +DL  GLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120
           ITQCCMQALY TK+Q AIE+ K++ERRRCNHPPKE+K   ECI+SVVN NG NKHRYVVA
Sbjct: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120

Query: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180
           +QD+ +RRKLR+VPGVPLI+M+RSVMVMEPLSEAS R++++ E EKL KGLNDPK AGL 
Sbjct: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180

Query: 181 TTPSVE 186
              SV+
Sbjct: 181 HDESVD 186

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  287 bits (735), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 157/181 (86%)

Query: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60
           MRQKRAKSY+KQ+LVYN+ FRFREPYQ+L+D+Q+V+DC  S+YDL  GL RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60

Query: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120
           ITQCCMQALY   +Q+AIEL + FERRRCNH PK+ K P ECI+SVVN+NG NKHRYVVA
Sbjct: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120

Query: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180
           +QDV +RRKLR+VPGVPL+H+SR+VM+MEPLS+AS++V++  E EKL KGLNDPK  G+K
Sbjct: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180

Query: 181 T 181
           T
Sbjct: 181 T 181

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  287 bits (734), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 159/180 (88%)

Query: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60
           MRQKRAKSY+KQ+LVY++ F+FREPYQVL+D+++V+    S++DLV GLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120
           ITQCCMQALY T++Q+AI++ K FERRRCNHPPKE K P EC+ SVVNVNG NKHRYVVA
Sbjct: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120

Query: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180
           SQD+ +RR+LR+VPGVPL+H+SRSVM+MEPLS+ S++++   E+EKL KGLNDPK AGLK
Sbjct: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  283 bits (724), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 155/193 (80%)

Query: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60
           MRQKRAKSY+KQ+LVYN+ F+FR PYQVL+D+Q+V DC  S+YDL  GLK TLQ+EVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60

Query: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120
           ITQCCMQALY   NQDAIEL + FERRRCNH PKE K   ECI+SVVN+NG NKHRYVVA
Sbjct: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120

Query: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180
           SQD+  RRKLR+VPGVPLIH+SR+VM+MEPLS+ S++V+   E EKL KGLNDPK  G+K
Sbjct: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180

Query: 181 TTPSVENELESES 193
           +    E   E ES
Sbjct: 181 SAVDKETVKEKES 193

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  281 bits (720), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 151/180 (83%)

Query: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60
           MRQKRAKSY+KQ+LVYN+ F+FREPYQVL+DDQ+V D   S YDLV  LKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60

Query: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120
           ITQCCMQALY TKN+ AI+LGK FERRRC H P EA  P ECI +VV+V G NKHRYVVA
Sbjct: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120

Query: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180
            QDV +RR LRKVPGVPL+H+SRSVM+MEPLS+AS++V+ M E  KL +GLNDPK AGLK
Sbjct: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  280 bits (715), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 164/195 (84%), Gaps = 1/195 (0%)

Query: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60
           MRQ+RAKSY+KQMLVYN+ F+FREPYQ ++DDQLV DC +S +D++ GLKRTLQAEVK M
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60

Query: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120
           ITQCCMQALY T NQ+AI + K FERRRCNHPPK+ K P ECI+S+V++ GSNKHRYVVA
Sbjct: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120

Query: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPK-LAGL 179
           SQD+ +RRKLRK+PGVP++H+SR+VM++EPLS+AS +++E  E++KL KGLND K  AGL
Sbjct: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180

Query: 180 KTTPSVENELESESQ 194
               S ++E  SES+
Sbjct: 181 DEPKSEKSEKTSESK 195

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  276 bits (707), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 153/176 (86%)

Query: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60
           MRQKRAKSY+KQ+LVY++ F+FREPYQVL+D+QLVS+C  S++DL  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120
           ITQCC+QALY T+N+ AI+L K FERRRCNH  K+ K P ECI+SVVNVNG+NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120

Query: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKL 176
           SQD+ LRRKLR VPGVPLIH++RSVM+MEPLS AS++ + M+E +KL KGLNDP +
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNI 176

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  274 bits (701), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 127/179 (70%), Positives = 150/179 (83%)

Query: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60
           MRQKRAKSY+KQMLVYN+ F+FR+PYQVL+DDQLV +   S +D V GL+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60

Query: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120
           ITQCCMQ+LY T NQ AI+ GK FERRRCNH PKE K   EC+ SVV+VNG NKHRYVVA
Sbjct: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120

Query: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGL 179
           +QDV +RR+LRK+PGVPL++M+RSVMVMEPLS AS +V+   E +KL KGLNDPK AG+
Sbjct: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGI 179

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  273 bits (697), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 151/179 (84%), Gaps = 1/179 (0%)

Query: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60
           MRQKRAK+YKKQMLVYN+ F+FREPYQVL+DDQ+V +  KS +DL+ GLKRTLQAEVKPM
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120
           ITQCCMQ LY TKNQDAI  GK +ERRRCNH  KE K P EC+QSVV VNG N+HRY+VA
Sbjct: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119

Query: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGL 179
           SQD+ +RR LRKVPGVPL++++R+VMVMEPLS  S +V+  +E++KL KGLNDPK  G+
Sbjct: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGI 178

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  269 bits (688), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 153/176 (86%)

Query: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60
           MRQKRAKSY+KQ+LVY++ F+FREPYQVL+D+QLVS+C  S+++L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120
           ITQCC+QALY T+N+ AI+L K FERRRCNH  K+ K P ECI+SVV+VNG+NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120

Query: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKL 176
           SQD+ LRRKLR VPGVPLIH++RSVM+MEPLS AS++ ++ +E +KL KGLNDP +
Sbjct: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNV 176

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  268 bits (685), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 122/180 (67%), Positives = 153/180 (85%)

Query: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60
           MRQKRAKSY+KQ+LVY++ F+FREPYQVL+D+QLV +C  S+++L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120
           ITQCC+QALY T+N  AI L K FERRRCNH  K+ K P ECI+SVVN++G+NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120

Query: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180
           SQD+ LRRKLR VPGVPLIH++RSVMVMEPLS AS++ ++++E +KL KGLNDP +  L+
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  268 bits (684), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 121/176 (68%), Positives = 152/176 (86%)

Query: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60
           MRQKRAKSY+KQ+LVY++ F+FREPYQVL+D+QLV +C  S+++L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120
           ITQCC+QALY T+N+ AI+L K FERRRCNH  K+ K P +CI+SVV++NG+NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120

Query: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKL 176
           SQD+ LRRKLR VPGVPLIH++RSVMVMEPLS AS++ ++M+E  KL KGLNDP +
Sbjct: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNV 176

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  267 bits (682), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 121/190 (63%), Positives = 157/190 (82%), Gaps = 2/190 (1%)

Query: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60
           MRQKRAKSY+KQ+LVYN+ FRFREPYQV++DD++V    +S +DL   L+RT+QAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAEVKLM 60

Query: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120
           ITQCCMQALY T N+ AI++ K +ERRRCNHPPK+ K P ECI+SVV++ G NKHRY+VA
Sbjct: 61  ITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIVA 120

Query: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180
            Q++ LRRKLR+VPGVPLIH+SR+VM+MEPLS+AS+R+++  E++KL  GLND K AG+K
Sbjct: 121 CQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKAAGIK 180

Query: 181 T--TPSVENE 188
              T  VE++
Sbjct: 181 AAETEKVEDK 190

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  266 bits (679), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 155/181 (85%)

Query: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQMLVYN+ F+FREPYQVL+D+Q+V DC  S++DLV GL+RTLQAEVK M
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60

Query: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120
           ITQCCMQALY T  Q AIEL K+FERRRCNHPPKE KPP EC++S+V VNG NKHRYVVA
Sbjct: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120

Query: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180
           SQD+  RR LR+ PGVPL+H  RSVMVMEPLS+AS++V+  +E EKL KGLNDP+ AG+K
Sbjct: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPRNAGIK 180

Query: 181 T 181
           T
Sbjct: 181 T 181

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  253 bits (646), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 149/178 (83%), Gaps = 1/178 (0%)

Query: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60
           MRQKRAK+YKKQMLVYN+ F+FR+PYQVL+DDQLV +  KS +DL+ GLKRTLQAEVKPM
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120
           ITQCC+Q LY +KNQ AI   K +ERRRCNH  KE K P ECI+SVV++NG N HRYVVA
Sbjct: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119

Query: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAG 178
           +QD+ +RR LR+VPGVPLI+M+RSVMVMEPLS  S +V++  E EKL+KGLNDPK AG
Sbjct: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAG 177

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  251 bits (640), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 118/191 (61%), Positives = 152/191 (79%), Gaps = 5/191 (2%)

Query: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAE-VKP 59
           MRQKRAKSYKKQM+VYN+ F+FREPYQ+L+D+Q+V D  +S+Y+L   L++TLQAE +K 
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 60  MITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVV 119
           MITQCCMQ LY T NQ+ I+  K FERRRCNH  K+ K P ECI+S+VN++G NKHRYVV
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 120 ASQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGL 179
           A+Q++ LRRKLR+VPGVP++H+SRSVM+MEP+S++S R+N   E+ KL KGLNDPK +  
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180

Query: 180 KT----TPSVE 186
            T    TP  E
Sbjct: 181 PTPKEGTPDTE 191

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  240 bits (612), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 139/177 (78%), Gaps = 2/177 (1%)

Query: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAE--VK 58
           MRQKRAKSYKKQ++VYN+ F+FREPYQV+IDD LV +  ++ Y+L+ GL   L +   +K
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 59  PMITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYV 118
           PMITQCC+ ALY +++Q++I +GK+FERRRCNH  KE   P EC+ S+V+VNG NKHRY+
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 119 VASQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPK 175
           VA+QD+ LRRKLRK+PGVPLIH  RSVMVMEPLS+AS   NE  E +KL  GLN  K
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTK 177

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 73.6 bits (179), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 77/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPMITQCCMQAL--YF 71
           L + Y    + PYQVLID   ++   +   DLV G+  TL A+  P+IT C M  L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIPLITDCVMAELEKLG 110

Query: 72  TKNQDAIELGKS--FERRRCNHPPKEAKPPHECIQSVVNVNGSNKHR-YVVASQDVTLRR 128
            K + A++L +    +R  C+H    A    +C+     VN   +H+ Y+VA+ D  L++
Sbjct: 111 PKYRIALKLARDPRIQRLSCSHKGTYA---DDCL-----VNRVLQHKCYIVATNDAALKQ 162

Query: 129 KLRKVPGVPLIHMSRSVMVMEPLSEA 154
           ++RKVPG+PL+ +     V+E L + 
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKLPDV 188

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 73.6 bits (179), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 77/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPMITQCCMQAL--YF 71
           L + Y    + PYQVLID   ++   +   D+V G+  TL A+  PMIT C M  L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMAELEKLG 110

Query: 72  TKNQDAIELGKS--FERRRCNHPPKEAKPPHECIQSVVNVNGSNKHR-YVVASQDVTLRR 128
            K + A++L +    +R  C+H    A    +C+     VN   +H+ Y+VA+ D  L++
Sbjct: 111 PKYRIALKLARDPRIQRLTCSHKGTYA---DDCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRKVPGVPLIHMSRSVMVMEPLSEA 154
           ++RKVPG+PL+ +     V+E L + 
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKLPDV 188

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 72.4 bits (176), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPMITQCCMQAL--YF 71
           L + Y    R PYQVLID   ++   +   D+V G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKNQDAIELGKS--FERRRCNHPPKEAKPPHECIQSVVNVNGSNKHR-YVVASQDVTLRR 128
            K + A++L +    +R  C H    A    +C+     VN   +H+ Y+VA+ D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLSCTHKGTYA---DDCL-----VNRVMQHKCYIVATNDAPLKQ 162

Query: 129 KLRKVPGVPLIHMSRSVMVMEPLSEA 154
           ++RK+PG+PL+ +     V+E L +A
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDA 188

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 72.0 bits (175), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPMITQCCMQAL--YF 71
           L + Y    + PYQVLID   ++   +   D++ G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKNQDAIELGKS--FERRRCNHPPKEAKPPHECIQSVVNVNGSNKHR-YVVASQDVTLRR 128
            K + A+ L +    +R  C+H    A    +CI     VN   +H+ Y+VA+ DV L++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYA---DDCI-----VNRVLQHKCYIVATNDVGLKQ 162

Query: 129 KLRKVPGVPLIHMSRSVMVMEPLSEA 154
           ++RKVPG+PL+ +     V+E L + 
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 71.2 bits (173), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPMITQCCMQAL--YF 71
           L + Y    + PYQVLID   ++   +   DLV G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKNQDAIELGKS--FERRRCNHPPKEAKPPHECIQSVVNVNGSNKHR-YVVASQDVTLRR 128
            K + A++L +    +R  C H    A    +CI     VN   +H+ Y+VA+ D  L++
Sbjct: 111 PKFRIALKLARDPRIKRLSCTHKGTYA---DDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRKVPGVPLIHMSRSVMVMEPLSEA 154
           ++RK+PG+PL+ +      +E L +A
Sbjct: 163 RVRKIPGIPLMSVGGHAYAIEKLPDA 188

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 70.9 bits (172), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPMITQCCMQAL--YF 71
           L + Y    + PYQVLID   ++   +   DLV G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKNQDAIELGKS--FERRRCNHPPKEAKPPHECIQSVVNVNGSNKHR-YVVASQDVTLRR 128
            K + A++L +    +R  C+H    A    +CI     VN   +H+ Y+VA+ D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYA---DDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRKVPGVPLIHMSRSVMVMEPLSEA 154
           ++RK+PG+PL+ +     V+E L + 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 69.7 bits (169), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPMITQCCMQAL--YF 71
           L + Y    + PYQVLID   ++   +   DLV G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 72  TKNQDAIELGKS--FERRRCNHPPKEAKPPHECIQSVVNVNGSNKHR-YVVASQDVTLRR 128
            K + A++L +    +R  C+H    A    +C+     VN   +H+ Y+VA+ D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLNCSHKGTYA---DDCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRKVPGVPLIHMSRSVMVMEPLSEA 154
           ++RKVPG+PL+ +     V+E L + 
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 69.7 bits (169), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPMITQCCMQAL--YF 71
           L + Y    + PYQVLID   ++   +   D+V G+   L A+  P+IT C +  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 72  TKNQDAIELGKS--FERRRCNHPPKEAKPPHECIQSVVNVNGSNKHR-YVVASQDVTLRR 128
            K + A++L +    +R  C H    A    +CI     VN   +H+ Y+VA+ D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLTCTHKGTYA---DDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRKVPGVPLIHMSRSVMVMEPLSEA 154
           ++RK+PG+PL+ +     V+E L + 
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 69.7 bits (169), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPMITQCCMQAL--YF 71
           L + Y    + PYQVLID   ++   +   DLV G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKNQDAIELGKS--FERRRCNHPPKEAKPPHECIQSVVNVNGSNKHR-YVVASQDVTLRR 128
            K + A+ L +    +R  C+H    A    +CI     VN   +H+ ++VA+ D  L++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYA---DDCI-----VNRVLQHKCFIVATNDAGLKQ 162

Query: 129 KLRKVPGVPLIHMSRSVMVMEPLSEA 154
           ++RK+PG+PL+ +     V+E L + 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 68.9 bits (167), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPMITQCCMQAL--YF 71
           L + Y    + PYQVLID   ++   +   D+V G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 72  TKNQDAIELGKS--FERRRCNHPPKEAKPPHECIQSVVNVNGSNKHR-YVVASQDVTLRR 128
            K + A+ L +    +R  C+H    A    +C+     VN   +H+ Y+VA+ D  L++
Sbjct: 111 PKYRIALRLARDPRIKRLNCSHKGTYA---DDCL-----VNRVLQHKCYIVATNDAALKQ 162

Query: 129 KLRKVPGVPLIHMSRSVMVMEPLSEA 154
           ++RKVPG+PL+ +     V+E L + 
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 68.9 bits (167), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPMITQCCMQAL--YF 71
           L + +    R PYQVLID   ++   +   D++ G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKNQDAIELGKS--FERRRCNHPPKEAKPPHECIQSVVNVNGSNKHR-YVVASQDVTLRR 128
            K + A+ L +    +R  C+H    A    +CI     VN   +H+ Y+VA+ D  L++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYA---DDCI-----VNRVLQHKCYIVATNDQGLKQ 162

Query: 129 KLRKVPGVPLIHMSRSVMVMEPLSEA 154
           ++RK+PG+PL+ +     V+E L + 
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 68.6 bits (166), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPMITQCCMQAL--YF 71
           L + Y    + PYQVLID   ++   +   D+V G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 72  TKNQDAIELGKS--FERRRCNHPPKEAKPPHECIQSVVNVNGSNKHR-YVVASQDVTLRR 128
            K + A++L +    +R  C+H    A    +C+     VN   +H+ Y+VA+ D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLTCSHRGTYA---DDCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRKVPGVPLIHMSRSVMVMEPLSEA 154
           ++RKVPG+PL+ +     V+E L + 
Sbjct: 163 RIRKVPGIPLLSVGGHSYVIEKLPDV 188

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 68.2 bits (165), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPMITQCCMQAL--YF 71
           L + Y    + PYQVLID   ++   +   D+V G+   L A+  P+IT C +  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 72  TKNQDAIELGKS--FERRRCNHPPKEAKPPHECIQSVVNVNGSNKHR-YVVASQDVTLRR 128
            K + A++L +    +R  C+H    A    +CI     VN   +H+ Y+VA+ D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYA---DDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRKVPGVPLIHMSRSVMVMEPLSEA 154
           ++RK+PG+PL+ +     V+E L + 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 67.8 bits (164), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPMITQCCMQAL--YF 71
           L + Y    + PYQVLID   ++   +   D+V G+   L A+  P+IT C +  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 72  TKNQDAIELGKS--FERRRCNHPPKEAKPPHECIQSVVNVNGSNKHR-YVVASQDVTLRR 128
            K + A++L +    +R  C+H    A    +C+     VN   +H+ Y+VA+ D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYA---DDCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRKVPGVPLIHMSRSVMVMEPLSEA 154
           ++RK+PG+PL+ +     V+E L + 
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 67.8 bits (164), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPMITQCCMQAL--YF 71
           L + Y    + PYQVLID   ++   +   D+V G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKNQDAIELGKS--FERRRCNHPPKEAKPPHECIQSVVNVNGSNKHR-YVVASQDVTLRR 128
            K + A++L +    +R  C+H    A    +C+     V+   +H+ Y+VA+ D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYA---DDCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRKVPGVPLIHMSRSVMVMEPLSEA 154
           ++RK+PG+PL+ +     V+E L + 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 67.8 bits (164), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPMITQCCMQAL--YF 71
           L + Y    + PYQVLID   ++   +   D+V G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKNQDAIELGKS--FERRRCNHPPKEAKPPHECIQSVVNVNGSNKHR-YVVASQDVTLRR 128
            K + A++L +    +R  C+H    A    +C+     V+   +H+ Y+VA+ D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYA---DDCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRKVPGVPLIHMSRSVMVMEPLSEA 154
           ++RK+PG+PL+ +     V+E L + 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 67.8 bits (164), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPMITQCCMQAL--YF 71
           L + Y    + PYQVLID   ++   +   D+V G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKNQDAIELGKS--FERRRCNHPPKEAKPPHECIQSVVNVNGSNKHR-YVVASQDVTLRR 128
            K + A++L +    +R  C+H    A    +C+     V+   +H+ Y+VA+ D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYA---DDCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRKVPGVPLIHMSRSVMVMEPLSEA 154
           ++RK+PG+PL+ +     V+E L + 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 67.4 bits (163), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPMITQCCMQAL--YF 71
           L + Y    + PYQVLID   ++   +   D+V G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKNQDAIELGKS--FERRRCNHPPKEAKPPHECIQSVVNVNGSNKHR-YVVASQDVTLRR 128
            K + A++L +    +R  C+H    A    +C+     V+   +H+ Y+VA+ D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYA---DDCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRKVPGVPLIHMSRSVMVMEPLSEA 154
           ++RK+PG+PL+ +     V+E L + 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 67.0 bits (162), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPMITQCCMQAL--YF 71
           L + Y    + PYQVLID   ++   +   D+V G+   L A+  P+IT C +  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVVAELEKLG 110

Query: 72  TKNQDAIELGKS--FERRRCNHPPKEAKPPHECIQSVVNVNGSNKHR-YVVASQDVTLRR 128
            K + A++L +    +R  C+H    A    +CI     VN   +H+ Y+VA+ D  L++
Sbjct: 111 PKFRIALKLARDPRIKRLSCSHRGTYA---DDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRKVPGVPLIHMSRSVMVMEPLSEA 154
           ++RK+PG+PL+ +     V+E L + 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVVEKLPDV 188

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 64.7 bits (156), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 74/143 (51%), Gaps = 13/143 (9%)

Query: 14  LVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPMITQCCMQAL--YF 71
           L + Y    + PYQVLID   ++   +   D+V G+   L A+   +IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCVMAELEKLG 110

Query: 72  TKNQDAIELGKS--FERRRCNHPPKEAKPPHECIQSVVNVNGSNKHR-YVVASQDVTLRR 128
            K + A++L +    +R  C+H    A    +CI     V+   +H+ Y+VA+ D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYA---DDCI-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRKVPGVPLIHMSRSVMVMEPL 151
           ++RKVPG+PL+ +     V+E L
Sbjct: 163 RVRKVPGIPLMSVGGHSYVIEKL 185

>Suva_13.41 Chr13 complement(62311..64194,64223..67294) [4956 bp,
           1651 aa] {ON} YML103C (REAL)
          Length = 1651

 Score = 32.3 bits (72), Expect = 1.7,   Method: Composition-based stats.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 162 SEREKLLKGLNDPKLAGLKTTPSVENELES 191
           + + KL++GL+ PK A L  TPS +N+L S
Sbjct: 46  TNKAKLIQGLSQPKHAALAPTPSGDNKLRS 75

>NCAS0G03020 Chr7 complement(554838..556226) [1389 bp, 462 aa] {ON}
           Anc_2.246 YNL062C
          Length = 462

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 47/95 (49%), Gaps = 6/95 (6%)

Query: 74  NQDAIELGKSFERRRCNHP---PKEAKPPHECIQSVVNVNGSNKHRYVVASQDVTLRRKL 130
           NQD I +G   ++   +      K++   +E I  ++  +G N H+  V SQ+  L+RK 
Sbjct: 106 NQDLINMGSDIQKLTSDEIEELKKQSVSGNEIISKIIESHG-NFHKKTVYSQEKYLKRKK 164

Query: 131 RKVPGVPLIHMSRSVMVMEPLSEASS--RVNEMSE 163
           +K   +  +    S  +++ L + S   R+ +MS+
Sbjct: 165 QKFDKIFTVDYLSSSALLQYLIDKSDIQRIMDMSQ 199

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,795,718
Number of extensions: 892531
Number of successful extensions: 3272
Number of sequences better than 10.0: 64
Number of HSP's gapped: 3283
Number of HSP's successfully gapped: 65
Length of query: 293
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 184
Effective length of database: 40,982,805
Effective search space: 7540836120
Effective search space used: 7540836120
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)