Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07898g6.16ON97497451970.0
TDEL0G045306.16ON95899828590.0
NDAI0D008706.16ON106998525240.0
YEL061C (CIN8)6.16ON100094524440.0
Smik_5.266.16ON100293824280.0
SAKL0E01078g6.16ON94896224250.0
Skud_5.286.16ON99893324010.0
Suva_5.66.16ON99994023870.0
NCAS0H008806.16ON1004101223820.0
KAFR0L003706.16ON96394722830.0
KLTH0C11330g6.16ON94188622770.0
KLLA0D01045g6.16ON96590722760.0
Ecym_30206.16ON94488222240.0
Kwal_56.224036.16ON94393922200.0
CAGL0B03641g6.16ON98887422220.0
ACR010C6.16ON94592021750.0
KNAG0M011306.16ON95096718610.0
Kpol_1032.66.16ON100472117050.0
Kpol_1045.736.16ON96290915540.0
TPHA0M002406.16ON93963015110.0
TPHA0J003006.16ON98296711971e-147
ZYRO0B03234g7.387ON11385099231e-107
TPHA0E008907.387ON12326008573e-97
TBLA0A072306.16ON10971818059e-91
ACR228C7.387ON11292956261e-66
Suva_2.547.387ON11102166161e-65
Smik_2.537.387ON11132166143e-65
YBL063W (KIP1)7.387ON11112166143e-65
Skud_2.417.387ON11102166126e-65
SAKL0F12298g7.387ON11122146091e-64
NCAS0E026407.387ON11022866046e-64
Ecym_46887.387ON11342186021e-63
TDEL0C016007.387ON11053476002e-63
NDAI0E043007.387ON11862336012e-63
KAFR0L017107.387ON11512245895e-62
TBLA0D006407.387ON11422064355e-43
KLTH0D11286g8.678ON6783903823e-37
TBLA0C049603.528ON8013883631e-34
SAKL0G05016g5.531ON5041753514e-34
SAKL0G18920g2.633ON6491743539e-34
KLTH0G03850g5.531ON4731733424e-33
Kwal_47.186085.531ON4791733424e-33
KLLA0B00759g5.531ON4561743301e-31
Skud_16.1278.678ON7064073263e-30
SAKL0F01760g3.528ON8091803239e-30
Ecym_40665.531ON4781813151e-29
Smik_7.483.528ON8051803221e-29
ZYRO0E08668g3.528ON7781803202e-29
Kwal_47.190933.528ON8191813203e-29
Skud_7.533.528ON8051803193e-29
Suva_7.443.528ON8051803159e-29
Kpol_423.83.528ON8061833132e-28
TDEL0D059603.528ON7331813112e-28
YGL216W (KIP3)3.528ON8051803122e-28
Ecym_34152.633ON6621773102e-28
KNAG0B005203.528ON7231853112e-28
ADR145C2.633ON6351703075e-28
KLTH0G01606g3.528ON8191813086e-28
CAGL0I07029g3.528ON7051823067e-28
NCAS0E005503.528ON7841823061e-27
AER441C3.528ON8181803061e-27
KAFR0F042103.528ON6721803041e-27
Ecym_12003.528ON8331803051e-27
NDAI0I029603.528ON8681903032e-27
Kpol_1004.255.531ON5062262973e-27
KLLA0A01606g3.528ON7691822996e-27
TPHA0D034803.528ON8471812981e-26
ZYRO0D12650g5.531ON4781952883e-26
TBLA0C039403.479ON7391922915e-26
CAGL0D04994g3.479ON6921682844e-25
AGR253W3.479ON7091692791e-24
TBLA0C053103.479ON6761762782e-24
KNAG0A078803.479ON7641442782e-24
KAFR0H024108.678ON6583182763e-24
Kwal_26.88068.678ON7153252763e-24
Kpol_505.393.479ON6921592755e-24
KLLA0D05951g8.678ON6683432728e-24
SAKL0F03168g3.479ON7061452702e-23
SAKL0H06490g8.678ON6572632692e-23
KLTH0F14498g3.479ON7021682702e-23
Kpol_1013.78.678ON6201802682e-23
TDEL0F036403.479ON7041662674e-23
KAFR0B065903.479ON7061952674e-23
NCAS0C013508.678ON6551842665e-23
ACR145W8.678ON6852062648e-23
ZYRO0F07414g8.678ON6541832621e-22
ZYRO0B04290g3.479ON7311532622e-22
TPHA0D032003.479ON7241502622e-22
TPHA0D012708.678ON6961892612e-22
Ecym_44073.479ON7111832612e-22
Kpol_1050.1033.479ON6971552603e-22
NCAS0F034703.479ON6981672585e-22
KLLA0B10956g3.479ON6901472576e-22
NDAI0E02090singletonON6852032541e-21
YPR141C (KAR3)3.479ON7291442551e-21
NDAI0B057703.479ON7631542542e-21
Skud_16.4353.479ON7291652532e-21
Smik_16.3883.479ON7291482523e-21
TBLA0C018808.678ON4681772474e-21
CAGL0M02189g8.678ON6721942504e-21
Suva_16.4693.479ON7311462488e-21
Ecym_23958.678ON6871842442e-20
YPL155C (KIP2)8.678ON7062012415e-20
Smik_6.3528.678ON7152072381e-19
TDEL0A062408.678ON6373132362e-19
TDEL0B072702.633ON6442042335e-19
KNAG0J017208.678ON6251852273e-18
TPHA0D041903.479ON6721452246e-18
Suva_16.1558.678ON7042012103e-16
Kpol_1019.112.633ON6472302023e-15
TPHA0N016502.633ON6822311782e-12
YKL079W (SMY1)2.633ON6561271763e-12
Kwal_55.21164singletonOFF5881251763e-12
Kwal_YGOB_55.211643.479ON6571251754e-12
Suva_11.1452.633ON6571091721e-11
Skud_11.1482.633ON6561091692e-11
Smik_11.1602.633ON6561281551e-09
NDAI0C004802.633ON5982941513e-09
KNAG0M025402.633ON5221091461e-08
TBLA0A008202.633ON8031701452e-08
NCAS0H031802.633ON6602121452e-08
TBLA0C008002.633ON6931641442e-08
ZYRO0E01078g2.633ON6681121406e-08
CAGL0L05104g2.633ON6752001398e-08
KAFR0C040202.633ON6672491164e-05
KNAG0H003602.633ON6811251121e-04
KAFR0B005907.488ON1261133910.042
NCAS0C028308.401ON874127870.12
TBLA0B051006.195ON411110790.92
NCAS0C052002.633ON572177781.4
ZYRO0G04444g5.453ON121129781.7
Ecym_64762.16ON850163762.5
Smik_2.677.488ON1377154753.1
Suva_2.707.488ON1380154735.8
KLTH0C02486g1.515ON2467139736.5
KAFR0C036508.8ON21242707.2
TBLA0J019107.154ON195048727.9
YBL047C (EDE1)7.488ON1381154728.4
KNAG0E022002.406ON135880728.6
Skud_2.557.488ON1390162719.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C07898g
         (974 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...  2006   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...  1105   0.0  
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   976   0.0  
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...   946   0.0  
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...   939   0.0  
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   938   0.0  
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...   929   0.0  
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...   924   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   922   0.0  
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   884   0.0  
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   881   0.0  
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   881   0.0  
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   861   0.0  
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   859   0.0  
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   860   0.0  
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   842   0.0  
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   721   0.0  
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   661   0.0  
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   603   0.0  
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   586   0.0  
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   465   e-147
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   360   e-107
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   334   3e-97
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   314   9e-91
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   245   1e-66
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   241   1e-65
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   241   3e-65
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   241   3e-65
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   240   6e-65
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   239   1e-64
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   237   6e-64
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   236   1e-63
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   235   2e-63
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   236   2e-63
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   231   5e-62
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   172   5e-43
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...   151   3e-37
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   144   1e-34
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   139   4e-34
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   140   9e-34
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   136   4e-33
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   136   4e-33
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   131   1e-31
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...   130   3e-30
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   129   9e-30
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   125   1e-29
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   128   1e-29
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   127   2e-29
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   127   3e-29
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   127   3e-29
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   125   9e-29
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   125   2e-28
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   124   2e-28
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   124   2e-28
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   124   2e-28
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   124   2e-28
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   122   5e-28
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   123   6e-28
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   122   7e-28
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   122   1e-27
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   122   1e-27
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   121   1e-27
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   122   1e-27
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   121   2e-27
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   119   3e-27
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   119   6e-27
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   119   1e-26
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   115   3e-26
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   116   5e-26
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   114   4e-25
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   112   1e-24
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   111   2e-24
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   111   2e-24
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   110   3e-24
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...   110   3e-24
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   110   5e-24
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...   109   8e-24
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   108   2e-23
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...   108   2e-23
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   108   2e-23
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   107   2e-23
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   107   4e-23
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   107   4e-23
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   107   5e-23
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...   106   8e-23
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...   105   1e-22
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   105   2e-22
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   105   2e-22
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...   105   2e-22
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   105   2e-22
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   104   3e-22
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   103   5e-22
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   103   6e-22
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...   102   1e-21
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   102   1e-21
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   102   2e-21
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   102   2e-21
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...   101   3e-21
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...   100   4e-21
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...   100   4e-21
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   100   8e-21
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...    99   2e-20
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...    97   5e-20
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...    96   1e-19
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...    96   2e-19
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...    94   5e-19
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    92   3e-18
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    91   6e-18
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...    86   3e-16
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...    82   3e-15
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    73   2e-12
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    72   3e-12
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    72   3e-12
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    72   4e-12
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    71   1e-11
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    70   2e-11
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    64   1e-09
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    63   3e-09
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    61   1e-08
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    60   2e-08
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     60   2e-08
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    60   2e-08
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    59   6e-08
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    58   8e-08
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    49   4e-05
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    48   1e-04
KAFR0B00590 Chr2 complement(117951..121736) [3786 bp, 1261 aa] {...    40   0.042
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     38   0.12 
TBLA0B05100 Chr2 complement(1199537..1200772) [1236 bp, 411 aa] ...    35   0.92 
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    35   1.4  
ZYRO0G04444g Chr7 complement(355149..358784) [3636 bp, 1211 aa] ...    35   1.7  
Ecym_6476 Chr6 (921068..923620) [2553 bp, 850 aa] {ON} similar t...    34   2.5  
Smik_2.67 Chr2 complement(121714..125847) [4134 bp, 1377 aa] {ON...    33   3.1  
Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON...    33   5.8  
KLTH0C02486g Chr3 complement(217025..224428) [7404 bp, 2467 aa] ...    33   6.5  
KAFR0C03650 Chr3 complement(744293..744931) [639 bp, 212 aa] {ON...    32   7.2  
TBLA0J01910 Chr10 (448704..454556) [5853 bp, 1950 aa] {ON} Anc_7...    32   7.9  
YBL047C Chr2 complement(127895..132040) [4146 bp, 1381 aa] {ON} ...    32   8.4  
KNAG0E02200 Chr5 complement(442946..447022) [4077 bp, 1358 aa] {...    32   8.6  
Skud_2.55 Chr2 complement(111625..115797) [4173 bp, 1390 aa] {ON...    32   9.8  

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score = 2006 bits (5197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 974/974 (100%), Positives = 974/974 (100%)

Query: 1   MGSSPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGI 60
           MGSSPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGI
Sbjct: 1   MGSSPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGI 60

Query: 61  TAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTG 120
           TAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTG
Sbjct: 61  TAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTG 120

Query: 121 DEKLYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSS 180
           DEKLYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSS
Sbjct: 121 DEKLYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSS 180

Query: 181 MRKLRIYDSGSGSNSNSGSRKNSRNNSPKLVTDPMINRRRMRTVPLSSSLAKQQHQWQQR 240
           MRKLRIYDSGSGSNSNSGSRKNSRNNSPKLVTDPMINRRRMRTVPLSSSLAKQQHQWQQR
Sbjct: 181 MRKLRIYDSGSGSNSNSGSRKNSRNNSPKLVTDPMINRRRMRTVPLSSSLAKQQHQWQQR 240

Query: 241 REQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKG 300
           REQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKG
Sbjct: 241 REQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKG 300

Query: 301 LRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGAQHQR 360
           LRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGAQHQR
Sbjct: 301 LRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGAQHQR 360

Query: 361 AKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKI 420
           AKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKI
Sbjct: 361 AKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKI 420

Query: 421 NSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMS 480
           NSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMS
Sbjct: 421 NSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMS 480

Query: 481 QDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVM 540
           QDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVM
Sbjct: 481 QDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVM 540

Query: 541 SGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQEFLQF 600
           SGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQEFLQF
Sbjct: 541 SGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQEFLQF 600

Query: 601 RQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYKDWIE 660
           RQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYKDWIE
Sbjct: 601 RQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYKDWIE 660

Query: 661 KILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKNNHEE 720
           KILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKNNHEE
Sbjct: 661 KILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKNNHEE 720

Query: 721 VLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQLFEP 780
           VLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQLFEP
Sbjct: 721 VLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQLFEP 780

Query: 781 QRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKDEVKGYED 840
           QRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKDEVKGYED
Sbjct: 781 QRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKDEVKGYED 840

Query: 841 ASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIRNTIASENST 900
           ASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIRNTIASENST
Sbjct: 841 ASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIRNTIASENST 900

Query: 901 LHQNKIATTPPLGQNSERSPLKPTVLQPNQLPENWRYGLRSPPKDQLSKSNGELKRHQDN 960
           LHQNKIATTPPLGQNSERSPLKPTVLQPNQLPENWRYGLRSPPKDQLSKSNGELKRHQDN
Sbjct: 901 LHQNKIATTPPLGQNSERSPLKPTVLQPNQLPENWRYGLRSPPKDQLSKSNGELKRHQDN 960

Query: 961 ETLEENVNKISRLE 974
           ETLEENVNKISRLE
Sbjct: 961 ETLEENVNKISRLE 974

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score = 1105 bits (2859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/998 (59%), Positives = 726/998 (72%), Gaps = 70/998 (7%)

Query: 1   MGSSPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGI 60
           M + P   GED EELNITVAVR RGRNEREI+AKSSVVVSVPDV GS+EV+INTT DVGI
Sbjct: 1   MVAMPQASGEDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGI 60

Query: 61  TAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTG 120
           TAQ+NSKTY VD+VFGPSANQ L+F++IAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTG
Sbjct: 61  TAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTG 120

Query: 121 DEKLYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSS 180
           DEKLY+ ELS+SAGIIPRILFKLFETL+L+ EDYVVKCSFVELYNEELKDLL DS E +S
Sbjct: 121 DEKLYDGELSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIAS 180

Query: 181 MRKLRIYDSGSGSNS-NSGSRKNS--------RNNSPKLVTDPMINRRRMRTVPLSSSLA 231
            RKLRI+DS + S + NS S  NS          +S +L T   + R+R +T P  +   
Sbjct: 181 SRKLRIFDSNTMSAATNSMSTGNSTKNSRNNSPRSSSELPTATFL-RKRWKTAPSVT--- 236

Query: 232 KQQHQWQQRREQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSAR 291
                      Q HQ                        QD  +G+YIQNLQDFHIT+A+
Sbjct: 237 -----------QSHQ----------------------NSQDQNAGIYIQNLQDFHITNAK 263

Query: 292 DGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENI 351
           +G++LLQKGL++RQVATTKMNDFSSRSHTIFTITLY+E+ GE+F+VSKMNLVDLAGSENI
Sbjct: 264 EGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSENI 323

Query: 352 SRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTAL 411
           SRSGAQHQRAKEAGSINQSLLTLGRVINSL DKS HVPFRESKLTRLLQDSLGGNTKTAL
Sbjct: 324 SRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTAL 383

Query: 412 IATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLST 471
           IATISPAKINSEETCSTLQYA+KAKNIKN+PQL S IMKDILVKNIT ELAK+K+DLLST
Sbjct: 384 IATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLST 443

Query: 472 KLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRI 531
           K +EG+YMSQDNYKE+TNDLESYKTE++E KR IE L+SQN+LLLKDKKASNEVN+LQRI
Sbjct: 444 KSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRI 503

Query: 532 KLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQM 591
           KLQNM+D MS L  K E Q+K+EQ LV     LK+T+   QS+IKE+ +RE+ I  +M  
Sbjct: 504 KLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGD 563

Query: 592 ILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRA 651
           +   EF + +Q +++NI DI       +I       G+Q N++ +R E+ +LL  AQ++ 
Sbjct: 564 LFNNEFARVKQTILSNIRDIEQQIDWENI-------GVQGNIDSIRGEISKLLERAQQQT 616

Query: 652 EKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFND 711
           + MYKD +EKIL+E P  FQ  + KV +VE  + T H+ LTENLSD+SE +NNL+QY ND
Sbjct: 617 DDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLND 676

Query: 712 HFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAI 771
           HFFKNNHEE+L SHID+TY  +Q SAD L Q+FK+MMD+HL+ NK LM++SL++AT + I
Sbjct: 677 HFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVI 736

Query: 772 DKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKV 831
            KEMQLFEPQ+KKWE+SF  IN CDSI+  F   ++S L  IKST GSS + I+++++KV
Sbjct: 737 RKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLGSSQEAINKTITKV 796

Query: 832 KDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIR 891
           K+++  +E  +++L  + V   Q + I+NK S L   L KS+  +  H  A D+LKE I 
Sbjct: 797 KEQMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSDHADAVDKLKEAID 856

Query: 892 NTIASENSTLHQNKIATTPPL-----GQN---SERSPLKPTVLQPNQLPEN-------WR 936
           + ++   S++   ++     +      QN    +RSPL+P   + N+   N        +
Sbjct: 857 HVVSERGSSMEGERVEHVDGILRRMDEQNLLYLDRSPLRPANFKMNKSERNSPNRSSPCK 916

Query: 937 YGLRSPPKDQLSKSNGELKRHQD--NETLEENVNKISR 972
               SP K  +       KR     N+  EE +NK+SR
Sbjct: 917 SVSHSPCKQPVCHPRINYKRSLTDLNDGQEEGLNKLSR 954

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
            Anc_6.16
          Length = 1069

 Score =  976 bits (2524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/985 (52%), Positives = 690/985 (70%), Gaps = 65/985 (6%)

Query: 15   LNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKV 74
            LNITVAVR RGRNEREI+ KSSV+V+VPD+ GS+EV+INTTDDVGITAQMNSKTY VDKV
Sbjct: 52   LNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKV 111

Query: 75   FGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDSAG 134
            FGPSANQQLIF E+AEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLYN ELS+SAG
Sbjct: 112  FGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAG 171

Query: 135  IIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRK-----LRIYDS 189
            IIPRILFKLF+TL++  EDYVVKCSF+ELYNE+LKDLL+D+  + +  K     LRI+DS
Sbjct: 172  IIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLNDNNNSINNSKSNINKLRIFDS 231

Query: 190  GSGSN-----SNSGSRKNSRNNSPKL--------VTDPMINRRRMR-------------T 223
             + SN     SN+ SR NSRNNSP+L         T+    RR+++             T
Sbjct: 232  STASNVNVPGSNASSRANSRNNSPRLNPSTSNVGTTNNNYLRRKLKSSRYSNPENSNIFT 291

Query: 224  VPLSSSLAKQQHQ--WQQRREQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQN 281
               SSS+            + Q   L           +      +   Q D+ +G+YIQN
Sbjct: 292  SNASSSVKNMTKNSFLSNSKNQTSNLNTNSNTRTNPPKLPTSSLETPPQDDNNNGIYIQN 351

Query: 282  LQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMN 341
            LQ+FHI++A++GL LLQKGL+ RQVA+TKMNDFSSRSHTIFTITLY+EHQG +F++SKMN
Sbjct: 352  LQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFRLSKMN 411

Query: 342  LVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQD 401
            LVDLAGSENI+RSGA +QRAKE GSINQSLLTLGRVINSLAD++ H+PFRESKLTRLLQD
Sbjct: 412  LVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFRESKLTRLLQD 471

Query: 402  SLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAEL 461
            SLGGNTKTALIATISPAK+ SEETCSTL+YASKAKNIKN+PQL S I KDIL+KNIT EL
Sbjct: 472  SLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKDILLKNITTEL 531

Query: 462  AKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKA 521
            ++VKSDLLSTK +EG+YMSQ++Y+++ N+L+++KTE  ESKRIIERLSSQN+LLLKDK+ 
Sbjct: 532  SQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQNALLLKDKRT 591

Query: 522  SNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQR 581
            SNEVNELQRIKL   +D ++ L EK+E Q+ KEQ LV     L+++    + +I+ Y  +
Sbjct: 592  SNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTFKKMIENYECQ 651

Query: 582  EKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVV 641
            +  +  +++ IL  + L  R +L ++   I+T +SG D         I  NL++++ EV+
Sbjct: 652  QIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDF-------DIGSNLDMIQNEVI 704

Query: 642  ELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEG 701
            ++LG  Q++AEK YK +IE  L++ P  F+ I   ++ + + +  +H  + +NLSDISE 
Sbjct: 705  KMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDISEE 764

Query: 702  YNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMK 761
            YNNLKQY N++ F+NNHE+++N+HI+ T Q L  SAD L   FK MM+ HL+ N+ LM+ 
Sbjct: 765  YNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRNLMLN 824

Query: 762  SLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSST 821
            S ++AT E I+KEM+LF P++KKWEES DLIN CDS++NGF  ++   LS  +S   +S 
Sbjct: 825  SFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKITASI 884

Query: 822  DVISRSVSKVKDEVK----GYEDAST--ILDGNEVVKRQIADIINKDSSLRNGLYKSIKS 875
            + +  + +++K E+     GY   +T  +++ N++++ Q  ++  K+S  ++ +  S+K 
Sbjct: 885  NQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVENSLKC 944

Query: 876  SQGHISAFDELKERIRNTIASENSTLHQNKIATTPPLG--------QNSERSPLKPTVLQ 927
            +   ++  + L++ I+  +          +I   P  G        +N +  P KP  LQ
Sbjct: 945  AVASVNNLNHLEDSIKMAV-------RDTRIKGGPTEGEVGVPFKKENGKEGPTKPG-LQ 996

Query: 928  PNQLPENWRYGLRSPPKDQLSKSNG 952
            P Q P N  +   +  +DQ   +NG
Sbjct: 997  PLQ-PTNEIF--LNSQQDQQHTTNG 1018

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
           CIN8Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 1000

 Score =  946 bits (2444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/945 (53%), Positives = 667/945 (70%), Gaps = 36/945 (3%)

Query: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72
           EELNITVAVR RGRNEREI  KSSVVV+VPD+ GS E++INTT D GITAQMN+K Y VD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132
           KVFGP A+Q LIF E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLYN ELSD+
Sbjct: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152

Query: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSS--------MRKL 184
           AGIIPR+L KLF+TL+L+  DYVVKCSF+ELYNEELKDLLD +   SS        M+KL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDSNSNGSSNTGFDGQFMKKL 212

Query: 185 RIYDSGSGSNSNSGSRKNSRNNSPK--------LVTDPMINRRRMRTVPLSSSL---AKQ 233
           RI+DS + +N+ S S  +SR+NS          L     + R+R+RT  L +++    +Q
Sbjct: 213 RIFDSSTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPNTIKQQYQQ 272

Query: 234 QHQWQQRREQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDG 293
           Q     R                       Q+      D  +G+YIQNLQ+FHIT+A +G
Sbjct: 273 QQAVNSRNNSSSNSGSTTNNASSNTNTNNGQRSSMAPNDQTNGIYIQNLQEFHITNAMEG 332

Query: 294 LQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISR 353
           L LLQKGL++RQVA+TKMNDFSSRSHTIFTITLY++HQ E+F++SKMNLVDLAGSENI+R
Sbjct: 333 LNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINR 392

Query: 354 SGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIA 413
           SGA +QRAKEAGSINQSLLTLGRVIN+L DKS H+PFRESKLTRLLQDSLGGNTKTALIA
Sbjct: 393 SGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIA 452

Query: 414 TISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKL 473
           TISPAK+ SEETCSTL+YASKAKNIKN+PQL SFIMKDILVKNIT ELAK+KSDLLSTK 
Sbjct: 453 TISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILVKNITMELAKIKSDLLSTKS 512

Query: 474 REGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKL 533
           +EG+YMSQD+YK + +DLESYK E+QE KR IE L+S+N+LL+KDK  S E  + Q  ++
Sbjct: 513 KEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSKNALLVKDKLKSKETIQSQNCQI 572

Query: 534 QNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMIL 593
           +++K  +  L  +L+ QHK E E+ D    L+    + Q  + +Y +RE  ++++ +M +
Sbjct: 573 ESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEVMQMALHDYKKRELDLNQKFEMHI 632

Query: 594 GQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEK 653
            +E  + +  L   +  ++       IL E     IQ NL++++ EV+ L+   Q++AE 
Sbjct: 633 TKEIKKLKSTLFLQLNTMQQ----ESILQE---TNIQPNLDMIKNEVLTLMRTMQEKAEL 685

Query: 654 MYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHF 713
           MYKD ++KIL E+P  F  +  K+D + V    +++ + ENLSDISE  NN+KQY  +HF
Sbjct: 686 MYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSDISEENNNMKQYLKNHF 745

Query: 714 FKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDK 773
           FKNNH+E+LN H+D TY+ ++   +  ++ FK++++DHL +NK L+M++L +AT+  ID+
Sbjct: 746 FKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKKLIMQNLTTATSAVIDQ 805

Query: 774 EMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKD 833
           EM LFEP+R KWE SFDLIN+CDS++N F   M + LS IKST  +S++ ++ S+S +K 
Sbjct: 806 EMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTVDTSSNSMNESISVMKG 865

Query: 834 EVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIRNT 893
           +V+  E+A ++L  N     Q   +INK + L++ +  SI S+  HI+  D++   I N 
Sbjct: 866 QVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITSTHSHITNVDDIYNTIENI 925

Query: 894 IAS----ENST---LHQNKIATTPPLGQNSERSPLKPTVLQPNQL 931
           + +    EN+T   + +N +   P L   S++ PL+ + +  N +
Sbjct: 926 MKNYGNKENATKDEMIENILKEIPNL---SKKMPLRLSNINSNSV 967

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
           YEL061C (REAL)
          Length = 1002

 Score =  939 bits (2428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/938 (53%), Positives = 668/938 (71%), Gaps = 38/938 (4%)

Query: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72
           EELNITVAVR RGRNEREI  KSSVVV+VPD+ GS E++INTT D GITAQMN+K Y VD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132
           KVFGP A+Q LIF E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLYN ELSDS
Sbjct: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152

Query: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDD--------SVENSSMRKL 184
           AGIIPR+L KLF+TL+L+  DYVVKCSF+ELYNEELKDLLD+          +   M+KL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNSSSNNGFDGQFMKKL 212

Query: 185 RIYDSGSGSNSNSGSRKNSRNNSPK--------LVTDPMINRRRMRTVPLSSSLAKQQHQ 236
           RI+DS + +N+ S S  +SR++S          L     + RRR+RT  L +++ +QQ  
Sbjct: 213 RIFDSSTANNTTSNSASSSRSSSRNSSPRSLNDLTPKAALLRRRLRTKSLPNTIKQQQQH 272

Query: 237 WQQRREQQHQLREQQQREQQAQQQQKEQQQREQQQ-----DSPSGVYIQNLQDFHITSAR 291
            QQ+                            Q+      D  +G+YIQNLQ+FHIT+A 
Sbjct: 273 QQQQTMNSRNNSSSNSGSATNNISSDTNNNNGQRNSLAPNDQSNGIYIQNLQEFHITNAM 332

Query: 292 DGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENI 351
           +GL+LLQKGL++RQVA+TKMNDFSSRSHTIFTITLY++HQ E+F++SKMNLVDLAGSENI
Sbjct: 333 EGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENI 392

Query: 352 SRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTAL 411
           +RSGA +QRAKEAGSINQSLLTLGRVIN+L DKS H+PFRESKLTRLLQDSLGGNTKTAL
Sbjct: 393 NRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKLTRLLQDSLGGNTKTAL 452

Query: 412 IATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLST 471
           IATISPAK+ SEETCSTL+YASKAKNIKN+PQL +FIMKDILVKNIT ELAK+KSDLLST
Sbjct: 453 IATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLST 512

Query: 472 KLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRI 531
           K +EG+YM+QD+YK + +DLESYK E+QE KR IE L+S+NSLL+K+K  S E  + Q  
Sbjct: 513 KSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTSKNSLLVKEKLKSKETIQSQNS 572

Query: 532 KLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQM 591
           +++++K  +  L  +L+ QHK E E+      L+    + Q  +++Y +RE  ++++ + 
Sbjct: 573 QIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEVMQMALQDYKRRELDLNKKFET 632

Query: 592 ILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRA 651
            +  E    +  L + +  ++      +IL E +   IQ NL++++ EV+ L+   Q++A
Sbjct: 633 HITTEIKNMKTTLFSQLSTLQQ----RNILQETD---IQPNLDIIKNEVLTLMETMQEKA 685

Query: 652 EKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFND 711
           E MYKD ++KIL E+P  F AI  K+D + V    +++ + ENLSDISE  NNLKQYF +
Sbjct: 686 ELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSDISEENNNLKQYFTN 745

Query: 712 HFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAI 771
           HFF+NNH+E+L+ H+D TY++++   +  ++ FK+ ++DHL++NK L+MK+L + T+  I
Sbjct: 746 HFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKKLIMKNLTTTTSAVI 805

Query: 772 DKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKV 831
           D+EM LFEP+R KWE SFDLIN CDS++N F   M + LS IKST  +S++ +++S+S +
Sbjct: 806 DQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKSTVDTSSNSMNKSISVM 865

Query: 832 KDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELK---E 888
           K +V+  E+A ++L  N     Q   +INK + L++ +  SI S+  HI+  D++    E
Sbjct: 866 KGQVEESENAISLLKNNIKFNDQFKQLINKHTILKDNIESSITSTNSHITNIDDIYNTIE 925

Query: 889 RIRNTIAS-ENST---LHQNKIATTPPLGQNSERSPLK 922
           +I N   + EN+T   + +N +   P L   S+R PL+
Sbjct: 926 KIMNNYGNKENATKDEMIENLLNEIPNL---SKRMPLR 960

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score =  938 bits (2425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/962 (52%), Positives = 679/962 (70%), Gaps = 41/962 (4%)

Query: 10  EDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTY 69
           E+ +ELNITV+VR RGRNEREI+AKSSVVV+VPDV GS+EV+INTTD++GITAQMNSKTY
Sbjct: 12  ENGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTY 71

Query: 70  AVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDEL 129
            VDKVFGPSA+Q LIFK+IAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDE+LY+ EL
Sbjct: 72  TVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGEL 131

Query: 130 SDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYDS 189
           SD+AGIIPRILFKLF+TL+ +DEDY+VKCSF+ELYNEELKDLL++  E+  ++KLRI+DS
Sbjct: 132 SDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKLRIFDS 191

Query: 190 GSGSNSNSGSRKNSRNNSPKLVTDPMINRRRMRT-VPLSSSLAKQQHQWQQRREQQHQLR 248
              + ++S SR NSRNNSP LV      +R  +T VP       QQH  QQ+++Q   + 
Sbjct: 192 ---NTTSSNSRNNSRNNSPNLVGTSGTFKRIFKTPVPYKQQQQHQQHLQQQQQQQPRLIN 248

Query: 249 EQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVAT 308
            +QQ                   +  S +YIQNLQ+FHIT+A+DG+ LLQ+GL++RQVA+
Sbjct: 249 NKQQ----------------SLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVAS 292

Query: 309 TKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSIN 368
           TKMNDFSSRSHTIFTI LY+ H GE+F+VSKMNLVDLAGSENISRSGAQ+QRAKEAGSIN
Sbjct: 293 TKMNDFSSRSHTIFTIMLYKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSIN 352

Query: 369 QSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCST 428
           QSLLTLGRVINSLADK+AH+PFRESKLTRLLQDSLGGNTKTALIATISPAKIN+EET ST
Sbjct: 353 QSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSST 412

Query: 429 LQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEIT 488
           L+YA+KAKNIKN+PQL + +MKDILVKNIT ELAK+KSD LSTK ++G+YM+QD+YKE+T
Sbjct: 413 LEYATKAKNIKNKPQLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELT 472

Query: 489 NDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLE 548
           +DLE+YKTE+QE KR IE+++SQN LLLKDK+AS+EV+ELQRIK++++ D ++ L +K++
Sbjct: 473 SDLENYKTEVQECKREIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMD 532

Query: 549 SQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNI 608
            QHK EQ+LV     LK  +   Q+ +K     + Q    M+ +L      F+Q +   +
Sbjct: 533 KQHKNEQDLVCTIHTLKDAIYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQL 592

Query: 609 EDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPT 668
             ++ +HS   +       GI  N++++++E+ ++L      +  + +  +EKILE  P 
Sbjct: 593 AAMKASHSSRHL-------GIDGNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPK 645

Query: 669 VFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDK 728
            F++I   +  +   V++Y   L +NL DISE YNN ++Y N+H FKNNHEE L+ H+DK
Sbjct: 646 HFESIRRDLLDISTVVDSYSNELVKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDK 705

Query: 729 TYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEES 788
           TY  L+ SA  L  KFK+MMD HL++NK+LM+KSL++A+ E + KE++LF P ++KWE S
Sbjct: 706 TYHMLKKSAGELFSKFKEMMDSHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESS 765

Query: 789 FDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGN 848
            + IN CDS++N F+  ++ AL  ++     S +    +   VKD +K ++  S +L  N
Sbjct: 766 LENINKCDSLNNTFDSTVKDALRRLEGNIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNN 825

Query: 849 EVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIRNTIASE----------- 897
             V   I ++  K + LR+ + ++    +     F+ + + IR  I  +           
Sbjct: 826 TKVVNNINEVKEKHTFLRDQVERTSSYIEAANEKFEGIDQFIRQIIDKKLPTHLVGNGEL 885

Query: 898 -NSTLHQNKIATTPPLGQNSERSPLKPTVLQPNQLPENWRYGLRSPPKDQLSKSNGELKR 956
            N  L Q       P+G  S R+P   +V     L  N   G+ SP K ++ ++  +  +
Sbjct: 886 VNVMLEQLGKTHLKPIGSAS-RTPSSRSVSPMKTLDNNIFNGI-SPSKRKVDETENDRSK 943

Query: 957 HQ 958
            Q
Sbjct: 944 SQ 945

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/933 (52%), Positives = 667/933 (71%), Gaps = 34/933 (3%)

Query: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72
           EELNITVAVR RGRNEREI  KSSVVV+VPD+ GS EV+INTT D GITAQMN+K Y VD
Sbjct: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 94

Query: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132
           KVFGP A+Q LIF+E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLYN EL+D+
Sbjct: 95  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 154

Query: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDS--------VENSSMRKL 184
           AGIIPR+L KLF+TL+L+  DYVVKCSF+ELYNEELKDLLD++         +   M+KL
Sbjct: 155 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEELKDLLDNNSNGSSNNGFDGQFMKKL 214

Query: 185 RIYDSGSGSNSNSGSRKNSRNNSPK--------LVTDPMINRRRMRTVPLSSSLAKQQHQ 236
           RI+DS + +N+ S S  +SR+NS          L     + R+R+RT  L +++ KQQ Q
Sbjct: 215 RIFDSSTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPNTI-KQQQQ 273

Query: 237 WQQRREQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQL 296
            Q    + +           +      Q+    Q D  +G+YIQNLQ+FHIT+A +GL L
Sbjct: 274 QQAMNSRNNSSSNSGSAANNSSSNTNGQRSPMTQNDQSNGIYIQNLQEFHITNALEGLNL 333

Query: 297 LQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGA 356
           LQ+GL++RQVA+TKMNDFSSRSHTIFTITLY++HQ E+F++SKMNLVDLAGSENI+RSGA
Sbjct: 334 LQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGA 393

Query: 357 QHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATIS 416
            +QRAKEAGSINQSLLTLGRVIN+L D+S H+PFRESKLTRLLQDSLGGNTKTALIATIS
Sbjct: 394 LNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATIS 453

Query: 417 PAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREG 476
           PAK+ SEETCSTL+YASKAKNIKN+PQL +F+MKDILVKNIT ELAK+KSDLLSTK +EG
Sbjct: 454 PAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEG 513

Query: 477 VYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNM 536
           +YMSQD+YK + +DLES+K E+QE KR IE L+S+NSLL+KDK  S E  + Q  +++++
Sbjct: 514 IYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESL 573

Query: 537 KDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQE 596
           K  ++ L  +L+ QHK E E+      L+    + Q  +++Y +RE  ++++ +  + +E
Sbjct: 574 KATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKE 633

Query: 597 FLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYK 656
               +  L   +++++      +I  E +   IQ NL++++ EV+ L+   Q++AE MYK
Sbjct: 634 IKSLKTALFLQLDNMQQ----KNIFQETD---IQPNLDMVKNEVLTLMETMQEKAELMYK 686

Query: 657 DWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKN 716
           D ++KIL E+P  F  I  K+D + +    +++ + ENLSDISE  NNLKQY  +HFFKN
Sbjct: 687 DCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKN 746

Query: 717 NHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQ 776
           NH+E+LN HID TY+ ++   +  ++ FK  ++DHL++NK L+M+++ +AT+  ID+EM 
Sbjct: 747 NHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMD 806

Query: 777 LFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKDEVK 836
           LFEP+R KWE SFDLIN CDS++N F  +M + LS IK T  +S++ ++ S+S +K +V+
Sbjct: 807 LFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVE 866

Query: 837 GYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIRNTIAS 896
             E+A ++L  N     Q   +I+K   L++ +  SI S+  HI+  D++   I + + +
Sbjct: 867 ESENAISLLKNNTKFNDQFKQLISKHIILKDNIESSITSTHSHITNVDDIYNTIEDIMTN 926

Query: 897 ----ENST---LHQNKIATTPPLGQNSERSPLK 922
               EN+T   +  N +   P L   S+R PL+
Sbjct: 927 HGNKENATKDEMIDNILKEIPNL---SKRLPLR 956

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score =  924 bits (2387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/940 (53%), Positives = 667/940 (70%), Gaps = 37/940 (3%)

Query: 9   GEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKT 68
           G   EELNITVAVR RGRNEREI  KSSVVV+VPD+ GS EV+INTT D GITAQMN+K 
Sbjct: 29  GVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKR 88

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           Y VDKVFGP A+Q LIF E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLYN E
Sbjct: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148

Query: 129 LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDD--------SVENSS 180
           LSD+AGIIPR+L KLF+TL+L+  DYVVKCSF+ELYNEELKDLLD+          E   
Sbjct: 149 LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPF 208

Query: 181 MRKLRIYDSGSGSNSNSGSRKNSRNNSPK--------LVTDPMINRRRMRTVPLSSSLAK 232
           M+KLRI+DS + +N+ S S  +SR+NS          L     + R+R+RT  L +++ K
Sbjct: 209 MKKLRIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPNTI-K 267

Query: 233 QQHQWQQRREQQHQLREQQQREQQAQ---QQQKEQQQREQQQDSPSGVYIQNLQDFHITS 289
           QQHQ Q    + +                     Q+      D  +G+YIQNLQ+FHIT+
Sbjct: 268 QQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQEFHITN 327

Query: 290 ARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSE 349
           A +GL LLQ+GL++RQVA+TKMNDFSSRSHTIFTITLY++HQ E+F++SKMNLVDLAGSE
Sbjct: 328 AMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSE 387

Query: 350 NISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKT 409
           NI+RSGA +QRAKEAGSINQSLLTLGRVIN+LADKS H+PFRESKLTRLLQDSLGGNTKT
Sbjct: 388 NINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKT 447

Query: 410 ALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLL 469
           ALIATISPAK+ SEETCSTL+YASKAKNIKN+PQL +FIMKDILVKNIT ELAK+KSDLL
Sbjct: 448 ALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLL 507

Query: 470 STKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQ 529
           STK +EG+YMSQD+YK + +DLESYK E+QE KR IE LSS+NSLLLKDK  S +  + Q
Sbjct: 508 STKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLKDKLKSKDTIQSQ 567

Query: 530 RIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERM 589
             +++++K  ++ L  +L+ QHK E E+      L+    + Q  +++Y +RE  ++++ 
Sbjct: 568 NSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKF 627

Query: 590 QMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQK 649
           +  + +E    +  L + +  +  N+         ++  IQ NL++++ EV+ L+   Q+
Sbjct: 628 ETHISKEIKSLKTTLFSQLSGMEQNNI-------SQETNIQPNLDIIKNEVLTLMETMQE 680

Query: 650 RAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYF 709
           +AE MYKD ++KIL E+P  F  I  K+D + V    ++  + ENLSDISE  NNLKQY 
Sbjct: 681 KAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYL 740

Query: 710 NDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTE 769
            +HFFKNNH+E+LN HID TY+ ++      ++ FK  ++DHL++NK L+M++L +AT+ 
Sbjct: 741 KNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSA 800

Query: 770 AIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVS 829
            I++EM LFEP+R KWE SFDLIN CDS++N F  +M + LS IK+T  +S++ +++S+S
Sbjct: 801 VINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSIS 860

Query: 830 KVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKER 889
            +K +V+  E+A ++L  N+    Q   ++NK + L++ +  SI S+  HI+  D++ + 
Sbjct: 861 VMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNIENSITSTHSHITNIDDIYDT 920

Query: 890 IRNTIAS----ENSTLHQ---NKIATTPPLGQNSERSPLK 922
           I N + +    EN+  ++   N +   P L   S+R PL+
Sbjct: 921 IENIMKNYGNKENAVKNEMIDNILKEIPSL---SKRVPLR 957

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
            Anc_6.16
          Length = 1004

 Score =  922 bits (2382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/1012 (51%), Positives = 680/1012 (67%), Gaps = 81/1012 (8%)

Query: 10   EDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTY 69
            E+  ELNITVAVR RGRNEREI +KS VVV+VPD+ G+ E++INTT + GITAQMNSKTY
Sbjct: 24   EEDTELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGITAQMNSKTY 83

Query: 70   AVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE- 128
             VDKVFGP+A+Q LIF+E+AEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY +  
Sbjct: 84   TVDKVFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDEKLYQNGT 143

Query: 129  -LSDSAGIIPRILFKLFETLDLR--------DEDYVVKCSFVELYNEELKDLLD-DSVEN 178
             LSD+AGIIPRILFKLF+TLD            D+VVKCSFVELYNE+LKDLL+ DS + 
Sbjct: 144  MLSDAAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDLLNYDSNDE 203

Query: 179  SSM------RKLRIYDSGSGSNSNSGSRKNSRNNSPKLVTDPMINRRRMRTVPLSSSLAK 232
                     RKLRI+DS + +N+NS S  +SR                    P +SS+  
Sbjct: 204  QQQQQQLGSRKLRIFDSTNNNNNNSNSNASSR-------------ASSRNNSPRTSSILP 250

Query: 233  QQHQWQQRREQQHQLREQQQREQQAQQQQKEQQQREQQQDSPS----------GVYIQNL 282
              +       ++  +R       +A+        R    D PS          G+YIQNL
Sbjct: 251  NANATNLAMRKK-SIRYNYNSNNKAKSSN---NTRPNTNDEPSSIAGPDENTNGIYIQNL 306

Query: 283  QDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNL 342
            Q+FHIT+A++GL LLQKGL++RQVA+TKMNDFSSRSHTIFTITLY+EH+  +F++SKMNL
Sbjct: 307  QEFHITNAKEGLSLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKEHKDNLFRLSKMNL 366

Query: 343  VDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDS 402
            VDLAGSENI+RSGA +QRAKE GSINQSLLTLGRVINSLADKS HVPFRESKLTRLLQDS
Sbjct: 367  VDLAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADKSPHVPFRESKLTRLLQDS 426

Query: 403  LGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELA 462
            LGGNTKTALIATISPAK+ SEETCSTL+YASKAKNIKN+PQL S I+KDIL+KNIT+ELA
Sbjct: 427  LGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSVILKDILLKNITSELA 486

Query: 463  KVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKAS 522
            KVKSDL+STK ++G+YMS ++Y+E+  +LES KTE+QESKR+IE+LSSQNS+LLKDK+++
Sbjct: 487  KVKSDLMSTKSKDGIYMSHEHYQELIMELESSKTEVQESKRMIEKLSSQNSMLLKDKRSA 546

Query: 523  NEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQRE 582
            NEVNELQRIKL N+KD MS L+EKLE Q+ KE +L++    L+ +     S++K Y  ++
Sbjct: 547  NEVNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQLEKSREKLNSLVKNYQTKQ 606

Query: 583  KQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQN-GIQQNLNVLRQEVV 641
             Q+  ++  IL +   + +++L          +S  D + + E N  ++ NL V++ E+ 
Sbjct: 607  SQLKTQISNILNENLFELKKIL----------NSHKDAIRQSEGNFDVEMNLKVIKDEIT 656

Query: 642  ELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEG 701
             +L   Q + E MYK++IE+ LE+ P   Q I   V QVE  V  Y+  +TENLSDISE 
Sbjct: 657  SMLEKTQHKTEMMYKEFIEEFLEQTPINLQKIFEHVTQVEFMVTGYYNEITENLSDISEE 716

Query: 702  YNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMK 761
            YNNLKQY ++ FF+NNHE++LN HI+ T   L  S+  L  KFK MMD HL +NK LM+ 
Sbjct: 717  YNNLKQYLDNDFFQNNHEDLLNIHINATSDILAQSSAELFNKFKIMMDAHLMENKKLMID 776

Query: 762  SLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSST 821
            + ++AT + I KEM+LF+P+R KWEES +LIN CDSI+NGF+ +M   +S IK+   SS+
Sbjct: 777  NFRTATNDVITKEMELFKPKRNKWEESIELINRCDSINNGFHHNMTGQVSKIKTNLASSS 836

Query: 822  DVISRSVSKVKDEV-----KGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSS 876
              I  +++ +K +V         D  T L+ + +  +   +II K+  L+     +I  +
Sbjct: 837  SSIHNAIASIKSQVLEQLSNDDSDVKTALENDPMFNKHFNEIIEKNMILQKNRKNAINYT 896

Query: 877  QGHISAFDELKERIRNTIASENSTLHQNKIATT------PPLGQNSERSPLKPT---VLQ 927
               +   DEL E ++  IA  N     + +A T      P     S+  PL+     ++ 
Sbjct: 897  DKSLLNIDELSETVK--IALNNIV---DDVAITDGDDNSPGTKTKSKLRPLRSASQLLIN 951

Query: 928  PNQLPENWRYGLRSPPKDQLSKSNGE-LKRHQDNETLEEN-----VNKISRL 973
             NQ  EN   G+    + +L  SN + LK     + L+EN       KISRL
Sbjct: 952  SNQNKENGVRGI-DVTESKLGNSNSQILKIRSKRKQLDENDGNLASKKISRL 1002

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  884 bits (2283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/947 (50%), Positives = 634/947 (66%), Gaps = 54/947 (5%)

Query: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72
           EELNITVAVR RGRN+REI AKSSVVV+VPD+MGS EVAINT++D+G TAQMNSKTY VD
Sbjct: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74

Query: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132
           KVFGPSA Q LIF EIAEPLF DF+KGYNCT+LVYGMTSTGKTYTMTGDEKLYN+ELSDS
Sbjct: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134

Query: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLL--DDSVENSSMRKLRIYDSG 190
           AGIIPRILFKLFETL+  +ED++VKCSFVELYNEELKDLL  D + +N + +KLRI+DS 
Sbjct: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFDSL 194

Query: 191 SGSNSNSGSRKNSRNNSPKLVTD-PMINRRRMRTVPLSSSLAKQQHQWQQRREQQHQLRE 249
                   SR NSRNNSPK+  +     ++++R    + +L + ++    +R     +R 
Sbjct: 195 G-----RDSRSNSRNNSPKMSNNNTTFLKKKLR----NEALLRSRNIASSKRSSMQTIRN 245

Query: 250 QQQREQQAQQQQK-----------------EQQQREQQQDSPSGVYIQNLQDFHITSARD 292
               +  A                      +  +   Q D  +G+YIQNLQ+FHIT+A++
Sbjct: 246 TTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKE 305

Query: 293 GLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENIS 352
           G++LLQKGL+ RQVA+TKMNDFSSRSHTIFTITL++E +GE+F++SKMNLVDLAGSENI+
Sbjct: 306 GIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENIN 365

Query: 353 RSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALI 412
           RSGA +QRAKEAGSINQSLLTLGRVINSLADK+ HVPFRESKLTRLLQDSLGGNTKTALI
Sbjct: 366 RSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALI 425

Query: 413 ATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTK 472
           ATISPAK+  EETCSTL+YASKAKNIKN+PQL SFIMKDIL+KNIT EL K+KSDLLSTK
Sbjct: 426 ATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTK 485

Query: 473 LREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIK 532
            ++G+YM Q +YKE+T DL++YKTEIQE KR IE L+SQN+LLLKDK+  NE NELQRIK
Sbjct: 486 SKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIK 545

Query: 533 LQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMI 592
           +Q M + M  L  K+E Q   E EL         T S    +I E   RE  ++ + + +
Sbjct: 546 IQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTL 605

Query: 593 LGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAE 652
           L        + L   IE+ +      +         + +NL +++ E+  LL  A+   E
Sbjct: 606 LDHSLSYVSKKLNYQIENFKDQGINQNF-------TVDENLQLIKSEMTNLLSTARDNFE 658

Query: 653 KMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDH 712
           K Y++ I K L + P +F  I++ V  ++   + Y+ ++ ENLSD+SE YNN KQ+  D 
Sbjct: 659 KFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDE 718

Query: 713 FF---KNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTE 769
           F+   K +  E+LN +I+ T   ++ S++ ++   + ++++HL+ NK L++ SL + TTE
Sbjct: 719 FYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTE 778

Query: 770 AIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVS 829
            +  E+   +P+  KWEES +LIN  D+++N FN ++ S+++ +      + D I+ ++ 
Sbjct: 779 LMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSINNNIK 838

Query: 830 KVKDEVKGYEDAST---ILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDEL 886
           K+ +  K  + A +   ++D N ++K     I  K+S L   + +    +   +   +EL
Sbjct: 839 KINEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVTNESMKKLNEL 898

Query: 887 KERIRNT---------IASENSTL---HQNKIATTPPLGQNSERSPL 921
              IR           I   NS L   H++    T PL  + +RS L
Sbjct: 899 DTSIRTVLKDIDYEKDIKETNSPLKPSHKHDYNHTIPLDNDKKRSFL 945

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/886 (51%), Positives = 620/886 (69%), Gaps = 42/886 (4%)

Query: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72
           EELNITVAVR RGRNE+E++AKSSVVV+VPDV G++EV+INTT D GITAQ+NSKTY VD
Sbjct: 5   EELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64

Query: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132
           +VFGPSA+Q LIFK IAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDE+LY+ ELS+ 
Sbjct: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124

Query: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYDSGSG 192
           AGIIPR+LFKLF+ LD  ++DY++KCSF+ELYNEELKDLLD++ ++S  RKLRI+DS + 
Sbjct: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFDSVTN 184

Query: 193 SNSNSGSRKNSRNNSPKLVTDPMINRRRMRTVPLSSSLAKQQHQWQQRREQQHQLREQQQ 252
            NS+  S +NS    P+  T     +RR+R     +++ K       +     +L     
Sbjct: 185 PNSSRSSSRNSSPKPPEGSTSG--TKRRIR----PNTMYKPSRSPTVKPTLSSELN---- 234

Query: 253 REQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMN 312
                                 S ++IQNLQ+FHI  A++G++LLQ+GLR+RQVA+TKMN
Sbjct: 235 ----------------------SAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMN 272

Query: 313 DFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLL 372
           D SSRSHTIFTI LYR+  GE F+VSKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLL
Sbjct: 273 DVSSRSHTIFTIMLYRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLL 332

Query: 373 TLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYA 432
           TLGRVINSLADK+AH+PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEET STL+YA
Sbjct: 333 TLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYA 392

Query: 433 SKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLE 492
           +KAKNIKN+PQ+ SFIMKD+LVKN+TAEL K++SDLL+TK ++G+YMSQ+NYKE+TN+LE
Sbjct: 393 TKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELE 452

Query: 493 SYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHK 552
           +YKTE+QE KR IERLS+QN LL K+K+ +NEVNE QR+K++ + + +  L +K++ QHK
Sbjct: 453 NYKTEVQECKRAIERLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHK 512

Query: 553 KEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIR 612
            EQEL ++   L   L   Q+ +K Y  +  +    M+ +L +    F+  L+N IE ++
Sbjct: 513 NEQELSNVVQELMRALRTMQNSLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLK 572

Query: 613 -TNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQ 671
            T   G D         +  N++ L +E+  +         ++ + ++ KI E+ PT  Q
Sbjct: 573 GTEEDGFD---------VDANIDTLTKELNRIYDFINTSTIEICRKFMNKITEQTPTYLQ 623

Query: 672 AISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQ 731
            I N+V+ +   V +Y   L  +LS ISE YN+LK Y N+HFFKNN ++ L+ H+D+TY 
Sbjct: 624 DIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYH 683

Query: 732 QLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDL 791
           QL+ SA+ +  K ++MM++ L+ NK +MM+SL++A +E + KEM L +P ++ WE S + 
Sbjct: 684 QLKVSANSIFLKLREMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESSLEN 743

Query: 792 INNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVV 851
           IN CD +++GF  D+ S + D+             +V     ++  ++DAS  L  ++V+
Sbjct: 744 INECDKLNSGFEKDIGSVVRDVFEKINEGLQFSESAVGDANLDLSRFQDASRALRTDDVI 803

Query: 852 KRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIRNTIASE 897
              I +I  K + L+  +  S    +     F E+ + I+  + S+
Sbjct: 804 PGSIEEIKKKHNMLKLKVQDSASYMEAATQKFGEIDDSIQGLLNSQ 849

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  881 bits (2276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/907 (53%), Positives = 654/907 (72%), Gaps = 30/907 (3%)

Query: 4   SPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQ 63
           S   G  + +ELNITVAVR RGRNE+EI+AKSSVVV+ PDV+G++EV+INT+ D+GITA+
Sbjct: 2   SATNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITAR 61

Query: 64  MNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEK 123
           MNSKTY VDKVFGPSA+Q L+FKEIA+P+F DF+KGYNCT+LVYGMTSTGKTYTMTGDEK
Sbjct: 62  MNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEK 121

Query: 124 LYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVEN--SSM 181
           LY+ ELS++AGIIPR+LFKLF+TL++++ DY+VKCSF+ELYNEELKDLLDD  ++  ++ 
Sbjct: 122 LYDGELSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNS 181

Query: 182 RKLRIYDSGSGSNSNSGSRKNSRNNSPKLVTDPMIN---RRRMRTVPLSSSLAKQQHQWQ 238
           RKLRIYDS + SN+ +     S + S      P +N   +RR+R    + +L K + +  
Sbjct: 182 RKLRIYDSLNSSNNVTNVNSRSSSRS----NSPTVNLEAKRRIR----AGALYKPKPKLP 233

Query: 239 QRREQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQ 298
            + +   Q ++QQQ++QQ QQQQ+ Q Q  +Q    S +YIQ+LQ+FHIT A++GL+LLQ
Sbjct: 234 TQSQSNGQQQQQQQQQQQQQQQQQTQGQVNEQS---SAIYIQHLQEFHITDAKEGLRLLQ 290

Query: 299 KGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGAQH 358
           KGL +RQVA+TKMND SSRSHTIFT+TLY+   GE F+VSK+NLVDLAGSENISRSGAQ+
Sbjct: 291 KGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQN 350

Query: 359 QRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPA 418
           QRAKEAGSINQSLLTLGRVINSLADK+AH+PFRESKLTRLLQDSLGGNTKTALIATISPA
Sbjct: 351 QRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPA 410

Query: 419 KINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVY 478
           KINSEET STL+YA+KAKNIKN+PQL SF+MKDILVKNI+ ELAK+KSD LSTK +EG+Y
Sbjct: 411 KINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIY 470

Query: 479 MSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKD 538
           MS  +Y E+ ND+E+YKTEIQES+R IE+LSSQN LL KDKK+S +  E QR++++N++ 
Sbjct: 471 MSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQS 530

Query: 539 VMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQEFL 598
            M  L EK++ +HK E EL +M   LK  +   Q  +K +   E+++   +Q +L    L
Sbjct: 531 SMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNIL 590

Query: 599 QFRQMLVNNIEDIRTNHSGNDILHEGEQN-GIQQNLNVLRQEVVELLGLAQKRAEKMYKD 657
           ++R+ +   +++++            EQ+  I  ++N ++  +  LL   +K A  M ++
Sbjct: 591 EYRRKIETKLDNLKQ--------QALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCEN 642

Query: 658 WIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKNN 717
             +K++ + P  F ++ ++++ +   V+ +  RL E LS I+   NNLK Y + HFF+NN
Sbjct: 643 LAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNN 702

Query: 718 HEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQL 777
           H+E+LN H DKTY QL  S+  L+ K   ++ DH++ N+TL+M +L++ATTE I +EM  
Sbjct: 703 HQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSH 762

Query: 778 FEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKDEVKG 837
           FEP RK WE+SF+ IN CDS+SN F  D   +L+ +KS   S+    S    K+KD +  
Sbjct: 763 FEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHMESTVRESSLIADKIKDNLCH 822

Query: 838 YEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSI----KSSQGHISAFDELKERIRNT 893
           ++D + I +    +   + DI NK S LR+ L K++     SS+G   A D   +RI N 
Sbjct: 823 FQDRNDIANMTTNINGTVDDIKNKHSVLRDELEKNVSFIHASSEG-FKAIDSSLKRIMNF 881

Query: 894 IASENST 900
              E  T
Sbjct: 882 RMPEGKT 888

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score =  861 bits (2224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/882 (50%), Positives = 617/882 (69%), Gaps = 43/882 (4%)

Query: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72
           EELNITVAVR RGRNEREI+AKS+VVV+VPDV GS+EV+INTT D+GI  +MNS+TY VD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVD 78

Query: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132
           +VFGPSA+Q+LIFK IAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY+ ELSDS
Sbjct: 79  QVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDS 138

Query: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYDSGSG 192
           AGIIPR+LF+LF+TL+  + D++VKCS++ELYNEELKDLLDD+ + S  ++LRI+DS + 
Sbjct: 139 AGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYS--KRLRIFDSNTI 196

Query: 193 SNSNSGSRKNSRNNSPKLVTDPMINRRRMRTVPLSSSLAKQQHQWQQRREQQHQLREQQQ 252
           +NS +GS+    NNSPK                 SSS+AK+++     + ++  L +Q  
Sbjct: 197 TNSRAGSQ----NNSPK------------EQDGTSSSMAKRRYTHIPTKPKRPSLNKQLL 240

Query: 253 REQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMN 312
            EQ                   S +YIQNLQ+FHIT+AR+G+ +LQKGL++RQVA+TKMN
Sbjct: 241 YEQS------------------SAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMN 282

Query: 313 DFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLL 372
           DFSSRSHTIFTI LY+ ++GE+F++SKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLL
Sbjct: 283 DFSSRSHTIFTIMLYKSYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLL 342

Query: 373 TLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYA 432
           TLGRVINSLADKS H+PFRESKLTRLLQDSLGGNTKTALIATISPAKIN++ET STL+YA
Sbjct: 343 TLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYA 402

Query: 433 SKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLE 492
           +KAKNIKNRPQL SF+MKDILVK+I++EL+K+KSD LSTK +EG+YMS ++Y+E+ NDLE
Sbjct: 403 TKAKNIKNRPQLGSFMMKDILVKSISSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLE 462

Query: 493 SYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHK 552
           +Y+TEIQESKR +E  SSQNSLLLKDKKAS ++NELQ +K+  +++ +  L +K+E QH+
Sbjct: 463 NYQTEIQESKRQVESFSSQNSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHR 522

Query: 553 KEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIR 612
            E +LV     LK  L   +  ++ Y   E ++   ++ +L Q    +R+ +  ++E ++
Sbjct: 523 NEIDLVSTIHKLKEALHTMKGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVK 582

Query: 613 TNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQA 672
           T     ++        I  N++ +R    E L   +     M  + ++ + ++  T +Q 
Sbjct: 583 TRMLDKNL-------SINHNMDEIRTIFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQ 635

Query: 673 ISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQ 732
               +  ++  V TY   LT  L++++E  NN+K+Y ++HF KNN++E+L+  ++K Y +
Sbjct: 636 FKEALGDLDTKVQTYSVTLTNKLTEMTEENNNMKEYLDEHFLKNNNQEMLDLRMEKAYHK 695

Query: 733 LQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLI 792
            + ++D L+     MM+ H+++++ LM+ S++ A +E IDKE+++F+P +++W  SF+ I
Sbjct: 696 SKTASDALISSVVSMMESHMEESRNLMLSSMKDAVSEMIDKELEMFQPVKERWVLSFENI 755

Query: 793 NNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVK 852
           N CD+    F       L+++K    +S         +V++ V  +E         E + 
Sbjct: 756 NECDAAHQQFENKSTKLLTNLKELADNSVVAADDVAKQVQENVTNFEGIVRQASAKESIV 815

Query: 853 RQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIRNTI 894
           +Q+ DI +K   L +    +IK  +     F+E+   I+  I
Sbjct: 816 KQMNDINDKHKMLEDHFENNIKYFKESSKGFEEMDCSIKKII 857

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/939 (48%), Positives = 629/939 (66%), Gaps = 78/939 (8%)

Query: 11  DAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYA 70
           D EELNITVAVR RGRNE+E++A+SSVVV+VPDV G++EV+INTT D GITAQ+NSKTY 
Sbjct: 3   DDEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYT 62

Query: 71  VDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELS 130
           VDKVFGPSA+Q LIFK IAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDE+LY+ ELS
Sbjct: 63  VDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS 122

Query: 131 DSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYDSG 190
           + AGIIPR+LFKLF+ L  + +DY++KCSF+ELYNEELKDLLD++ ++S  +KLRI+DS 
Sbjct: 123 EGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFDSV 182

Query: 191 -----------------SGSNSNSGSRKNSRNNSPKLVTDPMINRRRMRTVPLSSSLAKQ 233
                                S+ G+R+ +R         P I+R      P  S ++K 
Sbjct: 183 SNVSSNSRASSRNNSPKPNEGSSFGTRRKTRA--------PSIHR------PTKSPVSKP 228

Query: 234 QHQWQQRREQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDG 293
               +                                    S ++IQNLQ+FHI  A++G
Sbjct: 229 VSPCE----------------------------------PSSAIHIQNLQEFHIMDAKEG 254

Query: 294 LQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISR 353
           ++LLQ+GLR+RQVA+TKMND SSRSHTIFTI LY++  GE F+VSKMNLVDLAGSENISR
Sbjct: 255 IRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRVSKMNLVDLAGSENISR 314

Query: 354 SGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIA 413
           SGAQ+QRAKEAGSINQSLLTLGRVINSLADKS H+PFRESKLTRLLQDSLGGNTKTALIA
Sbjct: 315 SGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKLTRLLQDSLGGNTKTALIA 374

Query: 414 TISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKL 473
           TISPAKINSEET STL+YA+KAKNIKN+PQ+ SFIMKD+L+K++TAEL K+KSDLLSTK 
Sbjct: 375 TISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLKSVTAELVKIKSDLLSTKS 434

Query: 474 REGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKL 533
           ++G+YMSQ+NYKE+TN+LE+YKTE++E KR +E++S+QNSLL+K+K+ SNEVNE Q++KL
Sbjct: 435 KDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLLIKEKRVSNEVNESQKVKL 494

Query: 534 QNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMIL 593
           + + + +  L +K++ QHK EQEL ++   L   L   Q  ++ Y  + ++    M+ +L
Sbjct: 495 RKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSLRIYEDQGQRFHTEMERVL 554

Query: 594 GQEFLQFRQMLVNNIEDIRTN--HSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRA 651
                 F++ L++ IE ++ N   +G+D         ++ N++ +  E+  +        
Sbjct: 555 YDNIGSFKKSLMDEIEKLKINVDENGDD---------VEVNVDAVTTELTRIFDFMNSSN 605

Query: 652 EKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFND 711
            ++++++I+K+ ++ P  F+ I ++V+ +   V++Y   L  +LS ISE YNNLK Y N+
Sbjct: 606 IEVFRNYIKKVNDQTPAYFKDIYSQVESITSVVSSYSSNLMIHLSSISEEYNNLKDYLNE 665

Query: 712 HFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAI 771
           HFFKNN +E L+ H+D+TY QL+ SA+ +  K ++M+++ L  NK  MM+SL+ A +E +
Sbjct: 666 HFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQSLRHAASEVV 725

Query: 772 DKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKV 831
            KEM L +P ++ WE S + IN CD ++N F   +   +++I  T          +    
Sbjct: 726 AKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQGQKTSQVTTEDA 785

Query: 832 KDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIR 891
           K E+     A + L  N ++ + +  I  K + L++ +  S    Q     F E+   I+
Sbjct: 786 KSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSANYMQAATQKFGEIDNSIQ 845

Query: 892 NTIASENSTLHQNKIATTPPLGQNSERS--PLKPTVLQP 928
           + + ++     Q++      L Q +++S  PL P+   P
Sbjct: 846 DLLNAQTIPQPQSENPIDGLLEQLNDKSLKPLGPSGKTP 884

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  860 bits (2222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/874 (52%), Positives = 613/874 (70%), Gaps = 24/874 (2%)

Query: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72
           EELNI VAVR RGRNEREI+AKSSVVV VPD   ++EV+INTTDDVGI A+MNSKTY VD
Sbjct: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89

Query: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132
           KVFGPSA+Q+L+++EIAEPLF DF+KGYNCT+LVYGMTSTGKTYTMTGDEKL+N EL D+
Sbjct: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149

Query: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLD--DSVENSSMRKLRIYDSG 190
           AGIIPR+LF+LF+TL+   +DY+VKCSFVELYNEELKDLLD  ++  NS  +KLRI+DS 
Sbjct: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFDSN 209

Query: 191 SGSNSNSGSRKNSRNNSPKLVTDPMINRRRMRTVPL-------SSSLAKQQHQWQQRREQ 243
               S SGS   S + +    + P  +R +M    L       +S ++   H    R +Q
Sbjct: 210 VNGTSASGSSSRSSSRNNSPRSAPDNSRAQMLRRKLGRHNTTGNSKISNNNHNKFSRFKQ 269

Query: 244 --QHQLREQQQREQQAQQQQKEQQQREQQQDSP----SGVYIQNLQDFHITSARDGLQLL 297
             Q   R       Q             QQ SP    + +YIQNL++FHITSA +GLQLL
Sbjct: 270 TSQESTRAHASNNHQNVHIPNNNSNNTNQQQSPIDQSASIYIQNLEEFHITSAMEGLQLL 329

Query: 298 QKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGAQ 357
           QKGL+ RQVA+TKMNDFSSRSH+IFTITLY+E  GE+F+VSKMNLVDLAGSENISRSGA 
Sbjct: 330 QKGLKQRQVASTKMNDFSSRSHSIFTITLYKEQNGELFRVSKMNLVDLAGSENISRSGAM 389

Query: 358 HQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISP 417
           +QRAKEAGSINQSLLTLGRVINSLADKS H+PFRESKLTRLLQDSLGGNTKTALIATISP
Sbjct: 390 NQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESKLTRLLQDSLGGNTKTALIATISP 449

Query: 418 AKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGV 477
           AK+ SEETCSTL+YASKAKNIKN+PQL +FIMKDILV++IT+ELAK+KSDLLSTK +EGV
Sbjct: 450 AKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVRSITSELAKIKSDLLSTKSKEGV 509

Query: 478 YMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMK 537
           YMS ++YK++  D+E YKTE++ESKR IE L++QN++L +++ +  + N   +  + ++K
Sbjct: 510 YMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAMLQQERLSLKDDNACYKANIASLK 569

Query: 538 DVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQEF 597
           D +  L   L+ Q  KE  +  +  +++      +  I  +  +++++ + +   +  E 
Sbjct: 570 DNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKTIHLFEFKQQELQQSISTFISDEI 629

Query: 598 LQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYKD 657
              R  L  +IE ++ N    D         I  NL  L +EVV+++  A++ A K Y +
Sbjct: 630 SNIRDTLKKHIEYLQNNGDLKD-------TEISGNLMRLEKEVVKVIKAAEEEASKSYGE 682

Query: 658 WIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKNN 717
            ++ +L+E P +F+++S ++D +       H ++ E LSD+SE YNNLKQY  ++FFKNN
Sbjct: 683 CVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDVSEEYNNLKQYLTNNFFKNN 742

Query: 718 HEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQL 777
           HEE+L+ H+  TY QL+ ++  L+Q F  M+D H+++NK  M++++   T E I+ E+Q+
Sbjct: 743 HEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRHMLENILGVTDEVINNELQM 802

Query: 778 FEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKDEVKG 837
           F  QR KWE+S  LIN CDS+++ F+  + S L +I+    SS D I  ++S ++   + 
Sbjct: 803 FGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVSSSRDNIGATISSIQSRTRN 862

Query: 838 YEDASTILDGNEVVKRQIADIINKDSSLRNGLYK 871
            +    ++ GN+V+++QI  I  K+ SL   L+K
Sbjct: 863 RQSIEEMIQGNDVIRQQITRIKQKNKSL--SLFK 894

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score =  842 bits (2175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/920 (49%), Positives = 625/920 (67%), Gaps = 45/920 (4%)

Query: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72
           EELNITVAVR RGRNEREI+AKSSVVV+VPDV GS+EV+INTTD+VGI A+MNS+TY VD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78

Query: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132
           KVFGPSA+Q LIFKEIAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY+ +LSDS
Sbjct: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138

Query: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYDSGSG 192
           AGIIPRI+FKLF+ L+  D D++VKCS++ELYNEELKDLLD+S ++S  ++LRI+DS S 
Sbjct: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS--KRLRIFDSSSM 196

Query: 193 SNSNSGSRKNSRNNSPKLVTDPMINRRRMRTVPLSSSLAKQQHQWQQRREQQHQLREQQQ 252
           ++S+  S +++    P++  +   +RRR R  P+ ++                       
Sbjct: 197 NHSSRASSQSNSPREPEVAHNGF-SRRRQRPPPVKAN----------------------- 232

Query: 253 REQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMN 312
           R    +QQ  E         S SG+Y+QN+Q+FHI +AR+G+ +LQKGL++RQVA+TKMN
Sbjct: 233 RMSATKQQLSE---------SGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMN 283

Query: 313 DFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLL 372
           DFSSRSHTIFTI LY+   GE+F+VSKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLL
Sbjct: 284 DFSSRSHTIFTIMLYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLL 343

Query: 373 TLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYA 432
           TLGRVINSLADKS H+PFRESKLTRLLQDSLGGNTKTALIATISPAKIN++ET STL+YA
Sbjct: 344 TLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYA 403

Query: 433 SKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLE 492
           +KAKNIKNRPQL + +MKDILVKNI++ELAK+KSD LSTK ++G+YMS ++Y+EI NDLE
Sbjct: 404 AKAKNIKNRPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLE 463

Query: 493 SYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHK 552
           + +TEIQESKR IE L+SQN+LLLKDKKAS EV ELQ  K++ ++  +  L +K+E QH 
Sbjct: 464 NCQTEIQESKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHH 523

Query: 553 KEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIR 612
            E EL      LK  L   Q  +K Y   E ++   ++ +L Q    +R+ +  ++E ++
Sbjct: 524 NETELATTIHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVK 583

Query: 613 TNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVF-Q 671
            +    ++        I++N+N +     + L   +     M  D + K+++E P+++ +
Sbjct: 584 VSMLDKNL-------SIKENINNITTIFDDTLKSVEANGSDMC-DTLVKLIKETPSMYLK 635

Query: 672 AISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQ 731
             +  V  ++  +++Y   LT  L++ISE  N+L++Y + H FKN+ +EVL+  ++  YQ
Sbjct: 636 EFNETVSSLKSELSSYSNALTNKLTEISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQ 695

Query: 732 QLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDL 791
           +++  +D LL K   M+  H+++++TLM+ S++    E ID E  LF+P R +W  S D 
Sbjct: 696 KVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDN 755

Query: 792 INNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVV 851
           IN CD+    F     S L  +K    +S      +V+K K     + D    L  ++ +
Sbjct: 756 INQCDASHQNFEAKSTSGLDKLKELSDASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSL 815

Query: 852 KRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIRNTIASENSTLHQNKIATTPP 911
           K+Q+ DI +K   L +    ++K  +     F+++   I+  I   +  +   K   T  
Sbjct: 816 KKQMHDISDKHRMLEDHFDDNVKYFKESSKGFEDMDCSIKKIIHEMSPEVGDIKSVETLM 875

Query: 912 LGQNSER-SPLKPTVLQPNQ 930
              N+   SP++PT   P++
Sbjct: 876 ERINARTFSPVRPTGKTPSR 895

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/967 (42%), Positives = 612/967 (63%), Gaps = 69/967 (7%)

Query: 1   MGSSPAG--GGEDA---EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTT 55
           +G+ P G  G   A   +++NITVAVR RGRN+REI AKS +VV+VPDV  + EV+INT+
Sbjct: 6   LGNDPGGEIGSASAMEKDDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTS 65

Query: 56  DDVGITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKT 115
              GI AQ+ +KTY VDKV+GP ++Q+L+F++ AEPLF DF++GYNCT+LVYGMTSTGKT
Sbjct: 66  GGSGIEAQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKT 125

Query: 116 YTMTGDEKLYND-ELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLL-- 172
           YTMTGD ++  + +++  AGI PRIL KLFE L    +DYVVKCSFVELYNE+L+DLL  
Sbjct: 126 YTMTGDVEMGAEGDVNGQAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSE 182

Query: 173 --DD---SVENSSM--------RKLRIYDSGSGSNSNSGSRKNSRNNSPKLVTDPMINRR 219
             DD     ENSS         +KLRI+DS            NSR+NSP   T+   ++ 
Sbjct: 183 GQDDFSNGTENSSKQPESLNASKKLRIFDSN-----------NSRSNSPVTNTNNPTHKA 231

Query: 220 RMRTVPLSSSLAKQQHQWQQRREQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYI 279
           R                + +++ + ++ +        A    K      Q     +G+YI
Sbjct: 232 R--------------SDYLKKKLKSNRKKSLDDMSLNANAGGKTHVPPTQ-----TGIYI 272

Query: 280 QNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSK 339
           QNL+DFHI++A++GLQLLQ+GL+ RQVATTK+ND SSRSHTIFTITLY++ + +++++SK
Sbjct: 273 QNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVSSRSHTIFTITLYKKFKDDLYRLSK 332

Query: 340 MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLL 399
           +NLVDLAGSEN++++GA + RAKE+GSINQSLLTLGRVINSLADKSAH+PFRESKLTRLL
Sbjct: 333 INLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPFRESKLTRLL 392

Query: 400 QDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITA 459
           QDSLGGNTKT LIATISPAKI +EETCSTL+YASKAKNIKN+PQL SFI+KDIL+K+++ 
Sbjct: 393 QDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKDILLKDVSQ 452

Query: 460 ELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDK 519
           EL K+++DL  TK +EG+Y+SQ NYKE+ +DL+++KTE+ E KR  + L  +N LL K+K
Sbjct: 453 ELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQENELLGKEK 512

Query: 520 KASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYG 579
           K+  E  +  + +L N++  +  ++ KL   + +  +L +   ++    +  +S+I+ Y 
Sbjct: 513 KSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTELKSLIEVYQ 572

Query: 580 QREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQE 639
           Q+ +    + Q +L  E       +++  + ++  +SGN  +H         +++ +R E
Sbjct: 573 QKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVNSGNYQIH--------THIDSIRGE 624

Query: 640 VVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDIS 699
           V+ LL   ++ AE +YK  I+ +L+E P +FQ IS+ V  +      ++  +  N SD+S
Sbjct: 625 VMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFSDLS 684

Query: 700 EGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLM 759
           E +N  KQY +  FF+NNH E++ +H D     +Q  +D LLQ  +  + ++L  N  ++
Sbjct: 685 EEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLSTNAQMV 744

Query: 760 MKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGS 819
             S+     + I+KEM LF P++ KWEES DLIN  DS+SN F  +M  ++ DI S   +
Sbjct: 745 TNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDIASVIRN 804

Query: 820 STDVISRSVSKVKDEVKGYE-DASTILDGNEVVKRQIADIINKDSSLRNGLYKSIK-SSQ 877
           S + + RS+S +K  +   + ++   ++ NE++      I  K +++ + +   +  ++Q
Sbjct: 805 SNESMDRSISTIKKHIIENDINSQEQINSNELLTNSFKAIQEKSNNILHLVTGDLTVTAQ 864

Query: 878 GHISAFDELKERIRNTIASENSTLHQNKIATTPPLGQNSERS----PLKPTVLQPNQLPE 933
             +     L   IR T+   +  +H  K    PP  +  E      PLKP+    N+L +
Sbjct: 865 ESMDGIQNLDRSIR-TLIHGDQYIHSTKGVHIPPQNRGPELHSTLIPLKPSSSNLNRLSD 923

Query: 934 NWRYGLR 940
           + +   R
Sbjct: 924 STKSSPR 930

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..12123)
            [3015 nt, 1005 aa]
          Length = 1004

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/721 (47%), Positives = 512/721 (71%), Gaps = 37/721 (5%)

Query: 272  DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
            D  +G+YIQNL++FHITSA++G++LLQ+GL+ RQVA+TKMNDFSSRSHTIFTI LY+EH 
Sbjct: 298  DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357

Query: 332  GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR 391
            G++F++SKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSLADK+ H+PFR
Sbjct: 358  GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417

Query: 392  ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD 451
            ESKLTRLLQDSLGGNTKTALIATISPAK+NSEETCSTL+YA+KAK+IKN+PQL S I KD
Sbjct: 418  ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477

Query: 452  ILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQ 511
            ILVKNI +ELAKVK+DLLSTK R+GVYMSQ +YKE+TNDLESYKTE+QE KR+I+ L++Q
Sbjct: 478  ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537

Query: 512  NSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
            N LLLKDKKASNEV+ LQ+IKLQ+MKD +S L + +E QH+KEQ LVD+   LKS     
Sbjct: 538  NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597

Query: 572  QSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQ 631
            Q+ IK + +RE+    +M+ I  +E L+ + +L+ N+E I      N+         +  
Sbjct: 598  QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINN-------TDLGM 650

Query: 632  NLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRL 691
            N+  ++ EV  ++   Q  A  +YKD +E++++E+P +  ++++ + +++   + Y+++L
Sbjct: 651  NIEKIKDEVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQL 710

Query: 692  TENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDH 751
            + ++S+++  +N+LKQY N  FFK++HEE+LN HI+KTY  ++ ++ G++++ K  ++ +
Sbjct: 711  SISISELNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELY 770

Query: 752  LKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALS 811
            L++++ +++ SL++ T++ +  EM+LF P++KKWE+SF++IN CDS++N + GD+ + LS
Sbjct: 771  LEESRNIIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLS 830

Query: 812  DIKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYK 871
            ++K++  S++D++   VS+++        ++ + + ++ + +Q  +++ K+S L + L +
Sbjct: 831  NMKTSVTSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNE 890

Query: 872  SIKSSQGHISAFDELKERIRNTIASENSTLHQNKIA----TTPPLGQNS---------ER 918
            SI  ++  I+AFD+L E I +     N+    N I+    +T  + QN          E 
Sbjct: 891  SITMNESSINAFDKLSESIHSAFEKYNTA---NTISRLDESTNLMKQNKDGDISLDRVEM 947

Query: 919  SPLKPT---------VLQPNQLPENWRYGLRSPPKDQLSKSNGELKRHQDNETLEENVNK 969
             PL P          VL P+++  N      S  K Q SK    L   +D + +   V K
Sbjct: 948  LPLSPIFFSENKNNHVLSPSKVVVN-----SSAKKIQASKYQKRLNSTEDMDPIATKVQK 1002

Query: 970  I 970
            I
Sbjct: 1003 I 1003

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/909 (37%), Positives = 558/909 (61%), Gaps = 49/909 (5%)

Query: 4   SPAGGGEDAEELNITVAVRSRGR--NEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGIT 61
           S + G +D  E NI V  R +G+  NE+    +  +++  P +     +     DD    
Sbjct: 2   SLSDGVKDKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-----IKFKGKDDAV-- 54

Query: 62  AQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGD 121
                + + +D +F     Q+ ++ +  +P+F DF+ GYNC+ LVYG T +GKTYT++G+
Sbjct: 55  ----KREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGE 110

Query: 122 EK--LYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDD---SV 176
           E   L+++    S G+IPR+L +LF+ L   + D+VVKCS+VE+YNEELKDLL D   S+
Sbjct: 111 EDSLLHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSL 170

Query: 177 ENSSMRKLRIYDSGS-----GSNSNSGSRKNSRNNSPKLVTDPMINRRRMRTVPLSSSLA 231
            ++S++KLRI DSGS     G+NSN  +R NS   S K +   +I R++M    L++   
Sbjct: 171 LSASIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAII-RKKMGRQSLTA--L 227

Query: 232 KQQHQWQQRREQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSAR 291
           KQ +     R                     E   +   Q+     YIQNL++FHIT+A+
Sbjct: 228 KQANTLSISRSNSFN----------------EYSPQRHIQEKTGAPYIQNLEEFHITNAK 271

Query: 292 DGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENI 351
           +G+QLL +GL+NRQ+A++K   +SSR+ TIFTI LY+E +GE+F+VSK N VDLAG+E+ 
Sbjct: 272 EGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHS 331

Query: 352 SRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTAL 411
            +    +QR K+   INQ +  L +++NSL +K + +PF++SKLT L++D+L GN+K+  
Sbjct: 332 HKIEGTNQRFKDINIINQGIQNLNKIVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIF 391

Query: 412 IATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLST 471
           I T+   K + +E   TL++ +K +++K  P L   I K+ L+K+I+ ELAKVKSDLLST
Sbjct: 392 ILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLST 451

Query: 472 KLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRI 531
           K +EGVYMS ++Y  +T DL+ +K EI + K++I+ L+ Q++ L KDK+A  EVNE+QRI
Sbjct: 452 KSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRKDKRAFEEVNEVQRI 511

Query: 532 KLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQM 591
           KLQ+M+D +S +   +E Q ++E +L++ T  LK T++     I  Y  RE  +  +M+ 
Sbjct: 512 KLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNMNVTIARYTDRESSVQTQMKT 571

Query: 592 ILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRA 651
           +  +E  + + ML+ N+     N   +++        I+ NLN   +E+ ++L +++   
Sbjct: 572 LFNEELSKLKSMLLKNLRQFEKNELIDNL-------EIENNLNKAHEEIKQILQISENEI 624

Query: 652 EKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFND 711
           + ++ D I+K+ EE+P +F +    V ++E + +  +  L E LSD+SE +NNLKQY N+
Sbjct: 625 DSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLSDVSEEFNNLKQYINE 684

Query: 712 HFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAI 771
            FFKNNHEE+L ++++KTY Q+Q S+D  L KF  +++ +L+ NK++++++++SAT+E I
Sbjct: 685 KFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSVLLQNIKSATSEVI 744

Query: 772 DKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKV 831
           + EM  F PQ++KWE+S +LI      SN F    R  +  ++ T   +++ +  ++S++
Sbjct: 745 ENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLKGTSESLFDTLSEM 804

Query: 832 KDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIR 891
           K ++   + A+ I++ NEVV  +   I+ K+  L++ L  ++ S++  I AFD+L + IR
Sbjct: 805 KSKINELQKAANIIENNEVVTEEFISIMKKNGILKDTLNINMTSTEESIVAFDKLDDSIR 864

Query: 892 NTIASENST 900
           N   +E  T
Sbjct: 865 NVFKNEIDT 873

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/630 (47%), Positives = 447/630 (70%), Gaps = 7/630 (1%)

Query: 271 QDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREH 330
           Q+  + +YIQNL++FHI +AR+G+QLLQKGL+ RQVA+TKMND SSRSHTIFTI LY+EH
Sbjct: 232 QNGNASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEH 291

Query: 331 QGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPF 390
           +GE+FK+SKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINS+ADK+ H+PF
Sbjct: 292 KGEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPF 351

Query: 391 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMK 450
           RESKLTRLLQDSLGGNTKTALIATISPAK+N+EETCSTL+YA+KAK+IKN+PQL S IMK
Sbjct: 352 RESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMK 411

Query: 451 DILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSS 510
           D+ +K++  ELAK+K DL STK ++GVYM+Q++YK++TNDLESYKTEIQE  RI++ L  
Sbjct: 412 DVRLKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLEL 471

Query: 511 QNSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSL 570
           QN+LLLKDKKASNEVN+LQ + L  M + +S +   LE QHKKEQ LV+   + +     
Sbjct: 472 QNALLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLK 531

Query: 571 TQSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQ 630
            ++VIKEY ++E++I   M+ I   E ++ +++L+ N+  I      N I+    Q  ++
Sbjct: 532 MKTVIKEYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIA---KENLIV----QTNVK 584

Query: 631 QNLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQR 690
            N+ +++ +V+ ++  +Q+ ++K++ ++ ++I++E P + +  S+ V + +    TY   
Sbjct: 585 DNIKLIKDDVISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFAN 644

Query: 691 LTENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDD 750
           L ENL  I + Y+ L +YF++ FFK+NH  ++N H++ T   ++ S   + ++F+Q M+ 
Sbjct: 645 LFENLESIKQQYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEA 704

Query: 751 HLKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSAL 810
             + N+ L++++L++ +++ I  EM  F+  + +W+ SF  IN+CD ++N ++  M + L
Sbjct: 705 FAEQNEKLILENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYL 764

Query: 811 SDIKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLY 870
            ++K    SS ++I + ++++K  V        +L+ +  +      II+K   L + L 
Sbjct: 765 RNMKGKLQSSDEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQ 824

Query: 871 KSIKSSQGHISAFDELKERIRNTIASENST 900
            S+ S+Q  +  FDE+ + I+   A+ + T
Sbjct: 825 ISLNSTQNSLLVFDEICKSIQFAFANYSKT 854

 Score =  307 bits (787), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 138/190 (72%), Positives = 169/190 (88%), Gaps = 3/190 (1%)

Query: 1   MGSSPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDV-- 58
           M + P    +D +E+NI VAVR RGRN+REI++KSSV+VSVPDVMGS+E++INT+DD+  
Sbjct: 1   MSADPQKIEDDTDEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVS 60

Query: 59  GITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTM 118
           G+TAQ+NSKTY VDKVFGPSANQ+LIF+EIAEPLF DFL+GYNCTVLVYGMTSTGKTYTM
Sbjct: 61  GLTAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTM 120

Query: 119 TGDEKLYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVEN 178
           TGDEKLY  +LSDSAGIIPR+LFKLFET++ + ++YV+KCSF+ELYNEELKDLL DS  N
Sbjct: 121 TGDEKLYKGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDS-NN 179

Query: 179 SSMRKLRIYD 188
           + ++KLRI+D
Sbjct: 180 TKLKKLRIFD 189

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  465 bits (1197), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 311/967 (32%), Positives = 539/967 (55%), Gaps = 85/967 (8%)

Query: 10  EDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVM-GSHEVAINTTDDVGITAQMNSKT 68
           E A+  NITVAVR R   + E  + S  ++S+ D   G+    I   +  G       K 
Sbjct: 3   ESAKMENITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG-----RKKI 57

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLY--- 125
           Y +D V+G   +Q+ +F E   P +  F  GYN +++ YG   +GK YT+ G+       
Sbjct: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117

Query: 126 NDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVE-------- 177
           N+  S++ G++PR+L +LF+ L+    D+++KCSFVE+YN+EL+DLL D+          
Sbjct: 118 NNAESENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSN 177

Query: 178 ---NSSMRKLRIYDSGS-----GSNSNSGSRKNSR-NNSPKLVTDPMINRRRMRTVPLSS 228
               S+ +KLRI DS S       +SNS +R NS   NS K+ T  M  R   R++P ++
Sbjct: 178 GATGSTGKKLRIVDSASNGLRSAGSSNSSTRDNSPLTNSKKIPTAMMRKRMGKRSLPPNN 237

Query: 229 SLAKQQHQWQQRREQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHIT 288
           S++                     R   ++         +   +  + +YIQNLQ+  IT
Sbjct: 238 SISNNTAN--------------NNRLSLSRTNSFSDYSLQSSHERLNSIYIQNLQEITIT 283

Query: 289 SARDGLQLLQKGLRNRQVATT----KMNDFSSRSHTIFTITLYREHQ-GEMFKVSKMNLV 343
              +G+ +++KGL+NR++A+T      N+FS RSH+IF ITLY+E +  E+F++SK++ V
Sbjct: 284 EIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFV 343

Query: 344 DLAGSE----NISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLL 399
           + AGSE    N S++GA           N +L +  ++IN + + S +  F +SKLT+LL
Sbjct: 344 NFAGSEYGDNNTSKNGA----------FNSNLQSFNKMINGMVNNSTYASFLDSKLTQLL 393

Query: 400 QDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITA 459
           Q++  G T+T  IA I+P K   + TCS L  A+K K IKN P+  S I K+ L+K ++ 
Sbjct: 394 QNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSN 453

Query: 460 ELAKVKSDLLSTKLRE-GVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKD 518
           EL K KSDLLS K  + G+YM + +Y E+T  LESYK +IQ SK  I  L+ + + +  +
Sbjct: 454 ELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIE 513

Query: 519 KKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEY 578
           K+   E+NE QRIKLQN+++ +S L+  LE Q K+E EL ++   L S L   Q  +++Y
Sbjct: 514 KRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKY 573

Query: 579 GQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQ 638
             +E  +  +++++  +E ++ +  L +N  DI+ N   +D       + +  N++ ++ 
Sbjct: 574 SDKEIHLQNKLKLLYDKELVKLKNSLESNFADIK-NRMPDD------NDNMNTNIDNIKA 626

Query: 639 EVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDI 698
           E++++   +Q + +++  +   ++L+ +P  F+ +   +  +E +V   H + +E LSDI
Sbjct: 627 EILKIANQSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDI 686

Query: 699 SEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTL 758
           SE +NNL  Y ND+F K++HEE+++++I++TY ++Q  +    + FK+++D +++ N   
Sbjct: 687 SEEFNNLNNYINDNFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNTKS 746

Query: 759 MMKSLQSATTEAIDKEMQLFEPQRKKWE-ESFDLINNC-DSISNGFNGDMRSALSDIKST 816
           + KS+ S T+E ++ E+  F P++KKWE  S ++I N  +SI+   N +    L+ + S 
Sbjct: 747 LSKSITSLTSEIVENELTQFNPEKKKWELASNEIIENFNESITKNKNKN-SEILAKLLSE 805

Query: 817 FGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSS 876
             S++++   ++S +K  V+  E+ S I + N+++K +  +IINK+  L++ +  +  SS
Sbjct: 806 STSTSELFINNMSSIKKNVEIVEEFSEIFNSNDLIKSEFLEIINKNKKLKDLITDNFNSS 865

Query: 877 QGHISAFDELKERIRNTIASE------NSTLH---------QNKIATTPPLGQNSERSPL 921
           +  I +FD LKE ++N   +E      N TL+         Q K+       + + +  L
Sbjct: 866 ENSIDSFDNLKEAMQNVFKNEMKESYSNDTLNLKEIFEQMEQQKLGVNSSSKKKAYKQNL 925

Query: 922 KPTVLQP 928
            P+ + P
Sbjct: 926 SPSKISP 932

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  360 bits (923), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 217/509 (42%), Positives = 302/509 (59%), Gaps = 62/509 (12%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKVF 75
           NI V VR R RN+REI  KSSVVVS     G   +  N +  +        KTY  D+VF
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVVSTMGRKGKSVILSNPSSPLS----HPKKTYMFDEVF 99

Query: 76  GPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE------- 128
           G  ++Q+ IF E+A+    + L+GYNCTV  YG T TGKTYTM+GD  ++ D        
Sbjct: 100 GADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIWGDLDSQDKIL 159

Query: 129 LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYD 188
           L + AGIIPR+L  LF+ L     ++ VK SF+ELYNE LKDLL D+  +S    +RI+D
Sbjct: 160 LGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLLADN--DSDEDNIRIFD 217

Query: 189 SGSGSNSNSGSRKNSRNNSPKLVTDPMINRRRMRTVPLSSSLAKQQHQWQQRREQQHQLR 248
           +   +NSN+    N        ++   +N+ ++R   LS                     
Sbjct: 218 N---NNSNAHGASNG-------MSQVKMNKSKVRAPTLSG-------------------- 247

Query: 249 EQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVAT 308
                   A               S S + ++ +++ +I SA +GLQLL KG   R+VA 
Sbjct: 248 --------ATVSSSASNSSTSSSSSSSSITVKGMEERYIKSAYEGLQLLTKGSLKRKVAA 299

Query: 309 TKMNDFSSRSHTIFTITLYREH----QGEMF-KVSKMNLVDLAGSENISRSGAQHQRAKE 363
           TK ND SSRSHTIFTI  +        GE + K+ K+NLVDLAGSENI+RSGA++ RA+E
Sbjct: 300 TKCNDLSSRSHTIFTIVTHVARTDPVSGEQYVKIGKLNLVDLAGSENINRSGAENMRAQE 359

Query: 364 AGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSE 423
           AG IN+SLLTLGRVIN+L + S+H+P+R SKLTRLLQDSLGG TKT +IATISPA+I+ +
Sbjct: 360 AGLINKSLLTLGRVINALVEHSSHIPYRGSKLTRLLQDSLGGKTKTCIIATISPARISMD 419

Query: 424 ETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDN 483
           ET STL+YA++AK+IKN PQ+   + KD  +     E+ +++ +L +++ REG+Y++Q+ 
Sbjct: 420 ETVSTLEYATRAKSIKNTPQVNQSLSKDSCIMEYIYEIERLRQELKASRQREGMYITQEQ 479

Query: 484 YKEITNDL-ESYKTEIQESKRIIERLSSQ 511
           Y     DL ES    ++E K +I+ +  Q
Sbjct: 480 Y-----DLYESNSLLVEEQKVVIQNMGEQ 503

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  334 bits (857), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 221/600 (36%), Positives = 319/600 (53%), Gaps = 109/600 (18%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEV-------AINTTDDVGIT------- 61
           NI V VR R R +REI  KSSVV+S     G+  +        +  T+  G T       
Sbjct: 51  NIKVYVRCRSRTQREIDEKSSVVISTLGANGNKVILSPNQSRKLYNTNANGSTRTKNNTN 110

Query: 62  -------------AQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYG 108
                           N +TY  DKVFG  ++Q+ +F+ +A+    + L+GYNCTV  YG
Sbjct: 111 LNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYEMLQGYNCTVFAYG 170

Query: 109 MTSTGKTYTMTGDEKLYNDE-------LSDSAGIIPRILFKLF----------------- 144
            T TGKTYTM+GD  +  +        L + AGIIPR+L  LF                 
Sbjct: 171 QTGTGKTYTMSGDLNILGNLDSKDKILLGEHAGIIPRVLVYLFKELSKNDTITNTKVNNN 230

Query: 145 ------------ETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYDSGSG 192
                       E ++L++ +Y VK SF+ELYNE+L DLL +            Y + + 
Sbjct: 231 KNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLLSN------------YKTDAL 278

Query: 193 SNSNSGSRKNSRNNSPKLVTDPMINRRRMRTVPLSSSLAKQQHQWQQRREQQHQLREQQQ 252
           ++++    + S N++P  +T+ +                    +++ +    H    +  
Sbjct: 279 NSNDKLINQTSGNSTPYSITNGL----------------NVNDKFKIKNNNLHDFDGKNV 322

Query: 253 REQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMN 312
           R           Q +     + S + ++ +++ +I SA +GLQLL +G   R+VA+TK+N
Sbjct: 323 RIMS-------NQNKSASNCNGSSITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKLN 375

Query: 313 DFSSRSHTIFTI----TLYREHQGEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSI 367
           D SSRSHTIFTI    T      G+ F K  K+NLVDLAGSENI+RSGA+++RA+EAG I
Sbjct: 376 DLSSRSHTIFTIITNVTKVDPVTGKHFVKTGKLNLVDLAGSENINRSGAENKRAQEAGLI 435

Query: 368 NQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCS 427
           N+SLLTLGRVIN+L D+S H+P+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET S
Sbjct: 436 NKSLLTLGRVINALVDRSHHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVS 495

Query: 428 TLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEI 487
           TL+YA++AK+IKN PQ+   + KD  +     E+ +++++L   + +EG+Y++QD     
Sbjct: 496 TLEYATRAKSIKNTPQINQSLSKDTFIHEYINEIDRLRNELKLARTKEGIYITQDQL--- 552

Query: 488 TNDL-ESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEK 546
             DL ES    I E K  I+ +  Q            E N +   KL+  +D    LSEK
Sbjct: 553 --DLYESNSILITEQKAKIDNMEDQIKRFKAKYVEETESNRILLNKLEQSEDANQKLSEK 610

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  314 bits (805), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 167/181 (92%), Gaps = 1/181 (0%)

Query: 12  AEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAV 71
            EELNITVAVR RGRNERE++AKSSVVVSVPD+MGS+EV+INT+D+VGI A MNSKTY V
Sbjct: 8   GEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTV 67

Query: 72  DKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSD 131
           DKVFGPSA+Q L+FKEIAEPLF DF+KGYNCT+LVYGMTSTGKTYTMTGDEKLY+ ELSD
Sbjct: 68  DKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSD 127

Query: 132 SAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYDSGS 191
           SAGIIPR+LFKLFE+ ++ ++DY++KCSFVELYNE+LKDLLDDSV+N + +KLRI+DS S
Sbjct: 128 SAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDN-TYKKLRIFDSMS 186

Query: 192 G 192
            
Sbjct: 187 S 187

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  245 bits (626), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 139/295 (47%), Positives = 203/295 (68%), Gaps = 21/295 (7%)

Query: 273 SPSG--VYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTIT--LYR 328
           SP+G  ++++ +++ +I SA++GL+LL  G   R+VA TK ND SSRSHTIFTIT  + +
Sbjct: 245 SPNGYSIFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTIFTITTNVTK 304

Query: 329 EH--QGEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKS 385
            H   GE + KV K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D S
Sbjct: 305 IHPISGEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 364

Query: 386 AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLR 445
            H+P+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET STL+YA++AK+IKN PQ+ 
Sbjct: 365 QHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSIKNTPQVN 424

Query: 446 SFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESK--- 502
             + K+  +     E+ +++ +L ++  +EG+Y++Q+ ++  T +  S   E Q++K   
Sbjct: 425 QLMAKESCIIEYIQEIERLRKELRASHSKEGIYITQEKFE--TYESNSILVEEQQAKIDN 482

Query: 503 ------RIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDV---MSGLSEKLE 548
                 R+ E+   Q  L+ +      E++   R  L+  KD+   ++G+  KLE
Sbjct: 483 LQEQLRRLKEKFLEQTKLIKEKDGQIKELDVANRKYLEQSKDLTIYINGIHSKLE 537

 Score =  150 bits (380), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 87/198 (43%), Positives = 113/198 (57%), Gaps = 25/198 (12%)

Query: 10  EDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTY 69
           E   E NI V VR R RNEREIR KSSVV+S     G   +  N           ++KTY
Sbjct: 48  EGEPEYNIKVYVRCRSRNEREIREKSSVVISTLGNNGREVILTNP-------GTGSNKTY 100

Query: 70  AVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE- 128
             D+VFG  ++Q+ +F ++A     + ++GYNCTV  YG T TGKTYTM+GD  +     
Sbjct: 101 TFDRVFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITMMGSSE 160

Query: 129 -------LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLL----DDSVE 177
                  LS+ AGIIPR+L +LF  L    EDY VK SF+ELYNE+L+DLL    D S+E
Sbjct: 161 DDPNFVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLLVDDKDVSLE 220

Query: 178 NSSM------RKLRIYDS 189
           + +         +RIYDS
Sbjct: 221 DHNFNGMAPPESIRIYDS 238

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  241 bits (616), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 167/216 (77%), Gaps = 8/216 (3%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL------YR 328
           S + ++ +Q+  I SA +GL LL +G   R+VA TK ND SSRSHT+FTIT        +
Sbjct: 239 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIEQDSK 298

Query: 329 EH-QGEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA 386
           EH Q + F K+ K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D S 
Sbjct: 299 EHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 358

Query: 387 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRS 446
           H+P+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STL+YA++AK+IKN PQ+  
Sbjct: 359 HIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNSPQVNQ 418

Query: 447 FIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQD 482
            + KD  +K+   E+ K+++DL +++ ++G++++QD
Sbjct: 419 SLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 454

 Score =  151 bits (382), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 85/204 (41%), Positives = 118/204 (57%), Gaps = 16/204 (7%)

Query: 5   PAGGGEDA-EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQ 63
           P     +A  E NI V VR R RN REI  KSSVV+S     G   +  N +     +++
Sbjct: 40  PICNNSNATSESNIHVYVRCRSRNRREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK 99

Query: 64  MNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEK 123
              KTY  D+VFG  ++Q+++F   A+    + L GYNCT+  YG T TGKTYTM+GD  
Sbjct: 100 ---KTYQFDQVFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDIN 156

Query: 124 LYNDE-------LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLL---- 172
           +  D        L + AGIIPR+L  LF+ L   +++Y VK SF+ELYNE LKDLL    
Sbjct: 157 ILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLKDLLSDNE 216

Query: 173 -DDSVENSSMRKLRIYDSGSGSNS 195
            DD   N S +++RI+D+ + ++S
Sbjct: 217 DDDPTANDSKKQIRIFDNNNNNSS 240

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  241 bits (614), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 167/216 (77%), Gaps = 8/216 (3%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL------YR 328
           S + ++ +Q+  I SA +GL LL +G   R+VA TK ND SSRSHT+FTIT        +
Sbjct: 239 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSK 298

Query: 329 EH-QGEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA 386
           +H Q + F K+ K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D S 
Sbjct: 299 DHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 358

Query: 387 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRS 446
           H+P+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STL+YA++AK+IKN PQ+  
Sbjct: 359 HIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTPQVNQ 418

Query: 447 FIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQD 482
            + KD  +K+   E+ K+K+DL +++ ++G++++QD
Sbjct: 419 SLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQD 454

 Score =  137 bits (346), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 114/192 (59%), Gaps = 15/192 (7%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKVF 75
           NI V VR R RN+REI  KSSVV+S     G   +  N +     +++   KTY  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQFDQVF 108

Query: 76  GPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE------- 128
           G  ++Q+ +F   A+    + L GYNCT+  YG T TGKTYTM+GD  +  D        
Sbjct: 109 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDKLL 168

Query: 129 LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDS-----VENSSMRK 183
           L + AGIIPR+L  LF+ L   + +Y VK SF+ELYNE LKDLL DS     V N + R+
Sbjct: 169 LGEHAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLKDLLSDSDDDDPVVNDTKRQ 228

Query: 184 LRIYDSGSGSNS 195
           +RI+D+ + ++S
Sbjct: 229 IRIFDNNNNNSS 240

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  241 bits (614), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 167/216 (77%), Gaps = 8/216 (3%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL------YR 328
           S + ++ +Q+  I SA +GL LL +G   R+VA TK ND SSRSHT+FTIT        +
Sbjct: 239 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSK 298

Query: 329 EH-QGEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA 386
           +H Q + F K+ K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D S 
Sbjct: 299 DHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 358

Query: 387 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRS 446
           H+P+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET STL+YA++AK+IKN PQ+  
Sbjct: 359 HIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQ 418

Query: 447 FIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQD 482
            + KD  +K+   E+ K+++DL +++ ++G++++QD
Sbjct: 419 SLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 454

 Score =  138 bits (348), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 116/202 (57%), Gaps = 15/202 (7%)

Query: 6   AGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMN 65
              G    + NI V VR R RN+REI  KSSVV+S     G   +  N +     +++  
Sbjct: 42  CNNGAATSDSNIHVYVRCRSRNKREIEEKSSVVISTLGPQGKEIILSNGSHQSYSSSK-- 99

Query: 66  SKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLY 125
            KTY  D+VFG  ++Q+ +F   A+    + L GYNCT+  YG T TGKTYTM+GD  + 
Sbjct: 100 -KTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINIL 158

Query: 126 NDE-------LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVE- 177
            D        L + AGIIPR+L  LF+ L   +++Y VK SF+ELYNE LKDLL DS + 
Sbjct: 159 GDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNENLKDLLSDSEDD 218

Query: 178 ----NSSMRKLRIYDSGSGSNS 195
               N   R++RI+D+ + ++S
Sbjct: 219 DPAVNDPKRQIRIFDNNNNNSS 240

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  240 bits (612), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 167/216 (77%), Gaps = 8/216 (3%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL------YR 328
           S + ++ +Q+  I SA +GL LL +G   R+VA TK ND SSRSHT+FTIT        +
Sbjct: 238 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSK 297

Query: 329 EH-QGEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA 386
           +H Q + F K+ K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D S 
Sbjct: 298 DHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 357

Query: 387 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRS 446
           H+P+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET STL+YA++AK+IKN PQ+  
Sbjct: 358 HIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQ 417

Query: 447 FIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQD 482
            + KD  +K+   E+ K+++DL +++ ++G++++QD
Sbjct: 418 SLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 453

 Score =  149 bits (375), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 116/205 (56%), Gaps = 15/205 (7%)

Query: 3   SSPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITA 62
           + P        + NI V VR R RN+REI  KSSVV+S     G   +  N +     + 
Sbjct: 38  TPPIYNSAATSDSNIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQ---SY 94

Query: 63  QMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDE 122
             + KTY  D+VFG  ++Q+ +F   A+    + L GYNCT+  YG T TGKTYTM+GD 
Sbjct: 95  SSSKKTYQFDQVFGAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDI 154

Query: 123 KLYNDE-------LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLL--- 172
            +  D        L + AGIIPR+L  LF+ L   +++Y VK +F+ELYNE LKDLL   
Sbjct: 155 NILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLLSDN 214

Query: 173 --DDSVENSSMRKLRIYDSGSGSNS 195
             DD   N S R++RI+D+ + ++S
Sbjct: 215 EDDDPAVNDSKRQIRIFDNNNNNSS 239

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  239 bits (609), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 117/214 (54%), Positives = 164/214 (76%), Gaps = 5/214 (2%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL----YREHQ 331
            + ++ +++ +I SA++GL+LL +G   RQVA+TK ND SSRSHT+FTIT          
Sbjct: 251 SIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHTVFTITTNVTKVDPLS 310

Query: 332 GEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPF 390
           GE + K  K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D S H+P+
Sbjct: 311 GEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPY 370

Query: 391 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMK 450
           RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STL+YA++AK+IKN PQ+   + K
Sbjct: 371 RESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSIKNTPQINQSMTK 430

Query: 451 DILVKNITAELAKVKSDLLSTKLREGVYMSQDNY 484
           D  +     E+ +++ +L +T+ ++G+Y++Q+ Y
Sbjct: 431 DSCITEYIHEIDRLRKELRATRTKDGIYITQEKY 464

 Score =  149 bits (377), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 114/201 (56%), Gaps = 12/201 (5%)

Query: 11  DAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYA 70
           D+   NI V VR R RN+REI  KSSVV+S     G   +  N +     +     KTY 
Sbjct: 49  DSPGYNIKVYVRCRSRNKREIGEKSSVVISTMGAQGRDVILSNPSSSSSGSLTNVKKTYT 108

Query: 71  VDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE-- 128
            D+VFG  ++Q+++F  +A+    + L+GYNCTV  YG T TGKTYTM+GD  +      
Sbjct: 109 FDRVFGAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTTH 168

Query: 129 --------LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDS--VEN 178
                   LS+ AGIIPR+L  LF+ L     DY VK SF+ELYNE LKDLL DS   ++
Sbjct: 169 NHDQSSILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLLADSNKEDD 228

Query: 179 SSMRKLRIYDSGSGSNSNSGS 199
           ++   +RI+D+     +  GS
Sbjct: 229 NNAESIRIFDNIKPEKNTQGS 249

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  237 bits (604), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 132/286 (46%), Positives = 196/286 (68%), Gaps = 11/286 (3%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL----YREH 330
           S + ++ +++ +I SA  GLQLL  G   R+VA TK ND SSRSHT+FTIT         
Sbjct: 240 SSIMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDPV 299

Query: 331 QGEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVP 389
            GE + K  K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D + H+P
Sbjct: 300 SGEQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHIP 359

Query: 390 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIM 449
           +RESKLTRLLQDSLGG TKT +IATISPAKI+ +ET STL+YA++AK+IKN PQ+   + 
Sbjct: 360 YRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSMS 419

Query: 450 KDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITND---LESYKTEIQESKRIIE 506
           KD  +     E+ +++ +L +++ ++G+ ++QD +    ++   ++  KT+IQ  +  I+
Sbjct: 420 KDSCINEYVHEIERLRQELKTSRQKDGISITQDQFDLYESNGILVDEQKTKIQNMEEQIQ 479

Query: 507 RLSS---QNSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLES 549
           R      + + L K+ ++  + NELQ I+L++ +  +  L E  +S
Sbjct: 480 RFKDKYVKQTELNKNLESRLKQNELQTIQLKSQRTQLLSLLENFQS 525

 Score =  145 bits (367), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 82/187 (43%), Positives = 112/187 (59%), Gaps = 14/187 (7%)

Query: 17  ITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKVFG 76
           I V VR R RNEREI+ KSSVV+S    +G+ +       +  +      +TY  D+VFG
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVIST---LGAPQSTQLLLSNPLLPLAYAKRTYTFDRVFG 117

Query: 77  PSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE-------- 128
             ++Q+ +F + A+    + L+GYNCTV  YG T TGKTYTM+GD  +   +        
Sbjct: 118 AESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMVL 177

Query: 129 LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYD 188
           L + AGIIPR+L +LF  LD  +E Y VK SF+ELYNE LKDLL  + E S    +RI+D
Sbjct: 178 LGEHAGIIPRVLVELFRWLD-GNEGYSVKVSFLELYNERLKDLL--ASEQSEEENIRIFD 234

Query: 189 SGSGSNS 195
           + S S+S
Sbjct: 235 NVSASSS 241

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  236 bits (602), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 166/218 (76%), Gaps = 5/218 (2%)

Query: 273 SPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTIT--LYREH 330
           S   + ++ +++ +I SA++GL+LL +G   R+VA T+ ND SSRSHTIFTIT  + + H
Sbjct: 251 SGHSIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHTIFTITTNVTKIH 310

Query: 331 --QGEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAH 387
              GE + K+ K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D S H
Sbjct: 311 PISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQH 370

Query: 388 VPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSF 447
           +P+RESKLTRLLQDSLGG TKT +IAT+SPAK + EET STL+YA++AK+IKN PQ+   
Sbjct: 371 IPYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKSIKNTPQINQL 430

Query: 448 IMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYK 485
           + K+  +     E+ K++ +L +   +EG+Y++++ Y+
Sbjct: 431 MAKESCILGYIKEIEKLRKNLKANHAKEGIYITEEKYE 468

 Score =  147 bits (372), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 115/209 (55%), Gaps = 27/209 (12%)

Query: 9   GEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKT 68
           G + +  NI V VR R RN REI+ KSSVVVS     G   +  N +         N+KT
Sbjct: 49  GSEEQGYNIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREIILSNQSTG-------NNKT 101

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           Y  D+VFG  ++Q+ +F ++A     + L+GYNCTV  YG T TGKTYTM+GD  +    
Sbjct: 102 YTFDQVFGVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGAS 161

Query: 129 LSDS--------AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVE--- 177
           L D         AGIIPR+L +LF+ L    EDY VK SF+ELYNE+L+DLL +  E   
Sbjct: 162 LEDPNYVLLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLLVEDKEPLI 221

Query: 178 ---------NSSMRKLRIYDSGSGSNSNS 197
                     +S   +RIYD+     SNS
Sbjct: 222 DEGGIGGGVANSPETIRIYDNLKLDRSNS 250

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  235 bits (600), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 139/347 (40%), Positives = 213/347 (61%), Gaps = 56/347 (16%)

Query: 277 VYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQG---- 332
           + ++ +++F+I SA +GL+LL  G   R+VA TK ND SSRSHT+FTIT           
Sbjct: 248 IMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTITTNVARTDPVSN 307

Query: 333 -EMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR 391
            +  K+ K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D S H+P+R
Sbjct: 308 EQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQHIPYR 367

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD 451
           ESKLTRLLQDSLGG TKT +IATISPAKI+ +ET STL+YA++AK+IKN PQ+   + K+
Sbjct: 368 ESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQSMSKN 427

Query: 452 ILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQ 511
             +     E+ +++ +L +++ +EG+Y+++D ++                      L   
Sbjct: 428 SCLGEYIHEIERLRQELKASRQKEGMYITEDQFQ----------------------LYES 465

Query: 512 NSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
           NS+L+++          Q++++QNM+D +     K   Q        +++ + +  L  +
Sbjct: 466 NSILVEE----------QKVRIQNMEDQILKFKAKYVEQ-------TNLSKDAEKRLKQS 508

Query: 572 QSVIKEYGQREKQISERMQMILGQEFLQFRQML---VNNIEDI-RTN 614
           Q + K+    + ++SE  Q         FRQ     V+++EDI R+N
Sbjct: 509 QLLCKKLSIEKAEMSENFQ--------SFRQTCTEYVDSVEDIHRSN 547

 Score =  152 bits (383), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 111/188 (59%), Gaps = 13/188 (6%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKVF 75
           N+ V VR R RNE+EI  KSSVV+S     G   +  N    +      + +TY  D+VF
Sbjct: 41  NMRVYVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNGAGSLS----HSKRTYTFDQVF 96

Query: 76  GPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYND-------E 128
           G  ++Q+ +F E+A+    + L+GYNCTV  YG T TGKTYTM+GD  +  D        
Sbjct: 97  GAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISILGDLDSQDKIL 156

Query: 129 LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYD 188
           L + +GIIPR+L  LF+ L     +Y VK SF+ELYNE+LKDLL +S +      +RI+D
Sbjct: 157 LGEHSGIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLLAESEQEE--ENIRIFD 214

Query: 189 SGSGSNSN 196
           + SG N N
Sbjct: 215 NNSGFNCN 222

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  236 bits (601), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 121/233 (51%), Positives = 171/233 (73%), Gaps = 7/233 (3%)

Query: 257 AQQQQKEQQQR--EQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDF 314
           AQ + +E+  R  +   ++ S + ++ +++ +I SA +GLQLL  G   R+VA+TK ND 
Sbjct: 267 AQNESEEETIRIFDNNNNASSSIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDL 326

Query: 315 SSRSHTIFTI----TLYREHQGEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQ 369
           SSRSHT+FTI    T      GE + K  K+NLVDLAGSENI+RSGA+++RA+EAG IN+
Sbjct: 327 SSRSHTVFTIATNITKIDPISGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINK 386

Query: 370 SLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTL 429
           SLLTLGRVIN+L D S H+P+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET STL
Sbjct: 387 SLLTLGRVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTL 446

Query: 430 QYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQD 482
           +YA +AK+IKN PQ+   + KD  +    +E+ +++ +L +++ ++G+ ++QD
Sbjct: 447 EYAIRAKSIKNTPQINQSMSKDTCINEYVSEIERLRLELKTSRQKDGICITQD 499

 Score =  144 bits (364), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 111/187 (59%), Gaps = 14/187 (7%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKVF 75
           NI V VR R R+EREI+ KSSVV+S     G+  +  N +  +        K+Y+ D+VF
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYPK----KSYSFDRVF 163

Query: 76  GPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYND-------E 128
           G  ++Q+ +F + A+    + L GYNCTV  YG T TGKTYTM+GD  +  +        
Sbjct: 164 GAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLESKDMIL 223

Query: 129 LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYD 188
           L + AGIIPR+L  LF+ L L + DY VK SF+ELYNE LKDL   +   S    +RI+D
Sbjct: 224 LGEHAGIIPRVLVNLFKMLALEN-DYSVKISFLELYNERLKDLFAQN--ESEEETIRIFD 280

Query: 189 SGSGSNS 195
           + + ++S
Sbjct: 281 NNNNASS 287

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  231 bits (589), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 120/224 (53%), Positives = 170/224 (75%), Gaps = 5/224 (2%)

Query: 266 QREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTIT 325
           Q+  + ++ S + ++ +++ +I SA +GLQLL +G   R+VA+TK ND SSRSHTIFTIT
Sbjct: 243 QKSSRNNTYSSIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKCNDLSSRSHTIFTIT 302

Query: 326 LYREHQ----GEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINS 380
                     GE + K+ K+NLVDLAGSENISRSGA++ RA+EAG IN+SLLTLGRVIN+
Sbjct: 303 TNITKIDPVSGEQYVKIGKLNLVDLAGSENISRSGAENMRAQEAGLINKSLLTLGRVINA 362

Query: 381 LADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKN 440
           L D S H+P+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STL+YA++AK+IKN
Sbjct: 363 LVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYATRAKSIKN 422

Query: 441 RPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNY 484
            PQ+   + KD+ +     E+ +++ +L +++ ++GVY++Q+ +
Sbjct: 423 TPQINQSMSKDVCINEYVQEIERLRQELKASRQKDGVYITQEQF 466

 Score =  154 bits (388), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 118/199 (59%), Gaps = 14/199 (7%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKVF 75
           NI V VR R RN+REI  KSSVV+S    MG+    +  +D   + +    KTY  D+VF
Sbjct: 59  NIQVYVRCRSRNQREIEEKSSVVIST---MGAQGKEVVLSDPSSVLSH-TKKTYIFDQVF 114

Query: 76  GPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYND-------E 128
           G  ++Q+++F   A+    + L+GYNCT+  YG T TGKTYTM+GD  +  D        
Sbjct: 115 GVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINILGDLESQDKIL 174

Query: 129 LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYD 188
           L + AGIIPR+L  LF+ L     +Y VK SF+ELYNE LKDLL  S E      +RI+D
Sbjct: 175 LGEHAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLLSQSKETE--ESIRIFD 232

Query: 189 SGSGSNSNSGSRKNSRNNS 207
           +   S  NS  +K+SRNN+
Sbjct: 233 NHIPSG-NSKIQKSSRNNT 250

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  172 bits (435), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 102/206 (49%), Positives = 137/206 (66%), Gaps = 31/206 (15%)

Query: 268 EQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTIT-- 325
           + +  S S + ++ +Q+  I +A +GL LL KG   R+V +TK+ND SSRSHTIFTIT  
Sbjct: 199 DNKDSSDSSIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTKLNDLSSRSHTIFTITTN 258

Query: 326 ---LYREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA 382
              L  +   E  K+ K+NLVDLAGSENI++SG +  R++E G IN+SLLTLGRVIN+L+
Sbjct: 259 IIKLDNQTNKEYIKIGKLNLVDLAGSENITKSGLK--RSQETGLINKSLLTLGRVINALS 316

Query: 383 DKSAH------------------------VPFRESKLTRLLQDSLGGNTKTALIATISPA 418
           DK+ +                        +P+RESKLTRLLQDSLGG TKT +IATISPA
Sbjct: 317 DKTNNTHGSNNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCIIATISPA 376

Query: 419 KINSEETCSTLQYASKAKNIKNRPQL 444
           K   +ET STL+YA++A +IKN P++
Sbjct: 377 KTCLDETISTLEYATRAMSIKNNPKI 402

 Score =  129 bits (323), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 95/172 (55%), Gaps = 24/172 (13%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKVF 75
           NI V VR R RN++EI  KSSVVVS     G+  +  N+T         N   Y  D VF
Sbjct: 9   NIKVYVRCRSRNQKEIDEKSSVVVSTLGQNGNQIIISNST---------NKNKYIFDNVF 59

Query: 76  GPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYND-------E 128
           G  ++Q+ IF  +A     + + GYNCT+  YG T TGKTYTM+GD  +  D        
Sbjct: 60  GVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNIIGDLNSTKNIL 119

Query: 129 LSDSAGIIPRILFKLFETL--------DLRDEDYVVKCSFVELYNEELKDLL 172
           L + AGIIPR+L +LF +L        +   + Y VK SF+ELYNE LKDLL
Sbjct: 120 LGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNERLKDLL 171

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score =  151 bits (382), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 115/390 (29%), Positives = 176/390 (45%), Gaps = 99/390 (25%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DKVF P  N   +++EI +P+     +GYN T+  YGMT +GKT+TM+G        
Sbjct: 140 FWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTR------ 193

Query: 129 LSDSAGIIPRILFKLFETL---DLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLR 185
             D AG+I   + ++F  +    + ++ Y V+ S++E+YNE++ DLL+            
Sbjct: 194 --DEAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEKIYDLLN------------ 239

Query: 186 IYDSGSGSNSNSGSRKNSRNNSPKLVTDPMINRRRMRTVPLSSSLAKQQHQWQQRREQQH 245
            Y S        GS ++                   + VP + +      +   R + +H
Sbjct: 240 -YPSAKSPGGTYGSFQS-------------------KNVPGAGA------ELPVRDDARH 273

Query: 246 QLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQ 305
            +R     EQQ    +                              D L+ ++ G  NR+
Sbjct: 274 GVRVVGLTEQQVHSSE------------------------------DVLRKIELGNSNRR 303

Query: 306 VATTKMNDFSSRSHTIFTITL-YREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEA 364
              T  N  SSRSH I TI +   E        S ++L DLAGSE   R+  QH+R KE 
Sbjct: 304 TGETDYNTRSSRSHAIVTIKVTCTELLSGTDTTSTLSLCDLAGSE---RAAGQHERRKEG 360

Query: 365 GSINQSLLTLGRVINSLADKS----------------AHVPFRESKLTRLLQDSLGGNTK 408
             IN+SLL LG VI+ L+  S                +HVP+R+SKLTR+LQ +L G++ 
Sbjct: 361 AFINKSLLALGTVISKLSAVSGASGGGAATPPPTFGNSHVPYRDSKLTRILQPALSGDSI 420

Query: 409 TALIATISPAKINSEETCSTLQYASKAKNI 438
              I TI        ET +T+++AS+AKN+
Sbjct: 421 VTTICTIDTKPDAMSETVNTIRFASRAKNV 450

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 111/388 (28%), Positives = 178/388 (45%), Gaps = 109/388 (28%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+   ++ QQ +F+   EPL    L GYN TV  YG T  GKTYT++G        
Sbjct: 110 FIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISGT------- 162

Query: 129 LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYD 188
             ++ GII   L  LF  +                  E LKD  + S+   S+  L IY 
Sbjct: 163 -PENPGIIFLTLQSLFNKI------------------ENLKDTKEISI---SLSYLEIY- 199

Query: 189 SGSGSNSNSGSRKNSRNNSPKLVTDPMINRRRMRTVPLSSSLAKQQHQWQQRREQQHQLR 248
                           N S K + DP I+ +++                         +R
Sbjct: 200 ----------------NESIKDLLDPTISSKKL------------------------VIR 219

Query: 249 EQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVAT 308
           E                      D+ + + + NL  +   +  + + L+ +G  NR  ++
Sbjct: 220 E----------------------DANNKISVSNLSTYSPATIEEVMDLIIQGNLNRTTSS 257

Query: 309 TKMNDFSSRSHTIFTITLYREHQ--------GEMFKVSKMNLVDLAGSENISRSGAQHQR 360
           T  N+ SSRSH +  I L ++++         ++F  S ++++DLAGSE  + +  + + 
Sbjct: 258 THANETSSRSHAVLQIHLTQQNKLNNDINSTEQLF--STLSIIDLAGSERAASTKNRGET 315

Query: 361 AKEAGSINQSLLTLGRVINSLADKSA-------HVPFRESKLTRLLQDSLGGNTKTALIA 413
             E  +IN+SLL LG  IN+L   ++       H+P+R+SKLTRLL+ SLGGN KT +I 
Sbjct: 316 LLEGANINKSLLALGNCINALCINTSSHSQQQIHIPYRDSKLTRLLKFSLGGNCKTVMIV 375

Query: 414 TISPAKINSEETCSTLQYASKAKNIKNR 441
            +SP+  + +ET +TL+YA++AK IK +
Sbjct: 376 CVSPSSKHYDETLNTLKYANRAKEIKTK 403

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  139 bits (351), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 118/175 (67%), Gaps = 8/175 (4%)

Query: 278 YIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREH---QGEM 334
           +++ L +F +    + L+ +++G R R V  T MN+ SSRSH IFTI++ +      G++
Sbjct: 198 FVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISIKQSETTLAGDL 257

Query: 335 F-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAH--VPFR 391
             + S + LVDLAGSE +S +GA+  R KE  +IN+SL TLGRV++ LA K+    +P+R
Sbjct: 258 TERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNRPKLIPYR 317

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRS 446
           +S LT +L+++LGGN+KT +IA +SP   + EET STL+YA+ AK +KN  ++ S
Sbjct: 318 DSALTWVLKENLGGNSKTVMIACVSPC--DYEETISTLRYATTAKEVKNTARVNS 370

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 93/191 (48%), Gaps = 26/191 (13%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPD--VMGSHEVAINTTDDVGITAQMNSKTYAVDK 73
           NI VAVR R    RE        V+ P   V+  H   I+T+  +        K +  D 
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSPTSFVIQQH---ISTSSLLATEEFTQGKIFTFDH 60

Query: 74  VFGPSAN----QQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDE---KLYN 126
            F  S N    Q++I+  I        L GYN  +L YG T +GK++TM G E     +N
Sbjct: 61  CFKYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHN 120

Query: 127 DE------LSDSA-GIIPRILFKLFETLDL--RDED-----YVVKCSFVELYNEELKDLL 172
           ++      + DSA GIIPR+   LF+  ++   +ED     + + CS++E+YNE+++DLL
Sbjct: 121 NQTALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQVRDLL 180

Query: 173 DDSVENSSMRK 183
            +      +R+
Sbjct: 181 SEDGSKCRVRE 191

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  140 bits (353), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 111/174 (63%), Gaps = 8/174 (4%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL-YREHQGE 333
           SG+Y++ L   ++TS ++ L  +++G   R V++T MN  SSRSH+I  I L  R    E
Sbjct: 195 SGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIVRINLEKRNALEE 254

Query: 334 MFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLAD-------KSA 386
             + S + LVDLAGSE + ++ A     +EA  IN SL  LG VIN+L          SA
Sbjct: 255 NIQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINALTQVESKSKRTSA 314

Query: 387 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKN 440
           H+P+R+SKLTRLLQDSLGGN+KT LI   S ++ N +ET STL++ S+AK IKN
Sbjct: 315 HIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSRAKKIKN 368

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 75/129 (58%), Gaps = 11/129 (8%)

Query: 61  TAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTG 120
           + Q N + +  D+VF   + Q+ +++ +A  +   F +GYN T+L YG T +GK++TM G
Sbjct: 67  STQNNDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFG 126

Query: 121 DEKLYNDELSDSAGIIPRI---LFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVE 177
            +        ++ G+IPRI   +FK  ET D  D  + V  SF+E+Y E++ DLL  S+E
Sbjct: 127 PK--------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLLAQSLE 178

Query: 178 NSSMRKLRI 186
             + +++ +
Sbjct: 179 KPADKRISL 187

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  136 bits (342), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 112/173 (64%), Gaps = 8/173 (4%)

Query: 278 YIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKV 337
           +++ LQ+F + S  + L  L++G   + V  T +N+ SSRSHTIFTI + ++    +  V
Sbjct: 169 FVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHV 228

Query: 338 ----SKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAH--VPFR 391
               S + L+DLAGSE  + SGA  +R KE  +IN+SL TLGRVI  LA K     +P+R
Sbjct: 229 LERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYR 288

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQL 444
           ++ LT +L++SLGGN+KT +IA +SP     EET STL+YA+ A+++K   QL
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCDF--EETMSTLRYATLARSVKTFAQL 339

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 57/100 (57%), Gaps = 15/100 (15%)

Query: 80  NQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDSAGIIPRI 139
           +Q  +++++A       L GYN  +  YG T +GK++TMTG  +L         GI+PR+
Sbjct: 62  DQAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL--------PGIVPRM 113

Query: 140 LFKLFETLDLRDED-------YVVKCSFVELYNEELKDLL 172
             +LFE  ++ +         + ++CS++E+YNE ++DLL
Sbjct: 114 CQELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLL 153

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  136 bits (342), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 72/173 (41%), Positives = 115/173 (66%), Gaps = 8/173 (4%)

Query: 278 YIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKV 337
           +++ L++F ++S  D L  +++G   R + +T +N++SSRSHTIFTI++ ++ +  +  V
Sbjct: 169 FVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALGHV 228

Query: 338 ----SKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAH--VPFR 391
               S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ LA +     +P+R
Sbjct: 229 IERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIPYR 288

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQL 444
           ++ LT +L++SLGGN+KT +IA +SP   + EET STL+YA+ A+N+K   QL
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPC--DYEETLSTLRYATLARNVKTCAQL 339

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 86/168 (51%), Gaps = 29/168 (17%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKVF 75
           NI VAVR R   ERE+    S++  V D  G+    I   D      +  ++++  D+ F
Sbjct: 4   NIKVAVRLRRPLEREV--DESIIARVED--GN---VIQVKDR---NQKNETRSFHFDQCF 53

Query: 76  GPS----ANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSD 131
             S    A+Q  ++++++       L GY+  V  YG T +GK++TMTG          +
Sbjct: 54  AYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGS--------PE 105

Query: 132 SAGIIPRILFKLFETLDLRDED-------YVVKCSFVELYNEELKDLL 172
           S GI+ R+  +LFE  ++ +         + ++CS++E+YNE ++DLL
Sbjct: 106 SPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLL 153

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  131 bits (330), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 111/174 (63%), Gaps = 5/174 (2%)

Query: 278 YIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKV 337
           ++Q++  F +    + L+ L  G   R VA+T+MN  SSRSH IFT+++ ++      + 
Sbjct: 149 FVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIKQQEPDGSIRE 208

Query: 338 SKMNLVDLAGSE--NISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAH-VPFRESK 394
           S + LVDLAGSE  N +      +R KE  +IN+SL TLGR I+ LA  S H +P+R+S 
Sbjct: 209 SDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIPYRDSL 268

Query: 395 LTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFI 448
           LT +L+++LGGN+KT +IA ISP  I+ EE+ STL+YA+ AK IK R  +   +
Sbjct: 269 LTWVLKENLGGNSKTCMIACISP--IDLEESLSTLRYATTAKEIKLRATMNEIV 320

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 61/111 (54%), Gaps = 11/111 (9%)

Query: 67  KTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 126
           +++  D +F  S++Q  I  E+        L+GYN  +  YG T +GKTYTM G      
Sbjct: 35  RSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRGT----- 89

Query: 127 DELSDSAGIIPRILFKLFETLDLRDEDYV--VKCSFVELYNEELKDLLDDS 175
              + + GIIP +   LF+ L+L D+  V  V  ++ E+YNE+L DLL D+
Sbjct: 90  ---NSNPGIIPLLCRDLFDALEL-DKTTVSSVSITYFEIYNEKLIDLLGDT 136

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score =  130 bits (326), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 117/407 (28%), Positives = 175/407 (42%), Gaps = 113/407 (27%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D VF        +++   +P+    L G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 129 LSDSAGIIPRILFKLF-----ETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRK 183
           L    G+IP  +  LF     +++D  D+ + V  S++E+YNE                 
Sbjct: 219 L----GLIPLSVSYLFSNIMEQSMD-GDKKFDVIISYLEIYNE----------------- 256

Query: 184 LRIYDSGSGSNSNSGSRKNSRNNSPKLVTDPMINRRRMRTVPLSSSLAKQQHQWQQRREQ 243
            RIYD        SGSR  +                     P  S + K           
Sbjct: 257 -RIYDLLESGLEESGSRPGT---------------------PSRSYMGKSN--------- 285

Query: 244 QHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRN 303
                        +     E + R+   DS  GV +  L +    S  + L+ +  G ++
Sbjct: 286 -------------SNAMGVELKIRD---DSKYGVKVIGLTERRCESTEELLRWIGIGDKS 329

Query: 304 RQVATTKMNDFSSRSHTIFTITLYR-EHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAK 362
           R++  T  N  SSRSH I  I L   +      + S ++L DLAGSE   R+  Q +R K
Sbjct: 330 RKIGETDYNTRSSRSHAIVLIRLTSTDVNNGTSRSSTLSLCDLAGSE---RATGQQERRK 386

Query: 363 EAGSINQSLLTLGRVINSL-ADK------------------------------SAHVPFR 391
           E   IN+SLL LG VI+ L ADK                              S H+P+R
Sbjct: 387 EGSFINKSLLALGTVISKLSADKTTSVDSNISTTPTGSSGSSSGSITGNSGIPSNHIPYR 446

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNI 438
           +SKLTRLLQ +L G++    I T+      + ET +TL++AS+AKN+
Sbjct: 447 DSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNV 493

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  129 bits (323), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 111/180 (61%), Gaps = 8/180 (4%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE 329
           ++DS  G+ + NL      + +D + L+ +G  NR  + T  N+ SSRSH +  I + ++
Sbjct: 245 REDSIKGISVANLSHHTPQTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAVLQINVVQK 304

Query: 330 HQ----GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA--- 382
           ++     E    + ++++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L    
Sbjct: 305 NRTAELSEAHTFATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSG 364

Query: 383 -DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
              + HVP+R+SKLTRLL+ SLGGN KT +I  I+P+  + +ET +TL+YA++AK IK +
Sbjct: 365 RRSTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIKTK 424

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 77/150 (51%), Gaps = 19/150 (12%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F   A Q  +++    PL    L G+N TV  YG T  GKT+T++G        
Sbjct: 136 FVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 187

Query: 129 LSDSAGIIPRILFKLFETL-DLRDEDYV-VKCSFVELYNEELKDLLDDSVENSSMRKLRI 186
             +  G+I   + +LF+ + DL+D  +  +  S++E+YNE ++DLL   +   S +KL I
Sbjct: 188 TPEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLLSPDI---SSKKLVI 244

Query: 187 Y-DSGSGSNSNSGSRKNSRNNSPKLVTDPM 215
             DS  G      S  N  +++P+ V D M
Sbjct: 245 REDSIKGI-----SVANLSHHTPQTVQDVM 269

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  125 bits (315), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 77/181 (42%), Positives = 115/181 (63%), Gaps = 10/181 (5%)

Query: 271 QDSPSGV-YIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE 329
           +D P  V YI+ L D  + S  + L+ +++G   R VA T +N+ SSRSH I TI + ++
Sbjct: 165 RDGPRKVTYIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINI-QQ 223

Query: 330 HQGEMF-----KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA-D 383
            + + F     +VS + LVDLAGSE    S  + +R KE  +IN+SL+TL RV+  L+ +
Sbjct: 224 TEIDSFGDTVERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNN 283

Query: 384 KSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQ 443
           K   VP+RES LTR+L+D+L GN+ T ++A ISP   + EE+ STL+YAS AK+++    
Sbjct: 284 KVTGVPYRESLLTRVLRDNLDGNSITCILACISPC--DYEESISTLRYASTAKHVRTEAH 341

Query: 444 L 444
           L
Sbjct: 342 L 342

 Score = 83.6 bits (205), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 64/221 (28%), Positives = 100/221 (45%), Gaps = 51/221 (23%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVM---GSHEVAINTTDDVGITAQMNSKTYAVD 72
           NI VA+R R +  RE         S P V+    S+E+ +   +   +   +   T+  D
Sbjct: 4   NIKVAIRIRDKISRE--------TSRPSVIKRKTSNEITLQKDNTANVITTVE-HTFYFD 54

Query: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132
           +VF  S+NQ+ I+ E+A       L+GY+  V+ YG T  GKTYTM G E+         
Sbjct: 55  QVFDESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTEQ--------E 106

Query: 133 AGIIPRILFKLFETLDLR-----DED----YVVKCSFVELYNEELKDL------------ 171
            GIIP +  +LF+ +D+      DED    + V  S+ ++YNE++ D+            
Sbjct: 107 PGIIPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDMLSGGCNVLRVRD 166

Query: 172 ----------LDDSVENSSMRKLRIYDSGSGSNSNSGSRKN 202
                     L D + NS    L+  + GS   S +G+  N
Sbjct: 167 GPRKVTYIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVN 207

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  128 bits (322), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 111/180 (61%), Gaps = 8/180 (4%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE 329
           ++D+ S + + NL   H T+  D + L+ +G  NR  + T+ N+ SSRSH +  I + + 
Sbjct: 262 REDTQSHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQT 321

Query: 330 HQ----GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA--- 382
           ++          + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L    
Sbjct: 322 NKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLND 381

Query: 383 -DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
             +S H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA++AK IK +
Sbjct: 382 GSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 61/106 (57%), Gaps = 10/106 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F  +++Q  ++KE   PL    L G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 129 LSDSAGIIPRILFKLFETL-DLRDE-DYVVKCSFVELYNEELKDLL 172
                GII   + +LF  + DLRDE ++ +  S++E+YNE ++DLL
Sbjct: 206 -PSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDLL 250

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/180 (38%), Positives = 108/180 (60%), Gaps = 9/180 (5%)

Query: 271 QDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREH 330
           +DS   + + NL  ++     D + L+ KG  NR  + T  N+ SSRSH +  I + + +
Sbjct: 238 EDSNESIRVSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIMQHN 297

Query: 331 QGEMFK----VSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA---- 382
           +    K     + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L     
Sbjct: 298 RTADLKSDHTFATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLNDG 357

Query: 383 -DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
             +S HVP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA++AK IK +
Sbjct: 358 TRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKTK 417

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 69/123 (56%), Gaps = 12/123 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D++F   + Q+ +++    PL    L G+N TV  YG T  GKTYT++G        
Sbjct: 128 FVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGS------- 180

Query: 129 LSDSAGIIPRILFKLFETLD-LRD-EDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRI 186
             ++ GII + + +LF  ++ L+D + + +  SF+E+YNE ++DLL    E SS + + +
Sbjct: 181 -PENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLL--CPETSSKKLVIL 237

Query: 187 YDS 189
            DS
Sbjct: 238 EDS 240

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  127 bits (320), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 72/181 (39%), Positives = 109/181 (60%), Gaps = 9/181 (4%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLY-R 328
           ++DS   + + NL    +++  D + L+ KG  NR  + T  N+ SSRSH +  + +  R
Sbjct: 234 REDSHRHITVANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQR 293

Query: 329 EHQGEM---FKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA--- 382
               E+    K + ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L    
Sbjct: 294 NRTAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSG 353

Query: 383 --DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKN 440
                 HVP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA++AK IK 
Sbjct: 354 RKRGGYHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKT 413

Query: 441 R 441
           +
Sbjct: 414 K 414

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 61/107 (57%), Gaps = 10/107 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D+VF   ++Q  +++    PL    L G+N TV  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------- 177

Query: 129 LSDSAGIIPRILFKLFETL-DLRD-EDYVVKCSFVELYNEELKDLLD 173
             ++ GII   + +LF  + +L+D + + +  S++E+YNE ++DLL+
Sbjct: 178 -PENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLLE 223

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  127 bits (319), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 68/180 (37%), Positives = 112/180 (62%), Gaps = 8/180 (4%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE 329
           ++D+ + + + NL   H T+  D + L+ +G  NR  + T+ N+ SSRSH++  I + + 
Sbjct: 262 REDTQNHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIMQT 321

Query: 330 HQ----GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA--- 382
           ++          + ++++DLAGSE  S +  +  R  E  +IN+SLL LG  IN+L    
Sbjct: 322 NKLVDLTSQHTFATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLND 381

Query: 383 -DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
             ++ H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA++AK IK +
Sbjct: 382 GSRTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 60/106 (56%), Gaps = 10/106 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F  +++Q  ++KE   PL    L G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 129 LSDSAGIIPRILFKLFETL-DLRDE-DYVVKCSFVELYNEELKDLL 172
                GII   + +LF  + DL+DE ++ +  S++E+YNE + DLL
Sbjct: 206 -PSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLL 250

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  125 bits (315), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 111/180 (61%), Gaps = 8/180 (4%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE 329
           ++D+ + + + NL   H T+  D + L+ +G  NR  + T+ N+ SSRSH +  I + + 
Sbjct: 262 REDTQNHIKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQT 321

Query: 330 HQ----GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA--- 382
           ++          + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L    
Sbjct: 322 NKLVDLTSQHTFATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLND 381

Query: 383 -DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
             ++ H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA++AK IK +
Sbjct: 382 GSRTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 76.3 bits (186), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 61/106 (57%), Gaps = 10/106 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F  +++Q  ++KE   PL    L GYN TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFAYGATGCGKTYTVSGT------- 205

Query: 129 LSDSAGIIPRILFKLFETL-DLRDE-DYVVKCSFVELYNEELKDLL 172
                G+I   + +LF  + DL+DE ++ +  S++E+YNE ++DLL
Sbjct: 206 -PSQPGVIFLAMEELFNKIDDLKDEKNFEISLSYLEIYNERIRDLL 250

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  125 bits (313), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 69/183 (37%), Positives = 112/183 (61%), Gaps = 13/183 (7%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE 329
           ++D+ S + + NL      + +D + L+ KG  NR  + T  N+ SSRSH +  I + + 
Sbjct: 255 REDNESKISVANLSHHRPKTVQDVMDLIIKGNINRTTSATDANETSSRSHAVLQIHISQT 314

Query: 330 HQ------GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA- 382
           ++        +F  + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L  
Sbjct: 315 NRTVDLTSSHVF--ATLSIIDLAGSERAASTKNRGERLYEGANINKSLLALGNCINALCL 372

Query: 383 ----DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNI 438
                +S HVP+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA++AK I
Sbjct: 373 NDGTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEI 432

Query: 439 KNR 441
           K +
Sbjct: 433 KTK 435

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 79/149 (53%), Gaps = 17/149 (11%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F   ++Q  +++     L    L G+N TV  YG T  GKTYT++G        
Sbjct: 146 FIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGT------- 198

Query: 129 LSDSAGIIPRILFKLFETLD-LRD-EDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRI 186
             +  GII   + +LF+ ++ ++D +++ +  S++E+YNE ++DLL+    ++  +KL I
Sbjct: 199 -PEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLLN---PDTPSKKLVI 254

Query: 187 YDSGSGSNSNSGSRKNSRNNSPKLVTDPM 215
            +     N +  S  N  ++ PK V D M
Sbjct: 255 RE----DNESKISVANLSHHRPKTVQDVM 279

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 109/181 (60%), Gaps = 9/181 (4%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE 329
           ++DS + + + NL      +  D + L+  G  NR  + T  N+ SSRSH +  I + + 
Sbjct: 238 REDSENRISVANLSHHRPKTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQINIVQS 297

Query: 330 HQGEMFK----VSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA--- 382
            +          +K++++DLAGSE  + +  + +R +E  +IN+SLL LG  IN+L    
Sbjct: 298 SRTAEITSDHTFAKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINALCISD 357

Query: 383 --DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKN 440
              ++ HVP+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA++AK IK 
Sbjct: 358 GTRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKT 417

Query: 441 R 441
           +
Sbjct: 418 K 418

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 74/149 (49%), Gaps = 17/149 (11%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F  +A Q+ ++      L    L G+N TV  YG T  GKTYT++G        
Sbjct: 129 FVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGT------- 181

Query: 129 LSDSAGIIPRILFKLFETL-DLRD-EDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRI 186
             +  G+I   + +LF  + +L D   + +  S++E+YNE ++DLL   +   S +KL I
Sbjct: 182 -PERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRDLLSPEM---SPKKLVI 237

Query: 187 YDSGSGSNSNSGSRKNSRNNSPKLVTDPM 215
            +     + N  S  N  ++ PK V D M
Sbjct: 238 RE----DSENRISVANLSHHRPKTVEDVM 262

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  124 bits (312), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 110/180 (61%), Gaps = 8/180 (4%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE 329
           ++D+ + + + NL   H  +  D + L+ +G  NR  + T+ N+ SSRSH +  I + + 
Sbjct: 262 REDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQT 321

Query: 330 HQ----GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA--- 382
           ++          + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L    
Sbjct: 322 NKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLND 381

Query: 383 -DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
             +S H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA++AK IK +
Sbjct: 382 GSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 79.0 bits (193), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 61/106 (57%), Gaps = 10/106 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F  +++Q  ++KE   PL    L G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 129 LSDSAGIIPRILFKLFETL-DLRDE-DYVVKCSFVELYNEELKDLL 172
                GII   + +LF  + DL+DE D+ +  S++E+YNE ++DLL
Sbjct: 206 -PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLL 250

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  124 bits (310), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 107/177 (60%), Gaps = 6/177 (3%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE 329
            + S  GVY+Q+     ++   + L  +  G   R  ++T MN  SSRSH I  I L + 
Sbjct: 209 HESSTFGVYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIVKINLLKR 268

Query: 330 H--QGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKS-- 385
              +G + K S + LVDLAGSE +S++ A     +EA  IN SL +LG VIN+L  K   
Sbjct: 269 DNLEGSIQK-SDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINALTQKDKK 327

Query: 386 -AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
             H+P+R+S+LTRLL+DSLGGN+KT LI   +  K N  ET +TL++ S+AK I+N+
Sbjct: 328 RTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQIENK 384

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 75/129 (58%), Gaps = 12/129 (9%)

Query: 59  GITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTM 118
           G+  +  S+++  D VFG ++ Q  ++  +AE +   F  GYN T+L YG T +GK+YTM
Sbjct: 77  GVQGESPSRSFHFDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTM 136

Query: 119 TGDEKLYNDELSDSAGIIPRILFKLFETLDL----RDEDYVVKCSFVELYNEELKDLLDD 174
            G          D+ G+IPRI  ++FE + L     D +YVV  SF+E+Y E++ DLL +
Sbjct: 137 FGP--------IDNRGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLEKVYDLLGE 188

Query: 175 SVENSSMRK 183
           S+  S+  K
Sbjct: 189 SINKSASPK 197

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 72/185 (38%), Positives = 109/185 (58%), Gaps = 17/185 (9%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL--- 326
           ++DS   + + NL      S +D L L+ +G  NR  + T+ N  SSRSH +  I +   
Sbjct: 252 REDSNEKISVSNLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRSHAVLQIHIMQR 311

Query: 327 -----YREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL 381
                 +EHQ        ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L
Sbjct: 312 NKLVDLKEHQ----TFGTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCINAL 367

Query: 382 AD-----KSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAK 436
                  ++ HVP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA++AK
Sbjct: 368 CSNDGSHRNQHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANRAK 427

Query: 437 NIKNR 441
            IK +
Sbjct: 428 EIKTK 432

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 59/114 (51%), Gaps = 10/114 (8%)

Query: 61  TAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTG 120
           T   +   +  DK+F    +Q+ +++     L    L G+N TV  YG T  GKTYT++G
Sbjct: 135 TGSADETKFVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSG 194

Query: 121 DEKLYNDELSDSAGIIPRILFKLFETLDLR--DEDYVVKCSFVELYNEELKDLL 172
                     ++ GII R + +LF  +D     +D+ +  SF+E+YNE + DLL
Sbjct: 195 TR--------ENPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNETIHDLL 240

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  122 bits (307), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 73/170 (42%), Positives = 105/170 (61%), Gaps = 5/170 (2%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREH--QGE 333
           GVY++      ++   + L  +  G   R   +T MN  SSRSH I  I L +    +G 
Sbjct: 188 GVYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDMNLESSRSHAIVKINLLKRDNLEGN 247

Query: 334 MFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA--DKSAHVPFR 391
           + K S + LVDLAGSE ++++ A     +EA  IN SL +LG VIN+L   +K  H+P+R
Sbjct: 248 IQK-SDLFLVDLAGSEKVAKTNAVGATLEEAKKINLSLSSLGNVINALTQKEKRTHIPYR 306

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
           +S+LTRLL+DSLGGN+KT LI   +  K N  ET +TL++ S+AK+IKN+
Sbjct: 307 DSQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRFGSRAKHIKNK 356

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 69/122 (56%), Gaps = 12/122 (9%)

Query: 66  SKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLY 125
           ++ +  D VFG  A Q+ +F  +AE +   F  GYN T+L YG T +GK+YTM G     
Sbjct: 57  ARAFRFDYVFGTDARQEEVFDYVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGP---- 112

Query: 126 NDELSDSAGIIPRILFKLFETLDL----RDEDYVVKCSFVELYNEELKDLLDDSVENSSM 181
                   G+IPRI  ++FE + L     D +YVV  SF+E+Y E++ DLL +S+  +S 
Sbjct: 113 ----PGHRGLIPRICQQIFERIGLLKNCADIEYVVSVSFLEIYLEKVYDLLGESINKASS 168

Query: 182 RK 183
            K
Sbjct: 169 PK 170

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  123 bits (308), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 108/181 (59%), Gaps = 9/181 (4%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE 329
           ++D    + + NL    + +  D + L+ KG  NR  + T  N+ SSRSH +  + + ++
Sbjct: 234 REDVHRHITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQK 293

Query: 330 HQG----EMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKS 385
           ++     E  K + ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L    
Sbjct: 294 NRTAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGG 353

Query: 386 A-----HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKN 440
                 HVP+R+SKLTRLL+ SLGGN KT +I  ISP   + +ET +TL+YA++AK IK 
Sbjct: 354 KRGGGFHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKT 413

Query: 441 R 441
           +
Sbjct: 414 K 414

 Score = 71.6 bits (174), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 63/107 (58%), Gaps = 10/107 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D+VF   A+Q+ +++    PL    L G+N TV  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 177

Query: 129 LSDSAGIIPRILFKLFETLD-LRD-EDYVVKCSFVELYNEELKDLLD 173
            +++ GII   + +LF  ++ L+D + + +  S++E+YNE ++DLL+
Sbjct: 178 -AENPGIIFLTMQELFAKMEQLKDTKKFELTASYLEIYNESIRDLLE 223

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  122 bits (306), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 67/182 (36%), Positives = 110/182 (60%), Gaps = 10/182 (5%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE 329
           ++D+ + + + NL     T+ ++ + L+ +G  NR  + T+ N+ SSRSH +  I + ++
Sbjct: 265 REDTDNKITVANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIVQK 324

Query: 330 HQGEMFK----VSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA--- 382
           ++    K       ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L    
Sbjct: 325 NRTPDIKEEHTFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCING 384

Query: 383 ---DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK 439
                  HVP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA++AK IK
Sbjct: 385 NDERPRCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 444

Query: 440 NR 441
            +
Sbjct: 445 TK 446

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 61/106 (57%), Gaps = 10/106 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F   A Q+ +++     L    L G+N TV  YG T  GKTYT++G        
Sbjct: 156 FVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 207

Query: 129 LSDSAGIIPRILFKLFETL-DLRD-EDYVVKCSFVELYNEELKDLL 172
             ++ GI+ + + +LF+ + DL+D + + +  SF+E+YNE ++DLL
Sbjct: 208 TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLL 253

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  122 bits (306), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 112/182 (61%), Gaps = 10/182 (5%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE 329
           ++D  + + + NL   +  + ++ + L+ KG  NR  + T+ N+ SSRSH +  I + + 
Sbjct: 260 REDGANKISVSNLSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQT 319

Query: 330 HQGEMFK----VSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA--- 382
           ++          + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L    
Sbjct: 320 NRTADLTSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCLTD 379

Query: 383 ---DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK 439
              ++S H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA++AK IK
Sbjct: 380 GGTNRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 439

Query: 440 NR 441
            +
Sbjct: 440 TK 441

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 62/106 (58%), Gaps = 10/106 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F   A+Q+ +++     L    L G+N TV  YG T  GKTYT++G        
Sbjct: 151 FVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------- 203

Query: 129 LSDSAGIIPRILFKLFETL-DLRD-EDYVVKCSFVELYNEELKDLL 172
             +  GII R++ +LFE + DL+D + + +  S++E+YNE ++DLL
Sbjct: 204 -PEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLL 248

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  122 bits (306), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 70/180 (38%), Positives = 107/180 (59%), Gaps = 8/180 (4%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE 329
           ++DS S   + NL      +  D + L+ +G  NR  + T  N+ SSRSH +  + + + 
Sbjct: 237 REDSDSTTTVANLSYHTPETVEDVMDLVIRGNVNRTTSPTDANETSSRSHAVLQVHVVQS 296

Query: 330 HQGEMFKVSKM----NLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA--- 382
            +    K  KM    +++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L    
Sbjct: 297 SRTVDLKEDKMYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTG 356

Query: 383 -DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
                HVP+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA++AK+IK +
Sbjct: 357 RRAVCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 416

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 63/107 (58%), Gaps = 10/107 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F   A+QQ +F+    PL    L G+N TV  YG T  GKT+T++G        
Sbjct: 128 FMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFAYGATGCGKTFTISGT------- 180

Query: 129 LSDSAGIIPRILFKLFETL-DLRD-EDYVVKCSFVELYNEELKDLLD 173
             DS GII   + +LF+ + +L+D + + +  S++E+YNE ++DLL+
Sbjct: 181 -PDSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIYNETIRDLLE 226

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  121 bits (304), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 112/180 (62%), Gaps = 8/180 (4%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYR- 328
           ++D  S + + NL      + +D + L+ +G  NR  + T+ N+ SSRSH++  I + + 
Sbjct: 204 REDQNSKISVTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVKQV 263

Query: 329 ----EHQGEMFKV-SKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA- 382
               +  G   ++ S ++++DLAGSE    +  +  R  E  +IN+SLL LG  IN+L  
Sbjct: 264 LKNFDDIGSTNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINALCI 323

Query: 383 -DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
             KS H+P+R+SKLTRLL+ SLGGN KT +I  +SP+ ++ +ET +TL+YA++AK IK +
Sbjct: 324 NKKSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIKTK 383

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 59/109 (54%), Gaps = 13/109 (11%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F   + Q+ IF++   PL    L G+N TV  YG T  GKTYT+ G        
Sbjct: 92  FIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTING-------- 143

Query: 129 LSDSAGIIPRILFKLFETLDLRDED-----YVVKCSFVELYNEELKDLL 172
            S+  GII R + +LF  +++  +D       +  S++E+YNE ++DLL
Sbjct: 144 TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIRDLL 192

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  122 bits (305), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 70/180 (38%), Positives = 108/180 (60%), Gaps = 8/180 (4%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE 329
           ++D+ +   + NL      S +D + L+ KG  NR  + T  N+ SSRSH +  I + + 
Sbjct: 239 REDTDNTTTVANLSYHTPRSVQDVMDLVIKGNINRTTSPTDANETSSRSHAVLQIHVVQS 298

Query: 330 HQGEMFKVSK----MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKS 385
            +    K  K    ++++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L    
Sbjct: 299 SRSVDLKEDKTYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTG 358

Query: 386 ----AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
                HVP+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA++AK+IK +
Sbjct: 359 RRTYCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 418

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 79/149 (53%), Gaps = 17/149 (11%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F   A QQ +F     PL    + G+N TV  YG T  GKT+T++G        
Sbjct: 130 FMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGATGCGKTFTISGT------- 182

Query: 129 LSDSAGIIPRILFKLFETLD-LRD-EDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRI 186
             ++ GII   + +LF+ ++ L+D + + +  S++E+YNE ++DLL+    ++  +KL I
Sbjct: 183 -PENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIYNEMIRDLLE---PDTPSQKLII 238

Query: 187 YDSGSGSNSNSGSRKNSRNNSPKLVTDPM 215
            +       N+ +  N   ++P+ V D M
Sbjct: 239 RE----DTDNTTTVANLSYHTPRSVQDVM 263

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  121 bits (303), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 70/190 (36%), Positives = 110/190 (57%), Gaps = 23/190 (12%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIF------- 322
           ++D  S + + NL   +  S +D + L+ +G  NR  ++T+ N+ SSRSH +        
Sbjct: 300 REDKDSKISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIHIMQT 359

Query: 323 --TITLYREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINS 380
              I L  EH       + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+
Sbjct: 360 NTKIDLTSEHT-----FATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINA 414

Query: 381 LADKS---------AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQY 431
           L   +          H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+Y
Sbjct: 415 LCIPTNNTRRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKY 474

Query: 432 ASKAKNIKNR 441
           A++AK IK +
Sbjct: 475 ANRAKEIKTK 484

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 65/113 (57%), Gaps = 10/113 (8%)

Query: 62  AQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGD 121
           A+ N   +  DK+F  +++Q  ++      L    L G+N TV  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 122 EKLYNDELSDSAGIIPRILFKLFETL-DLRDE-DYVVKCSFVELYNEELKDLL 172
           +        ++ GII R++ +LFE + DL+DE  + +  S++E+YNE + DLL
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLL 288

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  119 bits (297), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 83/226 (36%), Positives = 121/226 (53%), Gaps = 30/226 (13%)

Query: 242 EQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGL 301
           EQ   L E  + +  ++ + +E + R         +YI+N+ +  +++    ++ ++ G 
Sbjct: 162 EQIIDLLEMNEVQSCSKYRVRENRDR--------SMYIENITEIEVSNIDQMIKCVKMGF 213

Query: 302 RNRQVATTKMNDFSSRSHTIFTITLYREH-----QGEMFKVSKMNLVDLAGSENISRSGA 356
           RNR   +T MN  SSRSH I +IT+ R          +   S    VDLAGSE  + +  
Sbjct: 214 RNRTTRSTNMNVNSSRSHAIVSITIKRTDIDLNTNSSIISDSICRFVDLAGSERSTATQN 273

Query: 357 QHQ-RAKEAGSINQSLLTLGRVINSLADK-----------SAH---VPFRESKLTRLLQD 401
            H  R KE  SIN+SL TL RV+ SL  +           SAH   VPFRES LT +L+D
Sbjct: 274 CHNDRLKEGNSINKSLSTLRRVLTSLKKREELKYNSNSNSSAHNIVVPFRESLLTWILKD 333

Query: 402 SLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSF 447
           +LGGN+KT +IA ISP   N EE+ STL+YA  A+ IK    + ++
Sbjct: 334 NLGGNSKTCIIACISPT--NFEESASTLRYADIAQTIKTNSIINTY 377

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 69/127 (54%), Gaps = 17/127 (13%)

Query: 70  AVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDEL 129
             D+ FG   +Q   +K        D L GYNC +L YG T +GKTYTM G+ K      
Sbjct: 62  CFDEGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------ 115

Query: 130 SDSAGIIPRI---LFKLFETLDLRD-------EDYVVKCSFVELYNEELKDLLD-DSVEN 178
           +D+ G+IPR    LF   E++ ++D        +Y V CS  E+YNE++ DLL+ + V++
Sbjct: 116 NDTRGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLLEMNEVQS 175

Query: 179 SSMRKLR 185
            S  ++R
Sbjct: 176 CSKYRVR 182

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  119 bits (299), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 109/182 (59%), Gaps = 10/182 (5%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE 329
           ++DS +  ++ NL      +  + + L+ KG  NR  + T  N+ SSRSH +  I + + 
Sbjct: 233 REDSYNRTFVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANETSSRSHAVLQIHVAQM 292

Query: 330 HQGEMFK----VSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKS 385
           ++    K     + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L   S
Sbjct: 293 NRTADIKQDQTFATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCVSS 352

Query: 386 ------AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK 439
                  HVP+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA++AK IK
Sbjct: 353 TRTGFSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKEIK 412

Query: 440 NR 441
            +
Sbjct: 413 TK 414

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 73/140 (52%), Gaps = 13/140 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D++F     QQ +++    PL    L G+N TV  YG T  GKT+T++G        
Sbjct: 124 FIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT------- 176

Query: 129 LSDSAGIIPRILFKLFETLD-LRD-EDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRI 186
            S+  GII   + +LF  ++ L+D + + ++ SF+E+YNE++ DLLD    N S +KL I
Sbjct: 177 -SEQPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNEQIHDLLD---PNISSKKLVI 232

Query: 187 YDSGSGSNSNSGSRKNSRNN 206
            +        S   K+S  N
Sbjct: 233 REDSYNRTFVSNLSKHSPEN 252

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  119 bits (298), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 65/181 (35%), Positives = 107/181 (59%), Gaps = 9/181 (4%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE 329
           ++DS   + + NL      + ++ +  + +G  NR  + T  N+ SSRSH +  I + + 
Sbjct: 237 REDSDQKITVSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIHIAQT 296

Query: 330 HQGEMF----KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA--- 382
            +          + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L    
Sbjct: 297 DRTPDLISNSTFATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISD 356

Query: 383 --DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKN 440
              ++ HVP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL YA++AK+IK 
Sbjct: 357 GTRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIKT 416

Query: 441 R 441
           +
Sbjct: 417 K 417

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 66/120 (55%), Gaps = 13/120 (10%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F  +ANQ  ++      L    L G+N TV  YG T  GKT+T++G        
Sbjct: 128 FVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISGT------- 180

Query: 129 LSDSAGIIPRILFKLFETLD-LRDEDYV-VKCSFVELYNEELKDLLDDSVENSSMRKLRI 186
             +  GII   + +LF+ ++ L+D   + +  S++E+YNE ++DLL+ +V   S +KL I
Sbjct: 181 -PEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLLNPNV---SSKKLVI 236

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  115 bits (288), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 74/195 (37%), Positives = 117/195 (60%), Gaps = 14/195 (7%)

Query: 261 QKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHT 320
           Q++ + RE+   S    +++ L++  + +  + +  + KG  NR V +T MN  SSRSH 
Sbjct: 165 QRKCKIRERHDHS---TFVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHA 221

Query: 321 IFTITLYRE--HQ--GEMFKV-SKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLG 375
           IF I++ ++  H+  G + +  S   LVDLAGSE +  + A  +  +E  SIN+SL  LG
Sbjct: 222 IFHISVNQKETHKKTGTVVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILG 281

Query: 376 RVINSLAD----KSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQY 431
           RVI+ LA+    +S  +P+RES LT +L+++LGGN+ T L+A +SP   N  E+ STL+Y
Sbjct: 282 RVISLLAEGDRQRSQMIPYRESALTWILKENLGGNSNTCLVACVSPE--NYYESLSTLRY 339

Query: 432 ASKAKNIKNRPQLRS 446
           AS  K +K    + S
Sbjct: 340 ASLTKKVKTNATINS 354

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 80/160 (50%), Gaps = 25/160 (15%)

Query: 66  SKTYAVDKVFGPS----ANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGD 121
           +K +  D  FG +     +Q +I++ +        L+GYN  +L YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 122 EKLYNDELSDSAGIIPRILFKLFETLDLRDE---------DYVVKCSFVELYNEELKDLL 172
           +         + GI+PR   +LFE   +  +         D+ VKCSF E+YNE++ DLL
Sbjct: 109 K--------GNEGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

Query: 173 DDSVENSSMRKLRIYDSGSGSNSNSGSRKNSRNNSPKLVT 212
                + S RK +I +    S    G  + + +N  +L++
Sbjct: 161 S----SLSQRKCKIRERHDHSTFVEGLEEIAVHNVEELIS 196

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  116 bits (291), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 108/192 (56%), Gaps = 14/192 (7%)

Query: 262 KEQQQREQQQDSPSGV-YIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHT 320
           K+    E + D  S + Y+ N++ F I +  D + L+ K    R  ++T +N  SSRSH 
Sbjct: 546 KDSISHEIRHDDQSKITYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHG 605

Query: 321 IFTITLY-REHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVIN 379
           IF I L    H+     +SK+NLVDLAGSE I+ S  Q  R KE  SIN+SL  LG VI+
Sbjct: 606 IFIIYLEGYNHKTNEKCISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIH 665

Query: 380 SL------------ADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCS 427
           +L              K+ H+PFR SKLT LL+ SL G++KT +   +S  + +  ET +
Sbjct: 666 ALNRGNKNHLNSNDLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETIN 725

Query: 428 TLQYASKAKNIK 439
           +L++A+K  N K
Sbjct: 726 SLRFATKVNNTK 737

 Score = 71.6 bits (174), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 59/116 (50%), Gaps = 16/116 (13%)

Query: 65  NSKTYAV--DKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDE 122
           N+ TY+   D VF        +F EI E L    L GYN  +  YG T +GKTYTM    
Sbjct: 438 NNATYSFEFDHVFKQDEGNSEVFNEI-EQLIQSALDGYNVCIFAYGQTGSGKTYTM---- 492

Query: 123 KLYNDELSDSAGIIPRILFKLFETLDLRDE---DYVVKCSFVELYNEELKDLLDDS 175
                 L+ + G+IP  +  +F ++D   +   +Y V C F+ELYNE + DL  D+
Sbjct: 493 ------LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDLFRDN 542

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  114 bits (284), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 104/168 (61%), Gaps = 6/168 (3%)

Query: 277 VYIQNLQDFHITSARDGL-QLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMF 335
            YI N+    +  +RD + ++L++  + R  A+T  N+ SSRSH+IF I L  +++G   
Sbjct: 521 TYITNITTC-VLDSRDTVDKVLKRANKLRSTASTAANEHSSRSHSIFIIHLEGKNEGTGE 579

Query: 336 KVSK-MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPFR 391
           K    +NLVDLAGSE ++ S    +R +E  SIN+SL  LG VI++L        H+PFR
Sbjct: 580 KSQGILNLVDLAGSERLNSSMVVGERLRETQSINKSLSCLGDVIHALNSPDGQKRHIPFR 639

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK 439
            SKLT LLQ SL G++KT +   ISPA ++  ET ++L++ASK  N K
Sbjct: 640 NSKLTYLLQYSLIGSSKTLMFVNISPAALHLNETINSLRFASKVNNTK 687

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 53/107 (49%), Gaps = 14/107 (13%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F        IFKE+ + L    L GYN  +  YG T +GKTYTM          
Sbjct: 397 FKFDKIFDQQETNDEIFKEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM---------- 445

Query: 129 LSDSAGIIPRILFKLFETLD---LRDEDYVVKCSFVELYNEELKDLL 172
           L+   GI+P  +  +F  +D    R   Y V C F+E+YNE + DLL
Sbjct: 446 LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIVDLL 492

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  112 bits (279), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/169 (40%), Positives = 99/169 (58%), Gaps = 6/169 (3%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE--HQGE 333
           G YI N+    +TS      +L+K  + R  A T+ N+ SSRSH++F + +     H GE
Sbjct: 538 GTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVFMVHINGRNLHTGE 597

Query: 334 MFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPF 390
             +  K+NLVDLAGSE I+ S    +R +E  +IN+SL  LG VI +L    A   ++PF
Sbjct: 598 TSQ-GKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYALNTPDAGKRYIPF 656

Query: 391 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK 439
           R SKLT LLQ SL G++KT +   I P   +  ET ++L++ASK  + K
Sbjct: 657 RNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNSTK 705

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 78/163 (47%), Gaps = 20/163 (12%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVV-SVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKV 74
           NI V  R R     E +  S +++    +  G+  + IN  +      ++ S  +  D +
Sbjct: 366 NIRVYCRVRPPLLNEPQDMSHILIEKFNEAKGAQSLTINRNE-----GRILSYNFQFDMI 420

Query: 75  FGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDSAG 134
           F PS   + IF+EI + L    L GYN  +  YG T +GKTYTM          L+   G
Sbjct: 421 FEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------LNAGDG 469

Query: 135 IIPRIL---FKLFETLDLRDEDYVVKCSFVELYNEELKDLLDD 174
           +IP  L   FK    L  R  +Y ++C ++E+YNE + DLL D
Sbjct: 470 MIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLLRD 512

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 101/176 (57%), Gaps = 6/176 (3%)

Query: 269 QQQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLY- 327
              D+     ++NL+   +TS      +L+  ++ R  A+T  N+ SSRSH+IF I ++ 
Sbjct: 496 HHDDASKTTVVENLETITLTSKESVDAVLKNAMKLRATASTSSNERSSRSHSIFIIKIHG 555

Query: 328 -REHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA 386
             E  GE  +   +NL+DLAGSE +S S  Q +R KE   IN+SL  LG V+NSL    A
Sbjct: 556 INEGLGEE-RNGLLNLIDLAGSERLSVSKVQSERIKETQHINKSLSFLGNVMNSLGSPDA 614

Query: 387 ---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK 439
              H+ FR+SKLT LLQ SL GN+KT ++  IS +  +  ET  +L +A K  + K
Sbjct: 615 TTRHISFRDSKLTYLLQYSLTGNSKTLMVVNISSSSDHINETIKSLNFAKKVNSTK 670

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 65/117 (55%), Gaps = 16/117 (13%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           Y+ DKVF  +   Q IFKE++E L    L G+N  +  YG T +GKT+TM          
Sbjct: 383 YSFDKVFSQTDTNQEIFKEVSE-LIQSSLDGFNVCIFAYGQTGSGKTFTM---------- 431

Query: 129 LSDSAGIIPRILFKLFETLDLRDED---YVVKCSFVELYNEELKDLL--DDSVENSS 180
           L+   GIIP     +F+ +D   ++   Y V C F+E+YN+E+ DLL  DD+  NSS
Sbjct: 432 LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDEIYDLLRSDDNKSNSS 488

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 92/144 (63%), Gaps = 3/144 (2%)

Query: 295 QLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYR-EHQGEMFKVSKMNLVDLAGSENISR 353
           ++L++  + R  A+T  N+ SSRSH+IF I L+   H+ +      +NLVDLAGSE +  
Sbjct: 611 KVLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEESCGVLNLVDLAGSERVHS 670

Query: 354 SGAQHQRAKEAGSINQSLLTLGRVINSLADKSA--HVPFRESKLTRLLQDSLGGNTKTAL 411
           S    +R +E  +IN+SL  LG VI +L DK+   H+PFR SKLT LLQ SL GN+KT +
Sbjct: 671 SQVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQYSLVGNSKTLM 730

Query: 412 IATISPAKINSEETCSTLQYASKA 435
              ISP+  +  ET ++L++ASK 
Sbjct: 731 FVNISPSSSHINETINSLRFASKV 754

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 56/108 (51%), Gaps = 14/108 (12%)

Query: 68  TYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYND 127
           ++  DK+F    +   +FKE+ + L    L GYN  +  YG T +GKTYTM         
Sbjct: 471 SFKFDKIFDTGESNDEVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 520

Query: 128 ELSDSAGIIPRILFKLF---ETLDLRDEDYVVKCSFVELYNEELKDLL 172
            L  + G+IP  +  +F   E L  R  +Y + C FVE+YNE + DLL
Sbjct: 521 -LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLL 567

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score =  110 bits (276), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 96/318 (30%), Positives = 153/318 (48%), Gaps = 67/318 (21%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMF 335
           GV I  L +    ++++ ++ ++ G  NR+ + T+ N  SSRSH +  + L   +  +  
Sbjct: 266 GVKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHAVILVRLVTHNVIDGS 325

Query: 336 KVSK-MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA-------- 386
           K S  + L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +S         
Sbjct: 326 KTSSTLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVISKLSAESLSNSKHVSN 382

Query: 387 ----------------HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQ 430
                           H+P+R+SKLTRLLQ +L GN+    I TI P      ET +TL+
Sbjct: 383 PMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDPRMETYAETINTLR 442

Query: 431 YASKAKNIKNRPQL--------RSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQD 482
           +AS+AKN+  R  +        +S + KD ++K +T  L K K  +   KL+     S D
Sbjct: 443 FASRAKNVSLRFNIKKNLSTISKSEVEKDKIIKELTFRLEKQKETINDMKLKS----SHD 498

Query: 483 NYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVMSG 542
              + + D  +           I  L ++NS+L K              KL+N +++M+ 
Sbjct: 499 TSNKFSLDNPN-----------ISLLQTENSILKK--------------KLENYENIMN- 532

Query: 543 LSEKLESQHKKEQELVDM 560
             + +E Q  +  E++DM
Sbjct: 533 -KDMIELQDSQMSEIIDM 549

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 72/137 (52%), Gaps = 9/137 (6%)

Query: 61  TAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTG 120
           T   N+  Y  D VF P  +   I+K  A PL      G+N T+  YGMT +GKTYTM G
Sbjct: 125 TINTNNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMG 184

Query: 121 DEKLYNDELSDSAGIIPRILFKLF-ETLDLR-DEDYVVKCSFVELYNEELKDLLDDSVEN 178
           D +       +  GI+P  +  LF + L+ R D+ Y V  S++E+YNE++ DLLDD   N
Sbjct: 185 DNE-------NPDGIVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEKIYDLLDDDRTN 237

Query: 179 SSMRKLRIYDSGSGSNS 195
             +   R   + S  NS
Sbjct: 238 HLLTPSRFTSTPSRLNS 254

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score =  110 bits (276), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 105/325 (32%), Positives = 151/325 (46%), Gaps = 38/325 (11%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL-YREH 330
           DS  GV +  L +  + S+ D L+ +  G  NR+   T  N  SSRSH I T+ L   + 
Sbjct: 273 DSKHGVRVMGLTEQRVYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNLACTDL 332

Query: 331 QGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKS----- 385
                  S ++L DLAGSE   R+  QH+R KE   IN+SLL LG VI+ L+  S     
Sbjct: 333 VSGAETTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSASSMHTTP 389

Query: 386 ----AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
               +H+P+R+SKLTR+LQ +L G +    I TI        ET +T+++AS+AKN+   
Sbjct: 390 SFGNSHIPYRDSKLTRILQPALSGESIVTTICTIDTRLDAMSETVNTIRFASRAKNV--- 446

Query: 442 PQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEI---------TNDLE 492
                     + VK   AELA  K D L   LR  +   Q+   E+         T DL 
Sbjct: 447 ---------SMTVKRNEAELAHEK-DALIHNLRRQLDEQQELIWELKRNQEKCEQTPDLY 496

Query: 493 SYKTEIQESKR---IIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLES 549
             + E    KR   + ERL  ++   ++D +    V  L       ++  + GL  +L S
Sbjct: 497 LLRKESDALKRKLQLCERLLDKDEAAVQDDQLVEIVEMLPPAVGALLESKIQGLQSQLRS 556

Query: 550 QHKKEQELVDMTCNLKSTLSLTQSV 574
                 +L     +L S LS  QS 
Sbjct: 557 HRDYSSQLERQLSDLDSRLSSHQST 581

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 78/152 (51%), Gaps = 12/152 (7%)

Query: 25  GRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKVFGPSANQQLI 84
           G N ++ R   SV + +     + +     +D+  I A  +   +  D VF P +N   +
Sbjct: 96  GENSQQYRGAISVSIRLKPTDANAKNPWFVSDEQTI-AHNDVGEFKFDNVFRPQSNNYEV 154

Query: 85  FKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDSAGIIPRILFKLF 144
           +++I +P+     +GYN  +  YGMT +GKT+TM+G          + AG+I   +  +F
Sbjct: 155 YQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTFTMSGT--------PEEAGLISLSVEHIF 206

Query: 145 ETL---DLRDEDYVVKCSFVELYNEELKDLLD 173
             +    L ++ + V  S++E+YNE++ DLL+
Sbjct: 207 AQIMSESLANKSFQVTVSYLEIYNEKIYDLLN 238

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  110 bits (275), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 96/159 (60%), Gaps = 7/159 (4%)

Query: 287 ITSARDGLQ-LLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ--GEMFKVSKMNLV 343
           I  ++D +  L++K  + R  ATT  N+ SSRSH+IF I L   +   GE      +NLV
Sbjct: 529 ILKSKDSVDFLIKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGES-SYGILNLV 587

Query: 344 DLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPFRESKLTRLLQ 400
           DLAGSE ++ S  +  R +E  +IN+SL  LG VI++L    A   H+PFR SKLT LLQ
Sbjct: 588 DLAGSERLNSSQVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQ 647

Query: 401 DSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK 439
            SL GN+KT +   ISP +   +ET ++L++ASK    K
Sbjct: 648 YSLTGNSKTLMFVNISPTQQQIQETLNSLRFASKVNTTK 686

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 56/107 (52%), Gaps = 14/107 (13%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D++F      + +F EI + L    L GYN  +  YG T +GKT+TM          
Sbjct: 397 FQFDRIFDQHEVNKDVFDEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 445

Query: 129 LSDSAGIIPRILFKLFE---TLDLRDEDYVVKCSFVELYNEELKDLL 172
           L+ + G+IP  +  +F+   +L  R  +Y V C FVE+YNE + DLL
Sbjct: 446 LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLL 492

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score =  109 bits (272), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 106/343 (30%), Positives = 169/343 (49%), Gaps = 74/343 (21%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLY--REHQGE 333
           GV +  L + +++S ++ ++ +  G  NR+   T  N  SSRSH +  I ++   E  GE
Sbjct: 235 GVKVVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVFCTDEITGE 294

Query: 334 MFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA------- 386
              +S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +S+       
Sbjct: 295 QV-MSTLSLCDLAGSE---RATGQQERRKEGAYINKSLLALGTVISKLSMESSGLSTNVG 350

Query: 387 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK------- 439
           H+P+R+SKLTR+LQ +L G++  A I T+      S E+ +T+++AS+AKNI        
Sbjct: 351 HIPYRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNISLAVKRNE 410

Query: 440 -----NRPQLRSFIMKDILVKNITA------------------------ELAKVK----- 465
                ++ QL   + K +  + IT                         EL K+K     
Sbjct: 411 ADSNVSKSQLIQTLRKQVREQQITIDNLTRGKGFIGSGISSDTSLLRENELLKMKVEHYE 470

Query: 466 -------SDLLSTKLREGVYM-SQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLK 517
                  S L  T+L E + M  QD    +   L +  +++QESKR I +L S  +   +
Sbjct: 471 RLETLEPSILKDTELVEIIDMLPQDIGVMLETKLVNMDSQLQESKRYISQLESART---R 527

Query: 518 DKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDM 560
           D  A+    EL    L N+ D+   L++ L   H++EQEL+ +
Sbjct: 528 DASATAATAEL----LSNVSDI--DLTQVL---HEQEQELMQL 561

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 62/107 (57%), Gaps = 10/107 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D VF P  N   +++ +A P+     +G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 129 LSDSAGIIPRILFKLFETLD--LRDEDYVVKCSFVELYNEELKDLLD 173
                GIIP  +  +F+ ++  L  + + V+ S++E+YNE + DLL+
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNERIFDLLN 204

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 90/145 (62%), Gaps = 6/145 (4%)

Query: 296 LLQKGLRNRQVATTKMNDFSSRSHTIFTITL--YREHQGEMFKVSKMNLVDLAGSENISR 353
           LL++  + R  A T  N+ SSRSH++F I L  Y  + GE  +   +NLVDLAGSE I+ 
Sbjct: 554 LLKRAAKLRSTAATGSNERSSRSHSVFIIKLRGYNSNTGEECQ-GTLNLVDLAGSERINA 612

Query: 354 SGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPFRESKLTRLLQDSLGGNTKTA 410
           S     R +E  +IN+SL  LG VI++LA   A   H+PFR SKLT LLQ SL G++KT 
Sbjct: 613 SQVTGDRLRETQNINKSLSCLGDVIHALASPDASKRHIPFRNSKLTYLLQYSLLGDSKTL 672

Query: 411 LIATISPAKINSEETCSTLQYASKA 435
           +   ISP   +  ET ++L++ASK 
Sbjct: 673 MFVNISPCLDHFNETLNSLRFASKV 697

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 78/168 (46%), Gaps = 26/168 (15%)

Query: 20  AVRSRGRNE-REIRAKSSVVVSV-PDVMG----SHEVAINTTDD------VGITAQMNSK 67
            +R +  NE +E+R    V   + P + G    S  V IN  +D      + IT      
Sbjct: 352 TMRRKLHNELQELRGNIRVFCRIRPLLQGEGSESCHVHINLFNDDEGTQSMNITRDSKKH 411

Query: 68  TYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYND 127
            +  DK+F P  +   IF+EI + L    L GYN  +  YG T +GKTYTM         
Sbjct: 412 EFKFDKIFDPENSNDDIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 461

Query: 128 ELSDSAGIIPRILFKLFETLDL---RDEDYVVKCSFVELYNEELKDLL 172
            L    G+IP  L  +F+ + L   R  +Y +   F+E+YNE + DLL
Sbjct: 462 -LHPQNGMIPSTLDHIFQWIHLLKERGWEYEISSQFIEIYNETIIDLL 508

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 84/263 (31%), Positives = 138/263 (52%), Gaps = 17/263 (6%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL-YREH 330
           DS  GV +  L +  + ++ D ++ +  G  NR+   T  N  SSRSH I  I L   + 
Sbjct: 268 DSKYGVKVIGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCTDL 327

Query: 331 QGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---- 386
           +  +   S ++L DLAGSE   R+ AQ +R KE   IN+SLL LG VI+ L+ +S     
Sbjct: 328 KSGLETTSTLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQNMG 384

Query: 387 -----HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK-- 439
                H+P+R+SKLTR+LQ +L G+     I T+     +S ET +T+++AS+AKNI   
Sbjct: 385 VGGGHHIPYRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNISLV 444

Query: 440 -NRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQD-NYKEITNDLESYKTE 497
             R ++     KD +++N+  +L +    +   K   G   + D    E    L+S    
Sbjct: 445 VKRNEMDISNEKDHIIENLRRQLEQQNETIAVLKSNNGTCRTTDAGASEDALSLQSENKV 504

Query: 498 IQESKRIIERLSSQNSLLLKDKK 520
           ++      E+L  ++S++L+D++
Sbjct: 505 LKLRLEHCEKLLDKDSMILQDQE 527

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 66/116 (56%), Gaps = 11/116 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           ++ D VF P+ +   +++E A P+     +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGT------- 199

Query: 129 LSDSAGIIPRILFKLFETL---DLRDEDYVVKCSFVELYNEELKDLLDDSVENSSM 181
            S+  G+IP  +  +F  +    L ++ + VK S++E+YNE++ DLL+  V   S 
Sbjct: 200 -SNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEKIYDLLNYQVSKGSF 254

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 97/168 (57%), Gaps = 6/168 (3%)

Query: 277 VYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL--YREHQGEM 334
            +I N+    +TS     ++L++ L+ R  A T  N  SSRSH++F I L  Y    GE 
Sbjct: 531 THITNITVCKLTSREMVNRMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYNTISGEK 590

Query: 335 FKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPFR 391
                +NLVDLAGSE I     Q +R +E  +IN+SL  LG VI++L    A   H+PFR
Sbjct: 591 -STGTLNLVDLAGSERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSADASKRHIPFR 649

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK 439
            SKLT LLQ SL G++KT +   +SP   +  ET ++L++A+K  + K
Sbjct: 650 NSKLTYLLQYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 73/167 (43%), Gaps = 31/167 (18%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVG---ITAQMNSK--TYA 70
           NI V  R R   E E  + SS+ +               +D+ G   IT + +SK   + 
Sbjct: 363 NIRVFCRLRPALENENYSSSSIEIE------------KFSDETGMQSITIKRDSKQHKFT 410

Query: 71  VDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELS 130
            D+ F        +F EI + L    L GYN  +  YG T +GKT+TM          L+
Sbjct: 411 FDRCFSAQETNGDVFSEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTFTM----------LN 459

Query: 131 DSAGIIPRILFKLF---ETLDLRDEDYVVKCSFVELYNEELKDLLDD 174
            + GIIP  L  +F   E L      Y +   FVE+YNE +KDL  +
Sbjct: 460 PNDGIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIKDLFKE 506

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  107 bits (268), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/180 (37%), Positives = 107/180 (59%), Gaps = 16/180 (8%)

Query: 271 QDSPS-GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE 329
           +D P+ GV +  L +    S  + L  ++ G ++R+ ++T  N  SSRSH I  I L   
Sbjct: 224 RDDPNYGVRVIGLTEKRCQSHEELLNWIKLGDKHRKTSSTDFNTRSSRSHAIILIRLISS 283

Query: 330 --HQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADK--- 384
               GE+   S ++L DLAGSE ++   AQH+R +E   IN+SLL LG VI+ L+ +   
Sbjct: 284 DLSSGEVV-TSTLSLCDLAGSERVT---AQHERRQEGSFINKSLLALGTVISKLSAEVNN 339

Query: 385 ------SAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNI 438
                 ++H+P+R+SKLTR+LQ +L GN+    I TI  +   + E+ +TL++AS+AKN+
Sbjct: 340 STESVNNSHIPYRDSKLTRILQPALSGNSIVTTICTIDTSVDATNESVNTLRFASRAKNV 399

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 63/118 (53%), Gaps = 12/118 (10%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           Y  D VF P A+   ++    +PL      G+N TV  YGMT +GKTYTM+G        
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG-------- 155

Query: 129 LSDSAGIIP----RILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMR 182
           +  +AG+IP     +  K+F++    ++ Y    S++E+YNE++ DLL+   +   +R
Sbjct: 156 VDGNAGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEKIYDLLETDFDPKPLR 213

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 71/166 (42%), Positives = 99/166 (59%), Gaps = 6/166 (3%)

Query: 279 IQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREH--QGEMFK 336
           I N+    +TS     +LL++  + R  A+T  N+ SSRSH+IF + L  E+   GE   
Sbjct: 532 ITNVTTVPLTSKNTVDELLKRANKLRSTASTACNERSSRSHSIFIVHLSGENVLTGERSH 591

Query: 337 VSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPFRES 393
              +NLVDLAGSE I+ S    +R +E  SIN+SL  LG VI++L    A   H+PFR S
Sbjct: 592 -GILNLVDLAGSERINTSQVIGERLRETQSINKSLSCLGDVIHALGSADASKRHIPFRNS 650

Query: 394 KLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK 439
           KLT LLQ SL GN+KT +   IS    ++ ET ++L++ASK  + K
Sbjct: 651 KLTYLLQYSLTGNSKTLMFVNISGNPNHTNETLNSLRFASKVNSTK 696

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 79/163 (48%), Gaps = 26/163 (15%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D++F        +F+EI + L    L GYN  +  YG T +GKTYTM          
Sbjct: 403 FKFDRIFNEKETNYDVFQEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 451

Query: 129 LSDSAGIIPRILFKLF---ETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLR 185
           L+ + GIIP  +  +F   + L  R   Y V C FVE+YNE + DLL         R+ +
Sbjct: 452 LNPTDGIIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLL--------RREEK 503

Query: 186 IYDSGSGSNSNSGSRKNSRNNSPKLVTDPMINRRRMRTVPLSS 228
              S SG ++NS ++   R+N     T  + N   + TVPL+S
Sbjct: 504 PAGSASGDDTNSNTKLEIRHNQETKET-TITN---VTTVPLTS 542

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 107/195 (54%), Gaps = 17/195 (8%)

Query: 253 REQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMN 312
           RE+Q  Q+   +   E Q  S     I N+    +       ++L +  + R  A+TK N
Sbjct: 517 REKQTSQKHDIRHDDESQTTS-----ITNVMTVTLDREETVEKVLHRATKLRSTASTKSN 571

Query: 313 DFSSRSHTIFTITLYREHQGEMFKVSK-----MNLVDLAGSENISRSGAQHQRAKEAGSI 367
           + SSRSH+IF I L+    G+  K ++     +NLVDLAGSE I+ S    +R +E   I
Sbjct: 572 EHSSRSHSIFIIHLH----GKNSKTNEDSYGILNLVDLAGSERINSSQVSGERLRETQHI 627

Query: 368 NQSLLTLGRVI---NSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 424
           N+SL  LG VI   NS   K  H+PFR SKLT LL+ SL GN+KT +   IS +  +  E
Sbjct: 628 NKSLSCLGDVIHALNSSEHKERHIPFRNSKLTHLLKYSLSGNSKTLMFVNISASLNHVNE 687

Query: 425 TCSTLQYASKAKNIK 439
           T ++L++ASK  + K
Sbjct: 688 TINSLRFASKVNSTK 702

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 69/141 (48%), Gaps = 19/141 (13%)

Query: 40  SVPDVMGSHEVAINTTDDVG-----ITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFG 94
           S+ D   SH    +  +D G     IT   N+  Y  DK+F    +   IFKE+ + L  
Sbjct: 387 SIEDPNTSHIKVYSLDNDHGTQTMEITKNNNTNKYKFDKIFDQFESNSEIFKEVGQ-LVQ 445

Query: 95  DFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDSAGIIP---RILFKLFETLDLRD 151
             L GYN  +  YG T +GKT+TM          L+ S GIIP   R +F   + L  R 
Sbjct: 446 SALDGYNVCIFAYGQTGSGKTFTM----------LNPSDGIIPSTVRHIFTWIDNLKERG 495

Query: 152 EDYVVKCSFVELYNEELKDLL 172
            +Y + C FVE+YNE + DLL
Sbjct: 496 WEYQINCQFVEIYNENIIDLL 516

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 68/184 (36%), Positives = 106/184 (57%), Gaps = 18/184 (9%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE 329
           + DS  GV +  L++    S+ + ++ +++G  +R+ A T  N  SSRSH I  I L   
Sbjct: 272 RDDSKYGVRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNT 331

Query: 330 HQGEMFKVSK-MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL------- 381
           +  +   +S  ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L       
Sbjct: 332 NVIDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTAA 388

Query: 382 -------ADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASK 434
                  A+ + H+P+R+SKLTR+LQ +L G++    I TI   K ++ ET +TL++AS+
Sbjct: 389 SHGNSPNANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASR 448

Query: 435 AKNI 438
           AKN+
Sbjct: 449 AKNV 452

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 74/157 (47%), Gaps = 18/157 (11%)

Query: 17  ITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKVFG 76
           ITVA+R +          +S +V+ P+ +          DD+G         +  D V+ 
Sbjct: 101 ITVAIRPKPTPPTHF--SNSWLVTDPETI--------VHDDMG--------EFKFDHVYS 142

Query: 77  PSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDSAGII 136
           P  +   I++ I +P+     +G+N TV  YGMT +GKTYTM G      D+       +
Sbjct: 143 PHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGSGGDGGDDDGLIPLSV 202

Query: 137 PRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLD 173
             +  K+ E   + +  + V  S++E+YNE + DLLD
Sbjct: 203 SYLFSKVIEVGLVGERKFDVLLSYLEIYNERIYDLLD 239

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score =  106 bits (264), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 113/206 (54%), Gaps = 19/206 (9%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYR-EH 330
           DS  GV + +L +  ++S  D ++ +  G RNR+   T  N  SSRSH I  + L R + 
Sbjct: 270 DSKYGVKVVDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTRYDL 329

Query: 331 QGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA-------- 382
           +      S ++L DLAGSE   R+  Q  R KE   IN+SLL LG VI  L+        
Sbjct: 330 KTGSEATSTLSLCDLAGSE---RAVTQIVRRKEGAFINKSLLALGTVIAKLSMLGSQANG 386

Query: 383 ----DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNI 438
                 + H+P+R+SKLTR+LQ +L G++    I TI     +S ET +T+++AS+AKNI
Sbjct: 387 LQPSPAAGHIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFASRAKNI 446

Query: 439 K---NRPQLRSFIMKDILVKNITAEL 461
                + ++ S   KD +++N+  +L
Sbjct: 447 ALNVRKNEMDSHAEKDTIIQNLRKQL 472

 Score = 74.3 bits (181), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 60/109 (55%), Gaps = 12/109 (11%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D VF      Q +++ +  P+     +GYN T+  YGMT +GKT+TM+G+++     
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNKQ----- 200

Query: 129 LSDSAGIIPRILFKLFETLDLRDED----YVVKCSFVELYNEELKDLLD 173
                G+IP+ +  +F+ +          Y VK S++E+YNE++ DLL+
Sbjct: 201 ---EPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEKIYDLLN 246

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score =  105 bits (262), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 102/183 (55%), Gaps = 17/183 (9%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE 329
           ++DS  GV I  L +    S+ + L+ ++ G ++R+   T  N  SSRSH I  I L + 
Sbjct: 255 REDSKYGVKIVGLTERRCESSDELLKWIRIGDKSRKTGETTYNTRSSRSHAIVMIRLTKT 314

Query: 330 HQGEMFKVSK-MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKS--- 385
              E   VS  ++L DLAGSE   ++   ++R KE   IN+SLL LG VI+ L+ +S   
Sbjct: 315 DLKEGTSVSSTLSLCDLAGSE---KAVTHNERRKEGAFINKSLLALGTVISKLSAESTSH 371

Query: 386 ----------AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKA 435
                      H+P+R+SKLTR+LQ +L GN     I TI      S ET +TL++AS+A
Sbjct: 372 RNGGSSSPVTGHIPYRDSKLTRILQPALSGNGVVTTICTIDTRPDASSETLNTLRFASRA 431

Query: 436 KNI 438
           KN+
Sbjct: 432 KNV 434

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 60/110 (54%), Gaps = 14/110 (12%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D VF  + N   ++ + ++P+     +G N TV  YGMT +GKT+TM G E      
Sbjct: 122 FKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAGTE------ 175

Query: 129 LSDSAGIIPRILFKLF-----ETLDLRDEDYVVKCSFVELYNEELKDLLD 173
             ++ G+IP  +  L+     E+L   D  + +  S++E+YNE++ DLLD
Sbjct: 176 --ETLGLIPLSVAYLYSRVMEESLQ-GDSRFEIAVSYLEIYNEKIYDLLD 222

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 93/153 (60%), Gaps = 8/153 (5%)

Query: 292 DGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ--GEMFKVSKMNLVDLAGSE 349
           DGL  L+K  R R  A+T  N+ SSRSH++F I L   +   GE      +NLVDLAGSE
Sbjct: 564 DGL--LRKANRLRSTASTSANERSSRSHSVFIIFLKGSNHLTGEQSD-GILNLVDLAGSE 620

Query: 350 NISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPFRESKLTRLLQDSLGGN 406
            I+ S    +R +E  +IN+SL  LG V+++L    A   H+PFR SKLT LLQ SL GN
Sbjct: 621 RINSSQVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGN 680

Query: 407 TKTALIATISPAKINSEETCSTLQYASKAKNIK 439
           +KT +   IS  + +  ET ++L++ASK  + K
Sbjct: 681 SKTLMFVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 76/161 (47%), Gaps = 18/161 (11%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVS-VPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKV 74
           NI V  R R   + E    + + V+   D  G   + I  +++ G +   N   +  D++
Sbjct: 377 NIRVFCRIRPPLKYENPNTAHLTVNKFDDENGCQTMEIVKSNNTGNSIPQN---FKFDRI 433

Query: 75  FGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDSAG 134
           F  +   + +F+EI + L    L GYN  +  YG T +GKTYTM          L+   G
Sbjct: 434 FDQNETNENVFEEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPRNG 482

Query: 135 IIPRIL---FKLFETLDLRDEDYVVKCSFVELYNEELKDLL 172
           IIP  +   F   E L  R  +Y + C F+E+YNE + DLL
Sbjct: 483 IIPATISHIFSWIENLKERGWNYEINCQFIEIYNENIADLL 523

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 93/150 (62%), Gaps = 8/150 (5%)

Query: 296 LLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSK---MNLVDLAGSENIS 352
           +L+K  + R  A T  N+ SSRSH++F I  Y + + E+   S    +NLVDLAGSE ++
Sbjct: 571 VLKKATKLRATAATNSNERSSRSHSVFMI--YLKGKNEITGDSSEGILNLVDLAGSERLN 628

Query: 353 RSGAQHQRAKEAGSINQSLLTLGRVINSLA---DKSAHVPFRESKLTRLLQDSLGGNTKT 409
            S A   R +E  +IN+SL  LG VI++L    +   H+PFR SKLT LLQ SL G++KT
Sbjct: 629 SSQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRNSKLTYLLQYSLTGSSKT 688

Query: 410 ALIATISPAKINSEETCSTLQYASKAKNIK 439
            +   ISP K +  ET ++L++ASK  + K
Sbjct: 689 LMFVNISPTKSHLNETINSLRFASKVNSTK 718

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 62/113 (54%), Gaps = 14/113 (12%)

Query: 66  SKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLY 125
           S+ Y  D++F  + +   +FKEI + L    L G+N  +  YG T +GKTYTM       
Sbjct: 427 SQIYKFDRIFDQADSNTEVFKEIGQ-LVQSSLDGHNVCIFAYGQTGSGKTYTM------- 478

Query: 126 NDELSDSAGIIPRILFKLF---ETLDLRDEDYVVKCSFVELYNEELKDLLDDS 175
              L+D+ G+IP  +  +F   E++  +   Y + C F+E+YNE + DLL D+
Sbjct: 479 ---LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLLRDN 528

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 64/189 (33%), Positives = 107/189 (56%), Gaps = 23/189 (12%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYR- 328
           + D+  G+ +  L +   +S  D ++ ++ G +N++++ T+ N  SSRSH+I  + L   
Sbjct: 242 RDDAQYGIKVVGLSEHRCSSKDDLMKWVRIGDKNKKISETEYNSRSSRSHSILLVRLIAT 301

Query: 329 EHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKS--- 385
           + +  +   S ++L DLAGSE   ++ +Q +R KE   IN+SLL LG VI  L+ +S   
Sbjct: 302 DLETGIVTTSTLSLCDLAGSE---KATSQQERRKEGAFINKSLLALGTVIAKLSSESNQH 358

Query: 386 ----------------AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTL 429
                           +H+P+R+SKLTR+LQ +L GN+    I T+      S ET +TL
Sbjct: 359 RNADNVNHQETSNPNNSHIPYRDSKLTRILQPALSGNSIITTICTVDIRSDASSETLNTL 418

Query: 430 QYASKAKNI 438
           ++AS+AKN+
Sbjct: 419 RFASRAKNV 427

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 69/126 (54%), Gaps = 20/126 (15%)

Query: 56  DDVGITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKT 115
           DDVG         + +D++F    +   I+ E+ +PL      GYN T+  YGMT +GKT
Sbjct: 104 DDVG--------EFRLDRIFDCDVSNLEIYSELCKPLIDKLAMGYNATLFAYGMTGSGKT 155

Query: 116 YTMTGDEKLYNDELSDSAGIIPRILFKLFETLD----LRDEDYVVKCSFVELYNEELKDL 171
           +TM+G +        +  G+IP  +  LF T++    L  + Y +  S++E+YNE+L DL
Sbjct: 156 FTMSGTQ--------EDTGLIPLSISHLFNTINEENLLGKKKYEMLVSYMEIYNEKLYDL 207

Query: 172 LDDSVE 177
           LD +VE
Sbjct: 208 LDTNVE 213

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/183 (37%), Positives = 105/183 (57%), Gaps = 7/183 (3%)

Query: 263 EQQQREQQQDSPS-GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTI 321
           E Q+ E + D  +    I N+    +TS      +L++  R R  A T+ N+ SSRSH++
Sbjct: 526 ESQKHEIRHDHDNHATSITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSV 585

Query: 322 FTITL--YREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVIN 379
           F + +  + +  GE+    K+NL+DLAGSE I+ S     R +E  +IN+SL  LG VI 
Sbjct: 586 FMVHINGHNDQTGEVSH-GKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIY 644

Query: 380 SLADKSA---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAK 436
           +L    A   H+PFR SKLT LLQ SL G++KT +   I   + ++ ET ++L++ASK  
Sbjct: 645 ALNSPDAAKRHIPFRNSKLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVN 704

Query: 437 NIK 439
           + K
Sbjct: 705 STK 707

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 57/110 (51%), Gaps = 14/110 (12%)

Query: 66  SKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLY 125
           S  +  DK+F P      +F+EI + L    L GYN  +  YG T +GKTYTM       
Sbjct: 414 SYNFHFDKIFEPHNTNADVFQEICQ-LVQCSLDGYNVCIFAYGQTGSGKTYTM------- 465

Query: 126 NDELSDSAGIIPRILFKLFE-TLDLRDED--YVVKCSFVELYNEELKDLL 172
              L+   G+IP  L  +F+ T DL +    Y + C ++E+YNE + DLL
Sbjct: 466 ---LNPGDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDLL 512

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/155 (41%), Positives = 101/155 (65%), Gaps = 7/155 (4%)

Query: 287 ITSARDGLQ-LLQKGLRNRQVATTKMNDFSSRSHTIFTITL--YREHQGEMFKVSKMNLV 343
           I S R  LQ L+Q+  + R+ A T MN+ SSRSH++F + +  + +   E  K   +NLV
Sbjct: 541 IESNRRELQELVQRLNKVRRTAKTAMNNRSSRSHSVFIVEVEGFNKDSEERCK-GVLNLV 599

Query: 344 DLAGSENISRSG-AQHQRAKEAGSINQSLLTLGRVINSL--ADKSAHVPFRESKLTRLLQ 400
           DLAGSE ++RSG    +R +E   IN+SL ++G VI++L     S H+PFR +KLT LL+
Sbjct: 600 DLAGSERMNRSGLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLK 659

Query: 401 DSLGGNTKTALIATISPAKINSEETCSTLQYASKA 435
            SL G++KT ++ T+SP+  +  ET ++L++A+K 
Sbjct: 660 HSLQGSSKTLMLVTVSPSNSSRNETMNSLRFATKV 694

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 57/112 (50%), Gaps = 14/112 (12%)

Query: 66  SKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLY 125
           S  +  DK+F    + + +F E+ E L    L G+N  +  YG T +GKTYTM       
Sbjct: 405 SVNFQFDKIFNYDESNRQVFGEVKE-LVQSALDGHNVCIFTYGQTGSGKTYTM------- 456

Query: 126 NDELSDSAGIIPRILFKLFE---TLDLRDEDYVVKCSFVELYNEELKDLLDD 174
              L++  GIIP  L  + +   ++      Y +K  FVE+YN+ + DLL+D
Sbjct: 457 ---LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYNDRIFDLLND 505

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 97/167 (58%), Gaps = 8/167 (4%)

Query: 279 IQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ---GEMF 335
           I N+   ++ S      +L++  + R  A+T  N+ SSRSH+IF I L   +     E +
Sbjct: 531 ITNIVTRNLDSEETADNILKRANKLRSTASTGSNEHSSRSHSIFIIHLRGSNSLTGEESY 590

Query: 336 KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPFRE 392
            +  +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI++L        H+PFR 
Sbjct: 591 GI--LNLVDLAGSERINSSQVTGDRLRETQNINRSLSCLGDVIHALGGPDQGKRHIPFRN 648

Query: 393 SKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK 439
           SKLT LLQ SL GN+KT +   ISP+  +  ET ++L++ASK  + K
Sbjct: 649 SKLTYLLQYSLTGNSKTLMFVNISPSANHINETINSLRFASKVNSTK 695

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 59/125 (47%), Gaps = 19/125 (15%)

Query: 59  GITAQMNSKT-----YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTG 113
           GI    N+ T     +  DK+F  +     +FKE+ + L    L GYN  +  YG T +G
Sbjct: 389 GIEVNNNNATQIPQRFKFDKIFNQTDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSG 447

Query: 114 KTYTMTGDEKLYNDELSDSAGIIPRILFKLF---ETLDLRDEDYVVKCSFVELYNEELKD 170
           KTYTM          L    GIIP  +  +F   + L  R   Y + C FVE+YNE + D
Sbjct: 448 KTYTM----------LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNENIID 497

Query: 171 LLDDS 175
           LL  S
Sbjct: 498 LLRSS 502

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score =  103 bits (257), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 91/147 (61%), Gaps = 4/147 (2%)

Query: 296 LLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ--GEMFKVSKMNLVDLAGSENISR 353
           +L+   + + +A T  N+ SSRSH++FTI ++  +   GE      +NLVDLAGSE I  
Sbjct: 541 VLRTANKTKSIAATNSNERSSRSHSVFTIRIHGTNSITGEASD-GVLNLVDLAGSERIDT 599

Query: 354 SGAQHQRAKEAGSINQSLLTLGRVINSLADKSA-HVPFRESKLTRLLQDSLGGNTKTALI 412
           S     R +E  +IN+SL  LG VI +L  K   H+PFR SKLT LLQ SL G++KT + 
Sbjct: 600 SNVTGDRLRETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLTYLLQYSLIGDSKTLMF 659

Query: 413 ATISPAKINSEETCSTLQYASKAKNIK 439
             +SP+  + +ET ++L++ASK  + K
Sbjct: 660 VNVSPSSNHVKETLNSLRFASKVNSTK 686

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 82/161 (50%), Gaps = 23/161 (14%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVM-GSHEVAINTTDDVGITAQMNSKTYAVDKV 74
           NI V  R R   E E++  S + VS  D   GS  + I+  D        NS+ +  DKV
Sbjct: 358 NIRVYCRIRPPLENEVQDISHIHVSNFDNRNGSQAIEISNED-------RNSR-FLFDKV 409

Query: 75  FGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDSAG 134
           F  +A+ + +F+E+ + L    L GYN  +  YG T +GKTYTM          ++D  G
Sbjct: 410 FSSNASNRDVFEEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM----------MNDPDG 458

Query: 135 IIPRILFKLFETLDL---RDEDYVVKCSFVELYNEELKDLL 172
           +IP  L  +F+   L   R  DY  +  F+E+YNE++ DLL
Sbjct: 459 VIPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLL 499

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 104/203 (51%), Gaps = 31/203 (15%)

Query: 264 QQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFT 323
           Q + + + DS  GV +  L +    S+ + +  + KG + R+ A T  N  SSRSH I  
Sbjct: 268 QNELKIRDDSKYGVRVIGLTEKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVL 327

Query: 324 ITLYREHQGEMFKVSK-MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA 382
           I L      +   +S  ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+
Sbjct: 328 IRLTTSDMKDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLS 384

Query: 383 DKS---------------------------AHVPFRESKLTRLLQDSLGGNTKTALIATI 415
            +S                            H+P+R+SKLTRLLQ +L G++    I TI
Sbjct: 385 TESNKNRSPTLPSPPLSSSSSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTI 444

Query: 416 SPAKINSEETCSTLQYASKAKNI 438
                +S ET +TL++AS+AKNI
Sbjct: 445 DTKNESSAETLNTLRFASRAKNI 467

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 78/163 (47%), Gaps = 27/163 (16%)

Query: 17  ITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKVFG 76
           ITVA+R +  +     + SS +V+    +          DDVG         +  D VF 
Sbjct: 101 ITVAIRPKPTSNPSDVSTSSWLVTDEKTIAH--------DDVG--------EFKFDHVFN 144

Query: 77  PSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDSAGII 136
              +   I++ I  P+     +G+N T+  YGMT +GKTYTM G       E     G+I
Sbjct: 145 SFVSNLEIYQVINRPMIDKLFQGFNSTIFAYGMTGSGKTYTMMG-----CPEREQKDGLI 199

Query: 137 PRILFKLF-----ETLDLRDEDYVVKCSFVELYNEELKDLLDD 174
           P  +  LF     ETLD  D+ + +  S++E+YNE++ DLL D
Sbjct: 200 PLSVSYLFTKIMEETLD-GDKKFEIVLSYLEIYNEKIYDLLGD 241

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 88/144 (61%), Gaps = 4/144 (2%)

Query: 296 LLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREH-QGEMFKVSKMNLVDLAGSENISRS 354
           +L+K  + R  A+T  N+ SSRSH+IF I L   + +        +NLVDLAGSE I+ S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVS 636

Query: 355 GAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPFRESKLTRLLQDSLGGNTKTAL 411
                R +E  +IN+SL  LG VI++L    +   H+PFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 412 IATISPAKINSEETCSTLQYASKA 435
              ISP+  +  ET ++L++ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 57/115 (49%), Gaps = 16/115 (13%)

Query: 61  TAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTG 120
           TAQ++   +  DK+F        +FKE+ + L    L GYN  +  YG T +GKT+TM  
Sbjct: 430 TAQVHE--FKFDKIFDQQDTNVDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM-- 484

Query: 121 DEKLYNDELSDSAGIIPRIL---FKLFETLDLRDEDYVVKCSFVELYNEELKDLL 172
                   L+   GIIP  +   F     L  +  DY V C F+E+YNE + DLL
Sbjct: 485 --------LNPGDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 67/154 (43%), Positives = 91/154 (59%), Gaps = 11/154 (7%)

Query: 296 LLQKGLRNRQVATTKMNDFSSRSHTIFTITL--YREHQGEMFKVSKMNLVDLAGSENISR 353
           +L++  + R  A+T  N+ SSRSH+IF I L    E  GE      +NLVDLAGSE I+ 
Sbjct: 603 ILRRANKLRSTASTLSNEHSSRSHSIFIIHLKGTNEITGEK-SYGILNLVDLAGSERINS 661

Query: 354 SGAQHQRAKEAGSINQSLLTLGRVINSLAD--------KSAHVPFRESKLTRLLQDSLGG 405
           S    +R +E  +IN+SL  LG VI++L          K  H+PFR SKLT LLQ SL G
Sbjct: 662 SQVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSLIG 721

Query: 406 NTKTALIATISPAKINSEETCSTLQYASKAKNIK 439
           N+KT +   ISP+     ET ++L++ASK  + K
Sbjct: 722 NSKTLMFVNISPSINYVNETLNSLRFASKVNSAK 755

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 57/114 (50%), Gaps = 14/114 (12%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F  +     +FKE+ + L    L GYN  +  YG T +GKTYTM          
Sbjct: 453 FKFDKIFNQNETNDDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 501

Query: 129 LSDSAGIIPRILFKLFE---TLDLRDEDYVVKCSFVELYNEELKDLLDDSVENS 179
           L    GIIP  +  +F     L  R   Y ++C FVE+YNE + DLL +  +N+
Sbjct: 502 LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNENIVDLLRNEHDNN 555

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 67/165 (40%), Positives = 93/165 (56%), Gaps = 12/165 (7%)

Query: 279 IQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVS 338
           I N+    + S      +L+K  + R  A+T  N+ SSRSH+IF I L     G   K  
Sbjct: 560 ITNVTSCQLESEERVDMILKKANKLRSTASTASNEHSSRSHSIFMIHL----SGSNAKTG 615

Query: 339 K-----MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPF 390
                 +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI++L    +   H+PF
Sbjct: 616 AQSYGTLNLVDLAGSERINISQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPF 675

Query: 391 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKA 435
           R SKLT LLQ SL G++KT +   ISP+  +  ET ++L++ASK 
Sbjct: 676 RNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKV 720

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 58/114 (50%), Gaps = 19/114 (16%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTM--TGDEKLYN 126
           +  DK+F      + +FKE+ + L    L GYN  +  YG T +GKT+TM  TGD     
Sbjct: 436 FKFDKIFDQQNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTMLNTGD----- 489

Query: 127 DELSDSAGIIPRIL---FKLFETLDLRDEDYVVKCSFVELYNEELKDLL-DDSV 176
                  GIIP  +   F     L  +  DY V C F+E+YNE + DLL +DS+
Sbjct: 490 -------GIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDLLRNDSI 536

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 88/148 (59%), Gaps = 12/148 (8%)

Query: 296 LLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSK-----MNLVDLAGSEN 350
           +L+K  + R  A+T  N+ SSRSH+IF I L     G   K        +NLVDLAGSE 
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHL----SGSNTKTGAQSYGTLNLVDLAGSER 632

Query: 351 ISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPFRESKLTRLLQDSLGGNT 407
           I+ S     R +E  +IN+SL  LG VI++L    +   H+PFR SKLT LLQ SL G++
Sbjct: 633 INISQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDS 692

Query: 408 KTALIATISPAKINSEETCSTLQYASKA 435
           KT +   ISP+  +  ET ++L++ASK 
Sbjct: 693 KTLMFVNISPSSSHINETLNSLRFASKV 720

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 57/115 (49%), Gaps = 16/115 (13%)

Query: 61  TAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTG 120
           TAQ++   +  DK+F        +FKE+ + L    L GYN  +  YG T +GKT+TM  
Sbjct: 430 TAQVHE--FKFDKIFDQKDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM-- 484

Query: 121 DEKLYNDELSDSAGIIPRIL---FKLFETLDLRDEDYVVKCSFVELYNEELKDLL 172
                   L+   GIIP  +   F     L  +  DY V C F+E+YNE + DLL
Sbjct: 485 --------LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score = 99.8 bits (247), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 99/177 (55%), Gaps = 18/177 (10%)

Query: 273 SPSGVYIQNLQDFHIT------SARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL 326
           +P    +  L++  IT      S    L+L+ +G RNR+V +T+ N  SSRSH +  + +
Sbjct: 214 APIACRLHGLKETTITLDDSEQSVSRVLELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRI 273

Query: 327 YREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRA--KEAGSINQSLLTLG---RVINSL 381
             +  G   +V  + L DLAGSE  S     H R    E G+IN+SL+ LG   R++N  
Sbjct: 274 T-DSMGSKARV--LTLCDLAGSERAS----VHDRGLRAEGGAINKSLMALGTVVRLLNET 326

Query: 382 ADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNI 438
              S HVP+R+SKLTRLL+ SL GN    ++ T+S +  + E++  TL++A +A  +
Sbjct: 327 GPSSTHVPYRDSKLTRLLKPSLSGNGLVTMVCTVSLSGTDYEQSLGTLRFARRASGV 383

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 51/109 (46%), Gaps = 23/109 (21%)

Query: 84  IFKEIAEPLF----GDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDSAGIIPRI 139
           IF    +PL      D + G   T++ YG T +GKTYTM G +           GI+   
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHGTKA--------EGGIVQLS 170

Query: 140 LFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYD 188
           +  L   L    ++  +  S++E+YNE L DLL D       ++LRI D
Sbjct: 171 IRDLLTQL---SKNCQITISYLEIYNERLHDLLCDGT-----KELRILD 211

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 71/194 (36%), Positives = 103/194 (53%), Gaps = 31/194 (15%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE-- 329
           DS  GV +  L      ++ + L  + KG +NR+ + T+ N  SSRSH I  I L  +  
Sbjct: 264 DSECGVRVVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKDI 323

Query: 330 HQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVIN---------- 379
             GE   +  ++L DLAGSE   R   Q++R KE   IN+SLL LG VI+          
Sbjct: 324 RTGEQ-NIRTLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSH 379

Query: 380 ----------SLADKSA-----HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 424
                     SLA  +      H+P+R+SKLTRLLQ +L G++    + TI  A  +S E
Sbjct: 380 HTGRAANSQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSE 439

Query: 425 TCSTLQYASKAKNI 438
           T +TL++AS++KN+
Sbjct: 440 TLNTLRFASRSKNV 453

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 60/109 (55%), Gaps = 12/109 (11%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D VF    +   I+ +  +PL    ++GYN T+  YGMT +GKT+TM+G E      
Sbjct: 133 FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNATIFAYGMTGSGKTFTMSGTE------ 186

Query: 129 LSDSAGIIPRILFKLFETL----DLRDEDYVVKCSFVELYNEELKDLLD 173
             +  G+IP  +  LF +L    +  +E   V  S++E+YNE++ DLLD
Sbjct: 187 --EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVSYLEIYNEKINDLLD 233

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score =  100 bits (248), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 88/146 (60%), Gaps = 6/146 (4%)

Query: 295 QLLQKGLRNRQVATTKMNDFSSRSHTIFTITL--YREHQGEMFKVSKMNLVDLAGSENIS 352
           ++L++  + R  A+T  N+ SSRSH+IF I L       G       +NLVDLAGSE I+
Sbjct: 575 RVLKRANKLRSTASTASNEHSSRSHSIFIIHLSGLNAKTGAQ-SYGTLNLVDLAGSERIN 633

Query: 353 RSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPFRESKLTRLLQDSLGGNTKT 409
            S     R +E  +IN+SL  LG VI++L    +   H+PFR SKLT LLQ SL G++KT
Sbjct: 634 ISQVVGDRLRETQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKT 693

Query: 410 ALIATISPAKINSEETCSTLQYASKA 435
            +   ISP+  +  ET ++L++ASK 
Sbjct: 694 LMFVNISPSSSHINETLNSLRFASKV 719

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 53/107 (49%), Gaps = 14/107 (13%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F      + +FKE+ + L    L GYN  +  YG T +GKT+TM          
Sbjct: 436 FKFDKIFDQRNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 484

Query: 129 LSDSAGIIPRIL---FKLFETLDLRDEDYVVKCSFVELYNEELKDLL 172
           L+   GIIP  +   F     L  +  DY V C F+E+YNE + DLL
Sbjct: 485 LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 98/184 (53%), Gaps = 20/184 (10%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYR-EH 330
           DS  GV + +L +  + S  + ++ +  G +NR+   T  N  SSRSH I  + L R E 
Sbjct: 271 DSKYGVKVVDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTRCEL 330

Query: 331 QGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL--------- 381
           +      S ++L DLAGSE   R+  Q  R KE   IN+SLL LG VI  L         
Sbjct: 331 KTGTEVTSTLSLCDLAGSE---RAVTQLVRRKEGAFINKSLLALGTVIAKLSANSAGSGS 387

Query: 382 -------ADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASK 434
                  +    H+P+R+SKLTR+LQ +L G++    I TI     ++ ET +T+++AS+
Sbjct: 388 GSNGQPPSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTVRFASR 447

Query: 435 AKNI 438
           AKNI
Sbjct: 448 AKNI 451

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 66/129 (51%), Gaps = 13/129 (10%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D VF        ++  + +P+     +GYN T+  YGMT +GKT+TM+G ++     
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTKQ----- 199

Query: 129 LSDSAGIIPRILFKLF-----ETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRK 183
                G+IP  +  +F     ET    +  Y VK S++E+YNE++ DLL  +  N ++  
Sbjct: 200 ---DPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLLSITEANGAVAS 256

Query: 184 LRIYDSGSG 192
            ++  + SG
Sbjct: 257 RQLGRNSSG 265

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 70/201 (34%), Positives = 103/201 (51%), Gaps = 35/201 (17%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE 329
           + DS  GV +  L +    S+ + L+ +  G ++R++  T  N  SSRSH I  I L   
Sbjct: 296 RDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTST 355

Query: 330 H-QGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL-ADK--- 384
           + +    + S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK   
Sbjct: 356 NVKNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMNS 412

Query: 385 ---------------------------SAHVPFRESKLTRLLQDSLGGNTKTALIATISP 417
                                      S H+P+R+SKLTRLLQ +L G++    I T+  
Sbjct: 413 VGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDT 472

Query: 418 AKINSEETCSTLQYASKAKNI 438
               + ET +TL++AS+AKN+
Sbjct: 473 RNDAAAETMNTLRFASRAKNV 493

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 72/133 (54%), Gaps = 15/133 (11%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D VF        +++  ++P+    L G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 129 LSDSAGIIPRILFKLFETLDLR----DEDYVVKCSFVELYNEELKDLLDDSVENSSMR-- 182
           L    G+IP  +  LF  +  +    D+ + V  S++E+YNE + DLL+  +E S  R  
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEESGSRIS 274

Query: 183 -KLRIYDSGSGSN 194
              R+Y S S SN
Sbjct: 275 TPSRLYMSKSNSN 287

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 103/207 (49%), Gaps = 41/207 (19%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYR- 328
           + DS  GV +  L +    S+ D L+ +  G ++R++  T  N  SSRSH I  I L   
Sbjct: 296 RDDSQYGVKVIGLTERRCESSEDLLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTST 355

Query: 329 EHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL-ADK--- 384
           + +    + S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK   
Sbjct: 356 DVRDGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTNS 412

Query: 385 ---------------------------------SAHVPFRESKLTRLLQDSLGGNTKTAL 411
                                            S H+P+R+SKLTRLLQ +L G++    
Sbjct: 413 VGSIIPTTPTSSGNSSSSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVTT 472

Query: 412 IATISPAKINSEETCSTLQYASKAKNI 438
           I T+      + ET +TL++AS+AKN+
Sbjct: 473 ICTVDTRNDAAAETMNTLRFASRAKNV 499

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 66/118 (55%), Gaps = 12/118 (10%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D VF        ++++ ++P+    L G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 129 LSDSAGIIPRILFKLFETLDLR----DEDYVVKCSFVELYNEELKDLLDDSVENSSMR 182
           L    G+IP  +  LF  +  +    D+ + V  S++E+YNE + DLL+  +E S  R
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNERIYDLLESGLEESGSR 272

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 101/313 (32%), Positives = 161/313 (51%), Gaps = 42/313 (13%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE--HQGE 333
           GV I  L +    S+ +  + +Q G +NR+ + T  N  SSRSH I  + L       GE
Sbjct: 250 GVRITGLTEKRCESSEELSRWIQIGDKNRKTSETIYNTRSSRSHAIVLVRLNNTDLRSGE 309

Query: 334 MFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVI--------------- 378
               S ++L DLAGSE   ++ +Q++R KE   IN+SLL LG VI               
Sbjct: 310 TVS-STLSLCDLAGSE---KAVSQYERRKEGAFINKSLLALGTVISKLSSESLSKNGPPT 365

Query: 379 ---NSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKA 435
               +  + + H+P+R+SKLTR+LQ +L GN+    I TI      + ET +T+++AS+A
Sbjct: 366 FTSTNPTEPNTHIPYRDSKLTRILQPALSGNSIITTICTIDTRNEAASETVNTIRFASRA 425

Query: 436 KN----IKNRPQL--RSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITN 489
           KN    +  RP +   S+  KD  ++N+T +L K    ++  K R  +  S  N  + T 
Sbjct: 426 KNVTLQVAKRPAVGTGSYNEKDQTIENLTQQLEKQHQLVMRLKQRTSMTSSSHN-DDSTV 484

Query: 490 DLESYKTEIQESKRIIE-RLSSQNSLLLKDKKASNEVNELQRIKLQNMK--DVMSGLSEK 546
           D  S  T ++   R+++ +LS+   LL KD   + E+ + + + + +M   DV S L  K
Sbjct: 485 DPNS--TLLKAENRVLKCKLSNCEKLLDKD---TIELEDSEMVAIIDMLPIDVGSVLETK 539

Query: 547 ---LESQHKKEQE 556
              LESQ ++ +E
Sbjct: 540 FQGLESQLRQYKE 552

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 63/114 (55%), Gaps = 12/114 (10%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D+VF  +     I++  + P+    L+G+N TV  YGMT +GKT+TMTG E      
Sbjct: 112 FTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTE------ 165

Query: 129 LSDSAGIIPRILFKLFETL---DLRDED-YVVKCSFVELYNEELKDLLDDSVEN 178
             D AG+IP  +  LF  +    +R    Y V  S++E+YNE++ DLLD   EN
Sbjct: 166 --DEAGLIPLSVTYLFSKILEHSMRGTSKYEVVVSYLEIYNEKIYDLLDCESEN 217

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 106/204 (51%), Gaps = 28/204 (13%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL-YREHQGE 333
           S + I+NL+  ++TS  + L   +KG   R +A       SSRS  I  IT+  R++  E
Sbjct: 187 SSISIKNLRCVYVTSLLEALSYCEKG---RSLA-------SSRSSVIIRITVEQRDNVKE 236

Query: 334 MFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA----------- 382
           +FK     LVDL  S+ I +        +    INQS++TL  V  SLA           
Sbjct: 237 VFKTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSVKNGRP 296

Query: 383 -DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK-- 439
              + ++P++ES LT+LLQ+++GGN KT L+   S AK + EET +TL + +  K +K  
Sbjct: 297 RSGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMKLVKNL 356

Query: 440 ---NRPQLRSFIMKDILVKNITAE 460
              N+    S  M D+L+K+  A+
Sbjct: 357 FQQNKAGTNSKAMLDLLMKDFDAK 380

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 63/132 (47%), Gaps = 20/132 (15%)

Query: 62  AQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGD----FLKGYNCTVLVYGMTSTGKTYT 117
           A  N K + VD++F P A      K+    + GD       GYN  ++ YG T +GKT T
Sbjct: 64  AGQNLKLFRVDQIFNPGAQT----KDTTSSIIGDSVAQLFNGYNVAIMAYGQTDSGKTST 119

Query: 118 MTGDEKLYNDELSDSAGIIPRILFKLFETLDLRDE---DYVVKCSFVELYNEELKDLLDD 174
           M G    YN       G+I  +  ++F T++   E   DY +  S +E+  E ++DLL  
Sbjct: 120 MFG----YN----KGDGVINGVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDLLAP 171

Query: 175 SVENSSMRKLRI 186
             E   + KLR+
Sbjct: 172 LSEQKPL-KLRL 182

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 97/185 (52%), Gaps = 20/185 (10%)

Query: 271 QDSPS-GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE 329
           +D P  GV +  + +    +A + ++ +  G   R+   T  N  SSRSH I  + L   
Sbjct: 236 RDDPVLGVKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITT 295

Query: 330 HQ-GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKS--- 385
           +        + ++L DLAGSE  S    Q +R KE   IN+SLL LG VI+ L+ +S   
Sbjct: 296 NLLNGTTHFNTLSLCDLAGSEKASE---QLERRKEGSFINKSLLALGTVISKLSAESNAH 352

Query: 386 ------------AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAS 433
                       +H+P+R+SKLTRLLQ +L  ++    I TI P K    ET +TL++AS
Sbjct: 353 DSSRPSSGSLNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFAS 412

Query: 434 KAKNI 438
           +AKN+
Sbjct: 413 RAKNV 417

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 78/180 (43%), Gaps = 25/180 (13%)

Query: 3   SSPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITA 62
           SSPA          ITVAVR        I+  +  V      +G   +A           
Sbjct: 80  SSPAATATRTNRATITVAVR--------IKPTAPNVDPQWHALGPRCIA----------- 120

Query: 63  QMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDE 122
             +   +  D VFGP+A  + +F E+   L      G N T+L YG T +GKTYTM G  
Sbjct: 121 HWDQGDFQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVG-- 178

Query: 123 KLYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMR 182
             +ND +    G    +  ++    D R     V  S++E+YNE++ DLL+ +  N  ++
Sbjct: 179 --HNDGIVKMCGDC--VFTRMLNAADERQVKRSVTVSYLEIYNEKICDLLNSNCRNEELK 234

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 86/145 (59%), Gaps = 5/145 (3%)

Query: 295 QLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ-GEMFKVSKMNLVDLAGSENISR 353
           QL++ G   R   +T MN+ SSRSH++F + +   ++  +     ++NLVDLAGSE + +
Sbjct: 526 QLIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHNRITQEHSTGRLNLVDLAGSERLQQ 585

Query: 354 SG--AQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTAL 411
                  +  KE  SIN+SL  L  VI+S+  +  ++PFR SKLT LL++SL   +KT +
Sbjct: 586 QEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPFRNSKLTYLLKNSLINKSKTLM 645

Query: 412 IATISPAKINS-EETCSTLQYASKA 435
              ISP  INS  ET ++L+ A K 
Sbjct: 646 YVNISP-NINSIRETINSLRLARKV 669

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 55/108 (50%), Gaps = 14/108 (12%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+FG   +   +F +I + L    L GYN  +  YG T +GKTYTM          
Sbjct: 384 FTFDKIFGMQDDNYEVFDDI-KNLVQSSLDGYNVCIFTYGQTGSGKTYTM---------- 432

Query: 129 LSDSAGIIPRILFKLFE---TLDLRDEDYVVKCSFVELYNEELKDLLD 173
           L++  GII + +  +      L     +Y ++  F+E+YNE ++DLL+
Sbjct: 433 LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNETIRDLLN 480

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 101/201 (50%), Gaps = 35/201 (17%)

Query: 270 QQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYR- 328
           + D+  GV +  L +    S+ + L+ +  G ++R++  T  N  SSRSH I  I L   
Sbjct: 296 RDDTQYGVKVIGLTERRCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTST 355

Query: 329 EHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL-ADK--- 384
           + +    + S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK   
Sbjct: 356 DLESGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKINP 412

Query: 385 ---SAHVP------------------------FRESKLTRLLQDSLGGNTKTALIATISP 417
              + H                          +R+SKLTRLLQ +L G++    I T+  
Sbjct: 413 TGSNIHTTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVDT 472

Query: 418 AKINSEETCSTLQYASKAKNI 438
               + ET +TL++AS+AKN+
Sbjct: 473 RNDAAAETINTLRFASRAKNV 493

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 73/140 (52%), Gaps = 15/140 (10%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D VF        +++  ++P+    L G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 129 LSDSAGIIPRILFKLFE-TLDLR---DEDYVVKCSFVELYNEELKDLLDDSVENSSMR-- 182
           L    G+IP  +  LF   ++L    D+ + V  S++E+YNE + DLL+  +E S  R  
Sbjct: 219 L----GLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNERIYDLLESGLEESLSRPS 274

Query: 183 -KLRIYDSGSGSNSNSGSRK 201
              R+Y     SN  S   K
Sbjct: 275 TPSRLYMGKGNSNGLSAELK 294

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 112/230 (48%), Gaps = 32/230 (13%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ-GEM 334
           G  ++NL+   + +  +   L+   L N++    + N+   RSHTI  +++ + ++  E 
Sbjct: 192 GFQVENLRTTQVLTLEELKILINICLLNQK---ERHNNLIQRSHTIMEVSIEKRNKLDES 248

Query: 335 FKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA----------DK 384
             +S + +VDLAGS+ I ++ +     ++A  IN  + ++  VIN L           D 
Sbjct: 249 ITMSSLYIVDLAGSDPIGKNSSSGITTEDAKKINHQIKSVNDVINGLVVMNREGGIMTDI 308

Query: 385 SA---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
           S     VP++ S LTRLL D LGGN KT  + T S  K +  ET STL++    K+    
Sbjct: 309 STLMHKVPYKSSILTRLLLDPLGGNCKTTFLLTSSLKKNDWNETLSTLKFGYNCKSANTN 368

Query: 442 PQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDL 491
           P++  F +            +K   D+  T ++    + +DN+  ITN+L
Sbjct: 369 PRINRFGLN-----------SKATMDIFLTDMK----LKEDNFISITNNL 403

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 79/153 (51%), Gaps = 22/153 (14%)

Query: 51  AINTTDD--VGITA-QMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVY 107
           +IN TD    G +  Q+ +  Y  DKVF  S +  +  +E  E      L+GYN +++ Y
Sbjct: 52  SINFTDTQLTGFSKDQVVNTQYKFDKVFA-SNDTGVEHQEFIESNLESLLQGYNTSIVTY 110

Query: 108 GMTSTGKTYTMTGDEKLYNDELSDSAGIIPRILFKLFETLDL------RDEDYVVKCSFV 161
           G + TGK++ + G+++          G+I ++L KLF  +D       ++  Y VK SF+
Sbjct: 111 GQSGTGKSFELYGEQQ---------DGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKFSFL 161

Query: 162 ELYNEELKDLLDDSVENSSMRKLRIYDSGSGSN 194
           E+Y E++ DL+D     S  + L+I DS    N
Sbjct: 162 EVYQEKMFDLMDSP---SVKKHLKINDSTYAMN 191

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 110/231 (47%), Gaps = 16/231 (6%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYR-EHQGEM 334
           G+ + NL+  H+ S ++ L    + +    V  +K ++   R++TIF I + + +   E 
Sbjct: 208 GLPVDNLRQVHVASFKETLYYFNQAM---SVLNSKHDNSFPRTNTIFNINIEKLDKLDES 264

Query: 335 FKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAH------- 387
              S + LVDLAGS+ I R  +    +++   IN S+ ++  +I SL+  S         
Sbjct: 265 TTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKNYEF 324

Query: 388 -----VPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRP 442
                VP+  SKL +LL++ LGGN KT  + TIS      ++    LQ  +  ++ K  P
Sbjct: 325 SLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSKTVP 384

Query: 443 QLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLES 493
           Q+  F + +    +I  E  K+K +    +  E V   ++    ITN  ES
Sbjct: 385 QINKFGLNENKTLSIALENFKLKENNFKIQQAESVKQIEELKSIITNKEES 435

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 61/112 (54%), Gaps = 14/112 (12%)

Query: 68  TYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYND 127
           ++    +F   +N  LI   I   +  + ++GYN  ++ YG   +GKTY+      LY +
Sbjct: 83  SFEFTHIFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYS------LYGN 136

Query: 128 ELSDSAGIIPRILFK-LFETLDLRDED------YVVKCSFVELYNEELKDLL 172
           ++ DS G + +I+FK LF  ++    D      ++VK SF+E++ +++ DLL
Sbjct: 137 DVDDSFG-LGQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVWLDKVVDLL 187

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 66/127 (51%), Gaps = 12/127 (9%)

Query: 50  VAINTTDDVGITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGM 109
           V   T + +  T +    T+  DKVF  +A Q+ + K +  P+  D L GYN TV+ YG 
Sbjct: 56  VLFRTNNPLHETTKETHSTFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITYGP 115

Query: 110 TSTGKTYTMTGDEKLYNDELSDSAGIIPRILFKLFETLDLRDE----DYVVKCSFVELYN 165
           + +GK+Y++ G +        +S GI+P I   LF+TL+  +E     + V     E+Y 
Sbjct: 116 SFSGKSYSLIGSK--------ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEIYM 167

Query: 166 EELKDLL 172
           E+  DLL
Sbjct: 168 EKTYDLL 174

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 100/220 (45%), Gaps = 30/220 (13%)

Query: 279 IQNLQDFHITSARDGLQLLQ--KGLRNRQVATTKMNDFSSRSHTIFTITL-YREHQGEMF 335
           I+++   H+ S  D    +Q  + + NR     K     SRSH +F + +  R  + ++ 
Sbjct: 196 IKDICPAHVGSYEDLRSYIQAVQNVGNRMACGDKTE--RSRSHLVFQLHVEQRNRKDDIL 253

Query: 336 KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADK----------S 385
           K S + LVDL G+E   +             +NQS+  L   + SL+ K          S
Sbjct: 254 KNSSLYLVDLHGAEKFDKRTESTLSQDALKKLNQSIEALKNTVRSLSMKERDSAYSAKGS 313

Query: 386 AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLR 445
               +RES+LT +L+DSLGGN KT +I T   + + +  T STL++    + I N+    
Sbjct: 314 HSSAYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT--TLSTLEFGDSIRQINNK---- 367

Query: 446 SFIMKDILVKNITAELAKVKSDLL--STKLREGVYMSQDN 483
                  +  N T    K K DL     K+++  Y++Q N
Sbjct: 368 -------VTDNTTGLNLKKKMDLFIQDMKIKDDNYVAQIN 400

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 58/125 (46%), Gaps = 14/125 (11%)

Query: 53  NTTDDVGITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTST 112
           N T  + I  +     +  D+ FG   + + IF EI + L    L GYN  +  YG T +
Sbjct: 392 NGTQCITIKREAKYHKFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGS 450

Query: 113 GKTYTMTGDEKLYNDELSDSAGIIPRILFKLF---ETLDLRDEDYVVKCSFVELYNEELK 169
           GKTYTM          L+   GIIP  L  +F   E L      Y +   F+E+YNE +K
Sbjct: 451 GKTYTM----------LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIK 500

Query: 170 DLLDD 174
           DL  D
Sbjct: 501 DLFKD 505

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 58/125 (46%), Gaps = 14/125 (11%)

Query: 53  NTTDDVGITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTST 112
           N T  + I  +     +  D+ FG   + + IF EI + L    L GYN  +  YG T +
Sbjct: 392 NGTQCITIKREAKYHKFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGS 450

Query: 113 GKTYTMTGDEKLYNDELSDSAGIIPRILFKLF---ETLDLRDEDYVVKCSFVELYNEELK 169
           GKTYTM          L+   GIIP  L  +F   E L      Y +   F+E+YNE +K
Sbjct: 451 GKTYTM----------LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIK 500

Query: 170 DLLDD 174
           DL  D
Sbjct: 501 DLFKD 505

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 59/109 (54%), Gaps = 12/109 (11%)

Query: 68  TYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYND 127
           T+  DKVF  +A Q+ +   + +P   D L GYN T+L YG + +GK+Y++ G +     
Sbjct: 75  TFQFDKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFSGKSYSLIGPQ----- 129

Query: 128 ELSDSAGIIPRILFKLFETLDLRDE----DYVVKCSFVELYNEELKDLL 172
              D  GI+P I   LF TL+ R++    ++ V     E+Y E+  DLL
Sbjct: 130 ---DGGGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYMEKTYDLL 175

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 71/137 (51%), Gaps = 13/137 (9%)

Query: 316 SRSHTIFTITL-YREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTL 374
           SRSH +F + +  R  + ++ K S + L+DL G+E   +             +NQS+  L
Sbjct: 234 SRSHVVFQLHVEQRNRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKKLNQSIEAL 293

Query: 375 GRVINSL---------ADKSAHVP-FRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 424
              + SL         + K++H   +RES+LT +L+DSLGGN KT +I T   + + +  
Sbjct: 294 KNTVQSLEIKSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 351

Query: 425 TCSTLQYASKAKNIKNR 441
           T STL++    + I NR
Sbjct: 352 TLSTLKFGDSIRQINNR 368

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 60/109 (55%), Gaps = 12/109 (11%)

Query: 68  TYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYND 127
           T+  DKVF  +A Q+ +   +  P   D L GYN T+L YG + +GK+Y++ G +  YN+
Sbjct: 74  TFQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFSGKSYSLLGSQ--YNE 131

Query: 128 ELSDSAGIIPRILFKLFETLDLRDE----DYVVKCSFVELYNEELKDLL 172
                 G++P I   LFETL+  +E    ++ V     E+Y E+  DLL
Sbjct: 132 ------GVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYMEKSYDLL 174

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 100/208 (48%), Gaps = 37/208 (17%)

Query: 316 SRSHTIFTITL-YREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTL 374
           S+SH +F + +  R  + ++ K S + L+DL G+E   +             +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALKKLNQSIEAL 292

Query: 375 GRVINSLA---------DKSAHVP-FRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 424
             ++  LA          K++H   +RES+LT +L+DSLGGN K  +I T   + + +  
Sbjct: 293 KNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLSNVPT-- 350

Query: 425 TCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLL--STKLREGVYMSQ- 481
           T STL++    + I N+           ++ + T    K K DL     K+++  Y+SQ 
Sbjct: 351 TISTLEFGDNIRQIINK-----------VMSSTTGLNMKKKMDLFVQDMKIKDDNYVSQI 399

Query: 482 -------DNYKEITND---LESYKTEIQ 499
                  D+ K+++N+    E  KTE++
Sbjct: 400 NILKSELDSLKDLSNESSSREDMKTELE 427

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 67/128 (52%), Gaps = 15/128 (11%)

Query: 68  TYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYND 127
           T+  DKVF  +A Q+ +   +  P   D L GYN T++ YG + +GK+Y++ G +     
Sbjct: 74  TFKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIITYGPSFSGKSYSLLGSQ----- 128

Query: 128 ELSDSAGIIPRILFKLFETLDLRDE----DYVVKCSFVELYNEELKDLLDDSVENSSMRK 183
              +  GI+P I   LFETL+   E    ++ V     E++ E+  DLL   V  ++ + 
Sbjct: 129 ---EGEGILPNICKVLFETLEKNKETKGNNFSVSVLAFEIFMEKTYDLL---VPLTNRKP 182

Query: 184 LRIYDSGS 191
           L+++ S S
Sbjct: 183 LKLHRSSS 190

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 110/235 (46%), Gaps = 36/235 (15%)

Query: 279 IQNLQDFHITSARDGLQLLQKGLRNRQVATTKM----NDFSSRSHTIFTITL-YREHQGE 333
           I+++   HI S +D    L+  +++ Q    +M    N   S+SH +F + +  R    +
Sbjct: 196 IKDICPAHIRSYKD----LKSYIQSVQNTDNRMGYSGNTERSKSHLVFQLHVEQRNRNAD 251

Query: 334 MFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADK--------- 384
           + + S + L+DL G+E   +             +NQS+  L  ++  L+ K         
Sbjct: 252 ILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEALKNIVRLLSVKDRDSAYSVK 311

Query: 385 -SAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQ 443
            S    +RES+LT +L+DSLGGN KT +I T   + +++  T STL++    + I N+  
Sbjct: 312 ASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVST--TLSTLEFGECIRQITNK-- 367

Query: 444 LRSFIMKDILVKNITAELAKVKSDLL--STKLREGVYMSQDNYKEITNDLESYKT 496
                    ++ N T    K K DL     K+R+  Y S+ N   +  +++S KT
Sbjct: 368 ---------VIDNTTGLNLKKKMDLFIEDMKIRDNNYASRINI--LKAEIDSLKT 411

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 141/294 (47%), Gaps = 39/294 (13%)

Query: 278 YIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREH---QGEM 334
           +++NL    I S  D  +  + G +              RS++I    ++ E    + ++
Sbjct: 205 HVKNLSHIQIASLDDLQKWFKIGCQRSSAIINAGTAKEKRSNSIIISKIHLEQVNPKDQL 264

Query: 335 FKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPF---- 390
           +K+S ++ +DL G +  ++   Q     E   +N  + +   +I +L+D  + +P+    
Sbjct: 265 YKLSTLSFIDLYGIDKFTKKDIQLTN-DEMKKLNTLMSSFQNLITTLSDPKS-LPYTSSL 322

Query: 391 -RESKLTRLLQDSLGGNTKTALIATI-SPAKINSEETCSTLQYASKAKNIKNRPQLRSF- 447
            ++S L ++LQD +GGN+KT  I    SP+ I  EE    L++A   K+IKN   +  F 
Sbjct: 323 YKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELIEMLKFAMGLKSIKNPLIMNVFG 382

Query: 448 --IMKDILV---------KNITAELAKVKSDL-LSTKLREGVYMSQDNYKEITNDLES-- 493
             + K +L+         +N   ++  ++S+L L  KL E V  + D+++E  ND  S  
Sbjct: 383 LNLQKQMLLFIKSSKLREENCQTKINYLQSELALKNKLLEPV--ATDHHEENYNDESSCS 440

Query: 494 -------YKTEIQESKRIIERLS-SQNSLLLKDKKASNEVNELQRIKLQNMKDV 539
                   K +I+  ++++E +S S+N    K K  +NE +EL +  +   +DV
Sbjct: 441 DKETIMKLKLKIESLEQVLEHISTSENP---KSKTETNEHDELLKKLMDKCEDV 491

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 63/109 (57%), Gaps = 10/109 (9%)

Query: 67  KTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 126
           +T+++DKVF PSA+Q  +   +  P+  +   G N  +   G + TGKT+TM G + +  
Sbjct: 42  RTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTMLGQQGV-- 99

Query: 127 DELSDSAGIIPRILFKLFETLDLRDEDYVVKCSF--VELYNEELKDLLD 173
                S G++ RIL K+F+ ++  +E   V+ S   VEL N+++ DLL+
Sbjct: 100 -----SQGLLQRILTKVFQLMN-ENEGVTVQYSLSAVELVNDKVYDLLN 142

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 83/170 (48%), Gaps = 18/170 (10%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREH-QGE 333
           S + I+NL+  ++ S  +    L +G  NR      M   +SRS+ +  I L +   + +
Sbjct: 235 SSLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVIKINLEQVFLEDQ 289

Query: 334 MFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRE- 392
           + K S + L+D+A S+ I ++ +    AKEA  +N  + +    IN LA+ +   P+ + 
Sbjct: 290 LMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAE-TGTSPYDQQ 348

Query: 393 ----------SKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYA 432
                     S L  ++   +GGN KT  I+TISP   N  ET  TL+ +
Sbjct: 349 INGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITLRIS 398

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 69  YAVDKVFGPSANQQ-LIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKL 124
           + VDKVF     Q  L+  +I +    +   G+N +++ +G + TGK++TM G+  L
Sbjct: 51  FQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQSGTGKSFTMFGNNSL 107

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 106/212 (50%), Gaps = 25/212 (11%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMF 335
           G +I++L   H+TS  +    L+ G +N     + ++   S+    F +    + + ++ 
Sbjct: 196 GDHIRDLHQIHVTSPIEIKDTLKNGYKN----ISPLHHSKSQIFVRFEVQCI-DRKDDVT 250

Query: 336 KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADK----SAHVPFR 391
           + S +  +DL GS+ +++  A    + +    NQ +  L  +I +L ++    S+H  F+
Sbjct: 251 RCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSH--FK 308

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMK- 450
           +S L ++L D LGG+TK  L+  I       E+    ++  +KAK IKN P +    +  
Sbjct: 309 DSSLNKILMDYLGGDTKMTLVVAIDGNTGGYED---AVKLGAKAKLIKNYPTMNKIGLNA 365

Query: 451 ----DILVKNITAE----LAKVKSDLLSTKLR 474
               D+LV+++  +    LAK+  +LL T+++
Sbjct: 366 KRKMDLLVQDMNVKEQNYLAKI--NLLQTEIK 395

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 54/104 (51%), Gaps = 6/104 (5%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           Y  D +F   + +   +  I + L  D  KGYN T++ YG TS+GK++ + GD    ND 
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPDSTNDG 145

Query: 129 LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLL 172
           L +   I  R+LF   E  +L+    +   S  ELY +++ DLL
Sbjct: 146 LINH--IADRLLFPQCED-NLK---TLCSISMWELYIDKVYDLL 183

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 66/164 (40%), Gaps = 50/164 (30%)

Query: 66  SKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLY 125
           S  Y  DK+F P      I   ++     D  KGYN T + YG T TGKTYT+ G    +
Sbjct: 55  SNQYRFDKIFEPEKPDDEINSTLSFACINDLFKGYNSTYISYGQTGTGKTYTLYG--TAF 112

Query: 126 NDELSD-----------------------------------------SAGIIPRILFKLF 144
           ND  +D                                         + G+I ++   LF
Sbjct: 113 NDTPTDLDSKNINTNKNVKNDSNISSNSNIQTSASSNKSANSILQKKNYGLISKVGNDLF 172

Query: 145 ETLD-----LRDEDYVVKCSFVELYNEELKDLL--DDSVENSSM 181
           E +D      +   ++V  SFVE+Y EE+ DLL  DD++ N  +
Sbjct: 173 EMIDQIRAIRKGITFLVNISFVEVYKEEVYDLLQHDDTLSNKKL 216

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 71/133 (53%), Gaps = 5/133 (3%)

Query: 317 RSHTIFTITLYREHQGEMFKV-SKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLG 375
           RS TI  I L +  + E  +  S +  VDLAGS+  S+   +    + A   N+ + +L 
Sbjct: 265 RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAASKYNRVMDSLN 324

Query: 376 RVINSLADKSA----HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQY 431
            ++ +LA+  +       +R S LTR+L D L GN KT LI + S  K +  ET STL +
Sbjct: 325 SMVYTLANSESISINKSIYRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFSTLGF 384

Query: 432 ASKAKNIKNRPQL 444
           +S A ++ N+ ++
Sbjct: 385 SSYASSMSNQIKI 397

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 55/112 (49%), Gaps = 20/112 (17%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGD----FLKGYNCTVLVYGMTSTGKTYTMTGDEKL 124
           +  +KV+     QQ    E+ E + GD     L G+N +++ +G   +GKTYTM G++  
Sbjct: 68  FRFNKVYDVGVRQQ----EVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGNDH- 122

Query: 125 YNDELSDSAGIIPRILFKLFETLDLRDED----YVVKCSFVELYNEELKDLL 172
                    GI+ R+   +F+ LD   ED      +  +F EL+ E + DLL
Sbjct: 123 -------EEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLL 167

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 82/358 (22%), Positives = 161/358 (44%), Gaps = 50/358 (13%)

Query: 316 SRSHTIFTITL-YREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTL 374
           SRS     IT+  R  + E  K S + L+DLA S+ + ++        E  S N S+  L
Sbjct: 224 SRSSAFLNITVEQRNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNL 283

Query: 375 GRVINSLAD--------KSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETC 426
            +V+  L++         S+    R S+L + LQ ++GG++KT  +   S  K + E T 
Sbjct: 284 HQVVYGLSELESPSSKNHSSKHTHRTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRENTV 343

Query: 427 STLQYASKAKNIKNRP-----QLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQ 481
            TL   S+ ++I N P      L S  + D+ +KN++      + D   T+++   Y+ +
Sbjct: 344 ITLSLGSRLRSIHNFPVQNKMGLNSKALLDLRLKNMS-----TREDSYLTRIK---YL-E 394

Query: 482 DNYKEITNDLESYKTEIQESKRIIE---RLSSQNSLLLKDKKASNEVNELQRIKLQNMKD 538
           D   ++   ++  K ++  +K + E   +L  Q  L  K ++     +E + +  Q    
Sbjct: 395 DEVSKLGGTIQQNKNQVSTNKSLTEKNMKLMDQLELYRKSQQTQKSGSEEENLTSQQNGR 454

Query: 539 VMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKE--YGQREKQISERMQMILGQE 596
           + + +SE L++  +K + ++ +   L   L     + ++  Y + + Q  E M + L   
Sbjct: 455 IQNEMSEVLDNLMEKCERVIQLQMRLDEELRQKSQMSQQLNYKESKAQALEAMNVKL--- 511

Query: 597 FLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKM 654
                      +E + TN        E E   +    ++LR+E+ + + +A+ R+EK+
Sbjct: 512 -----------LEQLNTN--------ENEMRNVLNTNSILRKEMEKWMHVAKTRSEKI 550

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 91/200 (45%), Gaps = 31/200 (15%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTIT---LYREHQG 332
           G+Y Q   + +I S ++  ++++    N++ +  KM+   S SH +   +   L R H  
Sbjct: 205 GLYYQEANNEYINSIKEFDRVMKLIQDNKEASEKKMDSKRSTSHVVIRCSVEQLDRVHG- 263

Query: 333 EMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL----------- 381
                S +   DL GS    +   Q    +    +N S+  L  V+NS+           
Sbjct: 264 -TITSSNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLESVVNSVLQNQQKNHLYI 322

Query: 382 ---------ADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYA 432
                    +     VP+++S+LT L+Q++LGGN++T ++      K + EET +TL++ 
Sbjct: 323 ENKLVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETIATLRFG 382

Query: 433 SKAKNIKNRPQLRSFIMKDI 452
            + +NI N      F+  D+
Sbjct: 383 VQLQNILN------FVRADV 396

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 8/84 (9%)

Query: 53  NTTDDVGITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTST 112
           NT     IT   +   +  +KV+        I K ++E +  D   GY+ +++ YG   +
Sbjct: 71  NTIIHYPITNFADESIFNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGS 130

Query: 113 GKTYTMTGDEKLYNDELSDSAGII 136
           GK++T+ G+E        DS GII
Sbjct: 131 GKSFTLFGNE--------DSDGII 146

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 114/249 (45%), Gaps = 22/249 (8%)

Query: 266 QREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDF--SSRSHTIFT 323
             E +QD     Y ++L    +TS  + +  +     NR   +    ++   S+SH I  
Sbjct: 169 HHETKQDDE--YYFKDLHVAFVTSRDELINYIMDAESNRFSGSCLHTNYVQRSKSHLITK 226

Query: 324 ITLYREHQGE-MFKVSKMNLVDLAGSENISRSG--AQHQRAKEAGSINQSLLTLGRVINS 380
           I + + +  E + K   ++  DLA  + I +    +    + E   +N    TL   I S
Sbjct: 227 INVEQRNLNEDVVKRGSISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLESTTLKNSIIS 286

Query: 381 LADKS----AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAK 436
           +++ S    A +P++ S LT+LL     GN KT +I T S  K N  ET  TL+   K +
Sbjct: 287 MSELSENPNAVIPYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLETLKMGLKLE 346

Query: 437 NIK-----NRPQLRSFIMKDILVKNITAELAKV--KSDLLSTKLREGVYMSQDNYKEITN 489
           +I      N+  L S    D++V+++ ++ A    +  LL T+L +     + +Y E  +
Sbjct: 347 SISSNVHMNKHALNSKKKLDLIVEDMKSKEANYMNRIRLLETELND----LRASYGEAIS 402

Query: 490 DLESYKTEI 498
           +  S+K E+
Sbjct: 403 ETSSFKEEM 411

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 43/91 (47%), Gaps = 8/91 (8%)

Query: 84  IFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDSAGIIPRILFKL 143
           ++  I   L  +  +GY+  V+ YG   TGK+    G +  Y        G++   +  L
Sbjct: 75  LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTY------EGGVVLMFVQDL 128

Query: 144 FETLDL--RDEDYVVKCSFVELYNEELKDLL 172
           ++ +D    D  + V  S +E++ E++ DLL
Sbjct: 129 YDKIDSIGNDTHFTVSLSTIEIHLEKMYDLL 159

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 58/125 (46%), Gaps = 6/125 (4%)

Query: 52  INTTDDVGITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTS 111
           + T +D  +  ++  ++++  KV    A +   F E+A  +  D L G NC V  YG   
Sbjct: 75  VQTVNDTVV--KLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINCCVTTYGSGL 132

Query: 112 TGKTYTMTGDEKLYNDELSDS---AGIIPRILFKLFETLDL-RDEDYVVKCSFVELYNEE 167
              +  M G +   + E  DS   +G++ +    +F  +D     +Y V  S  E+Y ++
Sbjct: 133 AADSLVMFGPQSGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSLSLCEVYVDK 192

Query: 168 LKDLL 172
           + DLL
Sbjct: 193 VFDLL 197

>KAFR0B00590 Chr2 complement(117951..121736) [3786 bp, 1261 aa] {ON}
           Anc_7.488 YBL047C
          Length = 1261

 Score = 39.7 bits (91), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 65/133 (48%), Gaps = 14/133 (10%)

Query: 480 SQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLK---DKKA-------SNEVN--- 526
           S++   E+T    +   E QE K  I + + QN+LLL    +K+A         +VN   
Sbjct: 629 SENKMNEVTLQFNNATRENQELKAKISQFNEQNNLLLSQLNEKQALLQKEMSIADVNRKQ 688

Query: 527 -ELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQI 585
            EL  I + N+ + +SGL EKL+    K  EL D    L+S  +  +    +  +RE Q+
Sbjct: 689 VELNDITVANLTNEISGLDEKLQIFISKTNELNDYQKTLESKHAQLEDKYNDLNERESQL 748

Query: 586 SERMQMILGQEFL 598
           +ER + I  QE L
Sbjct: 749 NERTKQIEEQEQL 761

>NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401
          Length = 874

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 60/127 (47%), Gaps = 15/127 (11%)

Query: 292 DGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKV---------SKMNL 342
           D ++LL    +N  V +  +N     S T   + L +  Q   F+          S+  +
Sbjct: 372 DAIELLGSTFKNLSVRSYAVNRLKKASDTELELYLLQLVQAVCFENISTFSDKTNSEFTI 431

Query: 343 VDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL-ADKSAHV--PFRESKLTRLL 399
           VD+ G++++ +S     +  E   +N SLLTLG+ IN+L  D+   V  P  E  + R L
Sbjct: 432 VDMNGTQHLGKSQNVMPKTTE---LNSSLLTLGKSINNLNLDEMPIVISPLAEFLIRRAL 488

Query: 400 QDSLGGN 406
           ++S  GN
Sbjct: 489 KNSRLGN 495

>TBLA0B05100 Chr2 complement(1199537..1200772) [1236 bp, 411 aa]
           {ON} Anc_6.195 YGL082W
          Length = 411

 Score = 35.0 bits (79), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 54/110 (49%), Gaps = 17/110 (15%)

Query: 111 STGKTYTMTGDEKL-------YNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVEL 163
           +T +T +  G+E+        +++EL+DS G +P  +    +   +RD++ + +     L
Sbjct: 272 TTTQTSSGAGNERANSNNTDPFDEELADSVGELPGAIINNSDNQQIRDDEALARA----L 327

Query: 164 YNEELKDLLDDSVENSSMRKLRI------YDSGSGSNSNSGSRKNSRNNS 207
             EE     + +  N S+   R       Y  GSG+NSN GSR  SR+NS
Sbjct: 328 QEEENNARRERAQRNRSLNVSRTRSSNNNYPYGSGNNSNDGSRGLSRSNS 377

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 78/177 (44%), Gaps = 28/177 (15%)

Query: 264 QQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFT 323
           QQQ+  + DS  G  ++ L++  ++S  +    LQ  L     A   + + +  +    +
Sbjct: 151 QQQKSLKWDSTIGA-VKGLKEVFVSSRCE----LQDYLN----AACDLQNSTFHTFVKIS 201

Query: 324 ITLYREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLAD 383
           + L   H+ + F+   +  VDL   E++                 Q + +L  V+++  D
Sbjct: 202 LQLVNCHE-DSFRKCCIEFVDLCAQEDVL----------------QLVCSLVAVLSNDND 244

Query: 384 KSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKN 440
           K   +   +S+  +LL +S+GGN KT  I   S  + N + +  TL++  K   + N
Sbjct: 245 KK--IGKEKSQFCKLLSNSIGGNRKTTFILACSTLEQNEKISLETLEFGLKVSQVVN 299

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 14/59 (23%)

Query: 90  EPLFGD----FLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDSAGIIPRILFKLF 144
           EPL  D      +G +C+++ YG ++TGKT+ +               GIIP  + +L+
Sbjct: 66  EPLVIDNINELTRGVDCSMVTYGQSATGKTHVL----------FDQVRGIIPLFIEQLY 114

>ZYRO0G04444g Chr7 complement(355149..358784) [3636 bp, 1211 aa]
           {ON} uniprot|Q9P8F2 Zygosaccharomyces rouxii rga1
           Pheromone response protein
          Length = 1211

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 20/29 (68%), Gaps = 1/29 (3%)

Query: 244 QHQLREQQQREQ-QAQQQQKEQQQREQQQ 271
            H  REQ QREQ Q +Q Q+EQ QREQ Q
Sbjct: 802 HHPQREQSQREQTQREQTQREQPQREQPQ 830

>Ecym_6476 Chr6 (921068..923620) [2553 bp, 850 aa] {ON} similar to
           Ashbya gossypii ABL193C
          Length = 850

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 81/163 (49%), Gaps = 28/163 (17%)

Query: 453 LVKNITAELAKVKSDLLSTKLREGV----------YMSQD-----NYKEITNDLESYKTE 497
           L+ NI +EL  +K+  L+ KL+E +          Y++++     N KE+  D++ +   
Sbjct: 533 LLNNIKSELEPLKA--LNLKLKEELESKLKDTKDHYVTKESNMKENIKELQEDVKVHLAN 590

Query: 498 IQESKRIIERLSSQNSLLLKDKKA--------SNEVNELQRIKLQNMKDVMSGLSEKLES 549
           I++S+ +IE L    + L+K+K+         S  ++ELQ  +LQ  +     L EK + 
Sbjct: 591 IKKSQDVIESLHKDIAALIKEKEELLNKNAELSKRISELQESQLQRDRSTFLDLCEKNQD 650

Query: 550 QHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMI 592
             +   EL+  + +L++ L    S    Y + E +ISE+  ++
Sbjct: 651 LLQSNHELITKSRDLEAELVAANS---NYQELESKISEKDSLL 690

>Smik_2.67 Chr2 complement(121714..125847) [4134 bp, 1377 aa] {ON}
           YBL047C (REAL)
          Length = 1377

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 72/154 (46%), Gaps = 28/154 (18%)

Query: 473 LREGVYMSQDNY-------KEITNDLESYKTEIQESKRIIERLSSQNSLL---------- 515
           L + + +S+ NY        E+TNDL+  + +  E K  I  L+S  + L          
Sbjct: 675 LTQQLAVSEANYHAAESKLNELTNDLQESQAKNAELKEQITNLNSMTASLQSQLNEKQQH 734

Query: 516 LKDKKASNEVN----ELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
           +K +++  +VN    EL +I + N++  + GL EK+     K++EL D    ++   +  
Sbjct: 735 VKQERSMVDVNSKQLELSQITVVNLQKEIEGLGEKITVYLTKQKELNDYQKTVEEQHAQL 794

Query: 572 QSVIKEYGQ-------REKQISERMQMILGQEFL 598
           Q+  +E          REKQ+ ER + I  QE L
Sbjct: 795 QAKYQELSNKDTDLSDREKQLEERNKQIEEQEDL 828

>Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON}
           YBL047C (REAL)
          Length = 1380

 Score = 32.7 bits (73), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 72/154 (46%), Gaps = 28/154 (18%)

Query: 473 LREGVYMSQDNY-------KEITNDLESYKTEIQESKRIIERLSSQNSLL---------- 515
           L + + +S+ NY        E+T DL+  +T+  E K  I  L+S  + L          
Sbjct: 677 LTQQLAVSEANYHAAESKLNELTTDLQESQTKNAELKEQITNLNSMTASLQSQLNEKQQH 736

Query: 516 LKDKKASNEVN----ELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
           +K +++  +VN    EL +I + N++  + GL EK+     K++EL D    ++   +  
Sbjct: 737 VKQERSMIDVNSKQLELNQITVVNLQKEIDGLGEKIGVYLTKQKELNDYQKTVEEQHAQL 796

Query: 572 QSVIK-------EYGQREKQISERMQMILGQEFL 598
           QS  +       +   REKQ+ ER + I  QE L
Sbjct: 797 QSKYQDLSNKDNDLADREKQLEERNKQIEEQENL 830

>KLTH0C02486g Chr3 complement(217025..224428) [7404 bp, 2467 aa]
           {ON} highly similar to uniprot|P32600 Saccharomyces
           cerevisiae YKL203C TOR2 putative
           protein/phosphatidylinositol kinase involved in
           signaling activation of translation initiation
           distribution of the actin cytoskeleton and meiosis
           phosphatidylinositol kinase homolg
          Length = 2467

 Score = 32.7 bits (73), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 28/139 (20%), Positives = 59/139 (42%), Gaps = 13/139 (9%)

Query: 638 QEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSD 697
           Q + + + + Q+R  K+ K W +++ E      Q   N  + +  T+  Y Q L+   S 
Sbjct: 275 QTLYKCMAIIQERDSKLTKKWFQRLFEGCAYGLQLNGN--EAIHATLLVYRQLLSLQGSH 332

Query: 698 ISEGYNNLKQY---FNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKD 754
           + E ++ + +    + DH +    +E+        Y  L   A    Q F     DH+  
Sbjct: 333 LQEQFDEMYEMTMRYKDHKYNVIRKEI--------YAILPLLASADPQLFTDKYLDHVMI 384

Query: 755 NKTLMMKSLQSATTEAIDK 773
           +   ++K++ ++ T   D+
Sbjct: 385 HYLTLLKNMHASPTNNSDR 403

>KAFR0C03650 Chr3 complement(744293..744931) [639 bp, 212 aa] {ON}
           Anc_8.8 YFL046W
          Length = 212

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 459 AELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQE 500
            + AK+K  LLS+  +E  Y  Q+ Y+ + NDLE  KT+++E
Sbjct: 93  VDFAKLKDQLLSSDRKE-FYNLQNEYERVHNDLEKMKTKLKE 133

>TBLA0J01910 Chr10 (448704..454556) [5853 bp, 1950 aa] {ON}
           Anc_7.154 YER008C
          Length = 1950

 Score = 32.3 bits (72), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 30/48 (62%)

Query: 232 KQQHQWQQRREQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYI 279
           KQ+   + RR+Q+ QL  Q+++ QQ +QQ+K QQ  E Q++    V +
Sbjct: 805 KQREDVELRRKQEKQLELQKEQLQQIEQQRKHQQYMEHQKNEQENVTV 852

>YBL047C Chr2 complement(127895..132040) [4146 bp, 1381 aa] {ON}
           EDE1Endocytic protein; involved in a network of
           interactions with other endocytic proteins, binds
           membranes in a ubiquitin-dependent manner, may also bind
           ubiquitinated membrane-associated proteins; interacts
           with Cmk2 and functions upstream of CMK2 in regulating
           non-apoptotic cell death
          Length = 1381

 Score = 32.3 bits (72), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 72/154 (46%), Gaps = 28/154 (18%)

Query: 473 LREGVYMSQDNY-------KEITNDLESYKTEIQESKRIIERLSSQNSLL---------- 515
           L + + +S+ NY        E+T DL+  +T+  E K  I  L+S  + L          
Sbjct: 679 LAQQLAVSEANYHAAESKLNELTTDLQESQTKNAELKEQITNLNSMTASLQSQLNEKQQQ 738

Query: 516 LKDKKASNEVN----ELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
           +K +++  +VN    EL ++ + N++  + GL EK+     K++EL D    ++   +  
Sbjct: 739 VKQERSMVDVNSKQLELNQVTVANLQKEIDGLGEKISVYLTKQKELNDYQKTVEEQHAQL 798

Query: 572 QSVIKEYGQ-------REKQISERMQMILGQEFL 598
           Q+  ++          REKQ+ ER + I  QE L
Sbjct: 799 QAKYQDLSNKDTDLTDREKQLEERNRQIEEQENL 832

>KNAG0E02200 Chr5 complement(442946..447022) [4077 bp, 1358 aa] {ON}
           Anc_2.406 YMR129W
          Length = 1358

 Score = 32.3 bits (72), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 38/80 (47%), Gaps = 7/80 (8%)

Query: 407 TKTALIATISPAKINSEETCSTLQYASKAKNI--KNRPQLRSFIMKDILVKNITAELAKV 464
           TK +LI  I+    N  E    L Y +K   +  K RPQ    I  D LV ++ AEL   
Sbjct: 551 TKKSLIIKIN----NGAEEQEDLPYTAKISFVDSKGRPQESKMIELDSLVHHVNAELPGT 606

Query: 465 KS-DLLSTKLREGVYMSQDN 483
            + D +S+K   GV + + N
Sbjct: 607 YNLDFVSSKFCPGVVIGKSN 626

>Skud_2.55 Chr2 complement(111625..115797) [4173 bp, 1390 aa] {ON}
           YBL047C (REAL)
          Length = 1390

 Score = 32.0 bits (71), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 76/162 (46%), Gaps = 29/162 (17%)

Query: 473 LREGVYMSQDNYKEITNDLESYKTEIQESK----RIIERLSSQNSLL------------- 515
           L + + +S+ NY    + L    T++QES+     + E++ + NS+              
Sbjct: 678 LSQQLAVSEANYHATESKLNELTTDLQESQAKNAELKEQIINLNSMTASLQSQLNEKQQN 737

Query: 516 LKDKKASNEVN----ELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
           +K +++  +VN    EL +I + N++  + GL EK+     K++EL D    ++   +  
Sbjct: 738 VKQERSMVDVNSKQLELNQITVTNLQKEIDGLGEKISVYLTKQKELNDYQKTVEEQHAQL 797

Query: 572 QSVIK-------EYGQREKQISERMQMILGQEFLQFRQMLVN 606
           QS  +       +   REKQ+ ER + I  QE L + Q + N
Sbjct: 798 QSKYQDLSNKDTDLADREKQLEERNKQIEEQESL-YHQHVSN 838

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 102,096,079
Number of extensions: 4798868
Number of successful extensions: 105099
Number of sequences better than 10.0: 2445
Number of HSP's gapped: 68080
Number of HSP's successfully gapped: 6150
Length of query: 974
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 855
Effective length of database: 39,836,145
Effective search space: 34059903975
Effective search space used: 34059903975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 71 (32.0 bits)