Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07898g6.16ON97497447840.0
Skud_5.286.16ON99893323760.0
KLTH0C11330g6.16ON94188822650.0
ACR010C6.16ON94592021490.0
TDEL0G045306.16ON95871820800.0
YEL061C (CIN8)6.16ON100066717430.0
NCAS0H008806.16ON100472317390.0
Smik_5.266.16ON100265817310.0
NDAI0D008706.16ON106969517310.0
Kpol_1032.66.16ON100472117010.0
SAKL0E01078g6.16ON94869616720.0
Suva_5.66.16ON99965816660.0
KLLA0D01045g6.16ON96563115530.0
Kwal_56.224036.16ON94365815280.0
CAGL0B03641g6.16ON98859415260.0
TPHA0M002406.16ON93962615070.0
KAFR0L003706.16ON96366814980.0
Ecym_30206.16ON94462014650.0
TBLA0A072306.16ON109763314440.0
KNAG0M011306.16ON95067213571e-171
Kpol_1045.736.16ON96262312101e-150
TPHA0J003006.16ON98296711451e-140
ACR228C7.387ON11292956251e-66
Suva_2.547.387ON11102166152e-65
TPHA0E008907.387ON12322786153e-65
Skud_2.417.387ON11103346134e-65
YBL063W (KIP1)7.387ON11112166134e-65
Smik_2.537.387ON11132166125e-65
SAKL0F12298g7.387ON11122146072e-64
NCAS0E026407.387ON11022866054e-64
Ecym_46887.387ON11342186021e-63
ZYRO0B03234g7.387ON11382416012e-63
TDEL0C016007.387ON11053476002e-63
NDAI0E043007.387ON11862165967e-63
KAFR0L017107.387ON11512155861e-61
TBLA0D006407.387ON11422014331e-42
SAKL0G05016g5.531ON5041753496e-34
SAKL0G18920g2.633ON6491743521e-33
KLTH0G03850g5.531ON4731733407e-33
Kwal_47.186085.531ON4791733391e-32
KLLA0B00759g5.531ON4561743291e-31
SAKL0F01760g3.528ON8091783202e-29
Ecym_40665.531ON4781803122e-29
Smik_7.483.528ON8051783193e-29
ZYRO0E08668g3.528ON7781793184e-29
Skud_7.533.528ON8051783167e-29
Kwal_47.190933.528ON8191793168e-29
Suva_7.443.528ON8051783122e-28
Ecym_34152.633ON6621713083e-28
Kpol_423.83.528ON8061813104e-28
TDEL0D059603.528ON7331793094e-28
YGL216W (KIP3)3.528ON8051783094e-28
KNAG0B005203.528ON7231833085e-28
ADR145C2.633ON6351703057e-28
KLTH0G01606g3.528ON8191743061e-27
CAGL0I07029g3.528ON7051803022e-27
KAFR0F042103.528ON6721783022e-27
NCAS0E005503.528ON7841803032e-27
AER441C3.528ON8181783032e-27
Ecym_12003.528ON8331783014e-27
Kpol_1004.255.531ON5061922946e-27
NDAI0I029603.528ON8681882999e-27
KLLA0A01606g3.528ON7691802952e-26
TPHA0D034803.528ON8471792962e-26
ZYRO0D12650g5.531ON4781782857e-26
TBLA0C039403.479ON7391762891e-25
TBLA0C049603.528ON8011852881e-25
CAGL0D04994g3.479ON6921682801e-24
TBLA0C053103.479ON6761732772e-24
KAFR0H024108.678ON6583182763e-24
Kwal_26.88068.678ON7153252773e-24
KNAG0A078803.479ON7641442773e-24
AGR253W3.479ON7091692763e-24
KLLA0D05951g8.678ON6683432755e-24
Kpol_505.393.479ON6921592737e-24
SAKL0H06490g8.678ON6572632702e-23
SAKL0F03168g3.479ON7061492693e-23
Kpol_1013.78.678ON6201792673e-23
NCAS0C013508.678ON6551822673e-23
KLTH0F14498g3.479ON7021682675e-23
TDEL0F036403.479ON7041662649e-23
KAFR0B065903.479ON7061532641e-22
ACR145W8.678ON6852062641e-22
KLTH0D11286g8.678ON6781842612e-22
TPHA0D012708.678ON6961872603e-22
TPHA0D032003.479ON7241502603e-22
ZYRO0B04290g3.479ON7311532603e-22
Kpol_1050.1033.479ON6971552593e-22
ZYRO0F07414g8.678ON6541812594e-22
Ecym_44073.479ON7111662576e-22
NCAS0F034703.479ON6981672568e-22
KLLA0B10956g3.479ON6901472541e-21
NDAI0E02090singletonON6851952532e-21
YPR141C (KAR3)3.479ON7291442532e-21
NDAI0B057703.479ON7631542523e-21
Skud_16.4353.479ON7291652514e-21
Smik_16.3883.479ON7291482514e-21
TBLA0C018808.678ON4681772465e-21
CAGL0M02189g8.678ON6721942495e-21
Suva_16.4693.479ON7311462471e-20
Ecym_23958.678ON6871842433e-20
YPL155C (KIP2)8.678ON7061992407e-20
Smik_6.3528.678ON7152052381e-19
TDEL0A062408.678ON6373132372e-19
Skud_16.1278.678ON7061992362e-19
TDEL0B072702.633ON6442042317e-19
KNAG0J017208.678ON6251792254e-18
TPHA0D041903.479ON6721452255e-18
Suva_16.1558.678ON7041992103e-16
Kpol_1019.112.633ON6472301995e-15
TPHA0N016502.633ON6822311791e-12
Kwal_55.21164singletonOFF5881251763e-12
YKL079W (SMY1)2.633ON6561271754e-12
Kwal_YGOB_55.211643.479ON6571251754e-12
Suva_11.1452.633ON6571091711e-11
Skud_11.1482.633ON6561091683e-11
Smik_11.1602.633ON6561091532e-09
NDAI0C004802.633ON5982941503e-09
KNAG0M025402.633ON5221091479e-09
TBLA0C008002.633ON6931641442e-08
NCAS0H031802.633ON6602711433e-08
TBLA0A008202.633ON8031701433e-08
ZYRO0E01078g2.633ON6683581424e-08
CAGL0L05104g2.633ON6753721406e-08
KAFR0C040202.633ON6672891165e-05
KNAG0H003602.633ON6811251121e-04
KAFR0B005907.488ON1261191930.029
NCAS0C028308.401ON874127870.14
Smik_2.677.488ON1377154781.5
NCAS0C052002.633ON572127771.8
Ecym_64762.16ON850163752.9
Suva_2.707.488ON1380154753.5
YBL047C (EDE1)7.488ON1381154744.2
SAKL0F14894g7.488ON1297181744.5
Skud_2.557.488ON1390162744.5
KLTH0C02486g1.515ON2467139744.8
KAFR0C036508.8ON21242716.1
KNAG0E022002.406ON135880727.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C07898g
         (974 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...  1847   0.0  
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...   919   0.0  
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   877   0.0  
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   832   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   805   0.0  
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...   676   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   674   0.0  
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...   671   0.0  
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   671   0.0  
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   659   0.0  
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   648   0.0  
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...   646   0.0  
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   602   0.0  
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   593   0.0  
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   592   0.0  
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   585   0.0  
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   581   0.0  
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   568   0.0  
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   560   0.0  
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   527   e-171
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   470   e-150
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   445   e-140
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   245   1e-66
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   241   2e-65
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   241   3e-65
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   240   4e-65
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   240   4e-65
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   240   5e-65
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   238   2e-64
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   237   4e-64
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   236   1e-63
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   236   2e-63
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   235   2e-63
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   234   7e-63
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   230   1e-61
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   171   1e-42
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   139   6e-34
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   140   1e-33
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   135   7e-33
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   135   1e-32
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   131   1e-31
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   127   2e-29
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   124   2e-29
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   127   3e-29
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   127   4e-29
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   126   7e-29
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   126   8e-29
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   124   2e-28
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   123   3e-28
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   124   4e-28
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   123   4e-28
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   123   4e-28
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   123   5e-28
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   122   7e-28
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   122   1e-27
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   120   2e-27
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   120   2e-27
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   121   2e-27
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   121   2e-27
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   120   4e-27
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   117   6e-27
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   119   9e-27
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   118   2e-26
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   118   2e-26
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   114   7e-26
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   115   1e-25
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   115   1e-25
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   112   1e-24
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   111   2e-24
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   110   3e-24
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...   111   3e-24
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   111   3e-24
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   110   3e-24
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...   110   5e-24
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   109   7e-24
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...   108   2e-23
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   108   3e-23
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   107   3e-23
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   107   3e-23
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   107   5e-23
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   106   9e-23
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   106   1e-22
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...   106   1e-22
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...   105   2e-22
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...   104   3e-22
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   104   3e-22
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   104   3e-22
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   104   3e-22
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...   104   4e-22
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   103   6e-22
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   103   8e-22
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   102   1e-21
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...   102   2e-21
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   102   2e-21
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   101   3e-21
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   101   4e-21
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...   101   4e-21
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    99   5e-21
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...   100   5e-21
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   100   1e-20
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...    98   3e-20
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...    97   7e-20
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...    96   1e-19
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...    96   2e-19
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...    96   2e-19
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...    94   7e-19
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    91   4e-18
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    91   5e-18
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...    86   3e-16
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...    81   5e-15
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    74   1e-12
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    72   3e-12
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    72   4e-12
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    72   4e-12
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    70   1e-11
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    69   3e-11
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    64   2e-09
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    62   3e-09
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    61   9e-09
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    60   2e-08
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     60   3e-08
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    60   3e-08
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    59   4e-08
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    59   6e-08
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    49   5e-05
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    48   1e-04
KAFR0B00590 Chr2 complement(117951..121736) [3786 bp, 1261 aa] {...    40   0.029
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     38   0.14 
Smik_2.67 Chr2 complement(121714..125847) [4134 bp, 1377 aa] {ON...    35   1.5  
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    34   1.8  
Ecym_6476 Chr6 (921068..923620) [2553 bp, 850 aa] {ON} similar t...    33   2.9  
Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON...    33   3.5  
YBL047C Chr2 complement(127895..132040) [4146 bp, 1381 aa] {ON} ...    33   4.2  
SAKL0F14894g Chr6 complement(1202168..1206061) [3894 bp, 1297 aa...    33   4.5  
Skud_2.55 Chr2 complement(111625..115797) [4173 bp, 1390 aa] {ON...    33   4.5  
KLTH0C02486g Chr3 complement(217025..224428) [7404 bp, 2467 aa] ...    33   4.8  
KAFR0C03650 Chr3 complement(744293..744931) [639 bp, 212 aa] {ON...    32   6.1  
KNAG0E02200 Chr5 complement(442946..447022) [4077 bp, 1358 aa] {...    32   7.9  

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score = 1847 bits (4784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 916/974 (94%), Positives = 916/974 (94%)

Query: 1   MGSSPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGI 60
           MGSSPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGI
Sbjct: 1   MGSSPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGI 60

Query: 61  TAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTG 120
           TAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTG
Sbjct: 61  TAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTG 120

Query: 121 DEKLYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSS 180
           DEKLYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSS
Sbjct: 121 DEKLYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSS 180

Query: 181 MRKLRIYDXXXXXXXXXXXXXXXXXXXPKLVTDPMINRRRMRTVPLSSSLAKXXXXXXXX 240
           MRKLRIYD                   PKLVTDPMINRRRMRTVPLSSSLAK        
Sbjct: 181 MRKLRIYDSGSGSNSNSGSRKNSRNNSPKLVTDPMINRRRMRTVPLSSSLAKQQHQWQQR 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDSPSGVYIQNLQDFHITSARDGLQLLQKG 300
                                          DSPSGVYIQNLQDFHITSARDGLQLLQKG
Sbjct: 241 REQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKG 300

Query: 301 LRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGAQHQR 360
           LRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGAQHQR
Sbjct: 301 LRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGAQHQR 360

Query: 361 AKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKI 420
           AKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKI
Sbjct: 361 AKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKI 420

Query: 421 NSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMS 480
           NSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMS
Sbjct: 421 NSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMS 480

Query: 481 QDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVM 540
           QDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVM
Sbjct: 481 QDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVM 540

Query: 541 SGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQEFLQF 600
           SGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQEFLQF
Sbjct: 541 SGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQEFLQF 600

Query: 601 RQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYKDWIE 660
           RQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYKDWIE
Sbjct: 601 RQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYKDWIE 660

Query: 661 KILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKNNHEE 720
           KILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKNNHEE
Sbjct: 661 KILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKNNHEE 720

Query: 721 VLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQLFEP 780
           VLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQLFEP
Sbjct: 721 VLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQLFEP 780

Query: 781 QRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKDEVKGYED 840
           QRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKDEVKGYED
Sbjct: 781 QRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKDEVKGYED 840

Query: 841 ASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIRNTIASENST 900
           ASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIRNTIASENST
Sbjct: 841 ASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIRNTIASENST 900

Query: 901 LHQNKIATTPPLGQNSERSPLKPTVLQPNQLPENWRYGLRSPPKDQLSKSNGELKRHQDN 960
           LHQNKIATTPPLGQNSERSPLKPTVLQPNQLPENWRYGLRSPPKDQLSKSNGELKRHQDN
Sbjct: 901 LHQNKIATTPPLGQNSERSPLKPTVLQPNQLPENWRYGLRSPPKDQLSKSNGELKRHQDN 960

Query: 961 ETLEENVNKISRLE 974
           ETLEENVNKISRLE
Sbjct: 961 ETLEENVNKISRLE 974

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score =  919 bits (2376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/933 (51%), Positives = 644/933 (69%), Gaps = 34/933 (3%)

Query: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72
           EELNITVAVR RGRNEREI  KSSVVV+VPD+ GS EV+INTT D GITAQMN+K Y VD
Sbjct: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 94

Query: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132
           KVFGP A+Q LIF+E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLYN EL+D+
Sbjct: 95  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 154

Query: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDS--------VENSSMRKL 184
           AGIIPR+L KLF+TL+L+  DYVVKCSF+ELYNEELKDLLD++         +   M+KL
Sbjct: 155 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEELKDLLDNNSNGSSNNGFDGQFMKKL 214

Query: 185 RIYDXXXXXXXXXXXXXXXXXXXPK--------LVTDPMINRRRMRTVPLSSSLAKXXXX 236
           RI+D                             L     + R+R+RT  L +++ K    
Sbjct: 215 RIFDSSTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPNTI-KQQQQ 273

Query: 237 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDSPSGVYIQNLQDFHITSARDGLQL 296
                                              D  +G+YIQNLQ+FHIT+A +GL L
Sbjct: 274 QQAMNSRNNSSSNSGSAANNSSSNTNGQRSPMTQNDQSNGIYIQNLQEFHITNALEGLNL 333

Query: 297 LQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGA 356
           LQ+GL++RQVA+TKMNDFSSRSHTIFTITLY++HQ E+F++SKMNLVDLAGSENI+RSGA
Sbjct: 334 LQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGA 393

Query: 357 QHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATIS 416
            +QRAKEAGSINQSLLTLGRVIN+L D+S H+PFRESKLTRLLQDSLGGNTKTALIATIS
Sbjct: 394 LNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATIS 453

Query: 417 PAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREG 476
           PAK+ SEETCSTL+YASKAKNIKN+PQL +F+MKDILVKNIT ELAK+KSDLLSTK +EG
Sbjct: 454 PAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEG 513

Query: 477 VYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNM 536
           +YMSQD+YK + +DLES+K E+QE KR IE L+S+NSLL+KDK  S E  + Q  +++++
Sbjct: 514 IYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESL 573

Query: 537 KDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQE 596
           K  ++ L  +L+ QHK E E+      L+    + Q  +++Y +RE  ++++ +  + +E
Sbjct: 574 KATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKE 633

Query: 597 FLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYK 656
               +  L   +++++      +I  E +   IQ NL++++ EV+ L+   Q++AE MYK
Sbjct: 634 IKSLKTALFLQLDNMQQ----KNIFQETD---IQPNLDMVKNEVLTLMETMQEKAELMYK 686

Query: 657 DWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKN 716
           D ++KIL E+P  F  I  K+D + +    +++ + ENLSDISE  NNLKQY  +HFFKN
Sbjct: 687 DCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKN 746

Query: 717 NHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQ 776
           NH+E+LN HID TY+ ++   +  ++ FK  ++DHL++NK L+M+++ +AT+  ID+EM 
Sbjct: 747 NHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMD 806

Query: 777 LFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKDEVK 836
           LFEP+R KWE SFDLIN CDS++N F  +M + LS IK T  +S++ ++ S+S +K +V+
Sbjct: 807 LFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVE 866

Query: 837 GYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIRNTIAS 896
             E+A ++L  N     Q   +I+K   L++ +  SI S+  HI+  D++   I + + +
Sbjct: 867 ESENAISLLKNNTKFNDQFKQLISKHIILKDNIESSITSTHSHITNVDDIYNTIEDIMTN 926

Query: 897 ----ENST---LHQNKIATTPPLGQNSERSPLK 922
               EN+T   +  N +   P L   S+R PL+
Sbjct: 927 HGNKENATKDEMIDNILKEIPNL---SKRLPLR 956

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/888 (51%), Positives = 606/888 (68%), Gaps = 46/888 (5%)

Query: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72
           EELNITVAVR RGRNE+E++AKSSVVV+VPDV G++EV+INTT D GITAQ+NSKTY VD
Sbjct: 5   EELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64

Query: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132
           +VFGPSA+Q LIFK IAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDE+LY+ ELS+ 
Sbjct: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124

Query: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYDXXXX 192
           AGIIPR+LFKLF+ LD  ++DY++KCSF+ELYNEELKDLLD++ ++S  RKLRI+D    
Sbjct: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFDSVTN 184

Query: 193 XXXXXXXXXXXXXXXPKLVTDPMINRRRMRTV--PLSSSLAKXXXXXXXXXXXXXXXXXX 250
                          P+  T     R R  T+  P  S   K                  
Sbjct: 185 PNSSRSSSRNSSPKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELN---------- 234

Query: 251 XXXXXXXXXXXXXXXXXXXXXDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTK 310
                                   S ++IQNLQ+FHI  A++G++LLQ+GLR+RQVA+TK
Sbjct: 235 ------------------------SAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTK 270

Query: 311 MNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQS 370
           MND SSRSHTIFTI LYR+  GE F+VSKMNLVDLAGSENISRSGAQ+QRAKEAGSINQS
Sbjct: 271 MNDVSSRSHTIFTIMLYRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQS 330

Query: 371 LLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQ 430
           LLTLGRVINSLADK+AH+PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEET STL+
Sbjct: 331 LLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLE 390

Query: 431 YASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITND 490
           YA+KAKNIKN+PQ+ SFIMKD+LVKN+TAEL K++SDLL+TK ++G+YMSQ+NYKE+TN+
Sbjct: 391 YATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNE 450

Query: 491 LESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQ 550
           LE+YKTE+QE KR IERLS+QN LL K+K+ +NEVNE QR+K++ + + +  L +K++ Q
Sbjct: 451 LENYKTEVQECKRAIERLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQ 510

Query: 551 HKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIED 610
           HK EQEL ++   L   L   Q+ +K Y  +  +    M+ +L +    F+  L+N IE 
Sbjct: 511 HKNEQELSNVVQELMRALRTMQNSLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEK 570

Query: 611 IR-TNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTV 669
           ++ T   G D         +  N++ L +E+  +         ++ + ++ KI E+ PT 
Sbjct: 571 LKGTEEDGFD---------VDANIDTLTKELNRIYDFINTSTIEICRKFMNKITEQTPTY 621

Query: 670 FQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKT 729
            Q I N+V+ +   V +Y   L  +LS ISE YN+LK Y N+HFFKNN ++ L+ H+D+T
Sbjct: 622 LQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLKDYLNEHFFKNNFQDALDVHVDRT 681

Query: 730 YQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESF 789
           Y QL+ SA+ +  K ++MM++ L+ NK +MM+SL++A +E + KEM L +P ++ WE S 
Sbjct: 682 YHQLKVSANSIFLKLREMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESSL 741

Query: 790 DLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGNE 849
           + IN CD +++GF  D+ S + D+             +V     ++  ++DAS  L  ++
Sbjct: 742 ENINECDKLNSGFEKDIGSVVRDVFEKINEGLQFSESAVGDANLDLSRFQDASRALRTDD 801

Query: 850 VVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIRNTIASE 897
           V+   I +I  K + L+  +  S    +     F E+ + I+  + S+
Sbjct: 802 VIPGSIEEIKKKHNMLKLKVQDSASYMEAATQKFGEIDDSIQGLLNSQ 849

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score =  832 bits (2149), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/920 (48%), Positives = 611/920 (66%), Gaps = 45/920 (4%)

Query: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72
           EELNITVAVR RGRNEREI+AKSSVVV+VPDV GS+EV+INTTD+VGI A+MNS+TY VD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78

Query: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132
           KVFGPSA+Q LIFKEIAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY+ +LSDS
Sbjct: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138

Query: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYDXXXX 192
           AGIIPRI+FKLF+ L+  D D++VKCS++ELYNEELKDLLD+S ++S  ++LRI+D    
Sbjct: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS--KRLRIFDSSSM 196

Query: 193 XXXXXXXXXXXXXXXPKLVTDPMINRRRMRTVPLSSSLAKXXXXXXXXXXXXXXXXXXXX 252
                          P++  +   +RRR R  P+ ++                       
Sbjct: 197 NHSSRASSQSNSPREPEVAHNGF-SRRRQRPPPVKAN----------------------- 232

Query: 253 XXXXXXXXXXXXXXXXXXXDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMN 312
                              +S SG+Y+QN+Q+FHI +AR+G+ +LQKGL++RQVA+TKMN
Sbjct: 233 ---------RMSATKQQLSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMN 283

Query: 313 DFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLL 372
           DFSSRSHTIFTI LY+   GE+F+VSKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLL
Sbjct: 284 DFSSRSHTIFTIMLYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLL 343

Query: 373 TLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYA 432
           TLGRVINSLADKS H+PFRESKLTRLLQDSLGGNTKTALIATISPAKIN++ET STL+YA
Sbjct: 344 TLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYA 403

Query: 433 SKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLE 492
           +KAKNIKNRPQL + +MKDILVKNI++ELAK+KSD LSTK ++G+YMS ++Y+EI NDLE
Sbjct: 404 AKAKNIKNRPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLE 463

Query: 493 SYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHK 552
           + +TEIQESKR IE L+SQN+LLLKDKKAS EV ELQ  K++ ++  +  L +K+E QH 
Sbjct: 464 NCQTEIQESKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHH 523

Query: 553 KEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIR 612
            E EL      LK  L   Q  +K Y   E ++   ++ +L Q    +R+ +  ++E ++
Sbjct: 524 NETELATTIHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVK 583

Query: 613 TNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVF-Q 671
            +    ++        I++N+N +     + L   +     M  D + K+++E P+++ +
Sbjct: 584 VSMLDKNL-------SIKENINNITTIFDDTLKSVEANGSDMC-DTLVKLIKETPSMYLK 635

Query: 672 AISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQ 731
             +  V  ++  +++Y   LT  L++ISE  N+L++Y + H FKN+ +EVL+  ++  YQ
Sbjct: 636 EFNETVSSLKSELSSYSNALTNKLTEISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQ 695

Query: 732 QLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDL 791
           +++  +D LL K   M+  H+++++TLM+ S++    E ID E  LF+P R +W  S D 
Sbjct: 696 KVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDN 755

Query: 792 INNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVV 851
           IN CD+    F     S L  +K    +S      +V+K K     + D    L  ++ +
Sbjct: 756 INQCDASHQNFEAKSTSGLDKLKELSDASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSL 815

Query: 852 KRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIRNTIASENSTLHQNKIATTPP 911
           K+Q+ DI +K   L +    ++K  +     F+++   I+  I   +  +   K   T  
Sbjct: 816 KKQMHDISDKHRMLEDHFDDNVKYFKESSKGFEDMDCSIKKIIHEMSPEVGDIKSVETLM 875

Query: 912 LGQNSER-SPLKPTVLQPNQ 930
              N+   SP++PT   P++
Sbjct: 876 ERINARTFSPVRPTGKTPSR 895

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/718 (58%), Positives = 530/718 (73%), Gaps = 24/718 (3%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           D  +G+YIQNLQDFHIT+A++G++LLQKGL++RQVATTKMNDFSSRSHTIFTITLY+E+ 
Sbjct: 244 DQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYN 303

Query: 332 GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR 391
           GE+F+VSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL DKS HVPFR
Sbjct: 304 GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFR 363

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD 451
           ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYA+KAKNIKN+PQL S IMKD
Sbjct: 364 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKD 423

Query: 452 ILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQ 511
           ILVKNIT ELAK+K+DLLSTK +EG+YMSQDNYKE+TNDLESYKTE++E KR IE L+SQ
Sbjct: 424 ILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQ 483

Query: 512 NSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
           N+LLLKDKKASNEVN+LQRIKLQNM+D MS L  K E Q+K+EQ LV     LK+T+   
Sbjct: 484 NTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTM 543

Query: 572 QSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQ 631
           QS+IKE+ +RE+ I  +M  +   EF + +Q +++NI DI       +I       G+Q 
Sbjct: 544 QSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENI-------GVQG 596

Query: 632 NLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRL 691
           N++ +R E+ +LL  AQ++ + MYKD +EKIL+E P  FQ  + KV +VE  + T H+ L
Sbjct: 597 NIDSIRGEISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDL 656

Query: 692 TENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDH 751
           TENLSD+SE +NNL+QY NDHFFKNNHEE+L SHID+TY  +Q SAD L Q+FK+MMD+H
Sbjct: 657 TENLSDVSEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNH 716

Query: 752 LKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALS 811
           L+ NK LM++SL++AT + I KEMQLFEPQ+KKWE+SF  IN CDSI+  F   ++S L 
Sbjct: 717 LEKNKDLMLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLL 776

Query: 812 DIKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYK 871
            IKST GSS + I+++++KVK+++  +E  +++L  + V   Q + I+NK S L   L K
Sbjct: 777 GIKSTLGSSQEAINKTITKVKEQMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLKK 836

Query: 872 SIKSSQGHISAFDELKERIRNTIASENSTLHQNKIATTPPL-----GQN---SERSPLKP 923
           S+  +  H  A D+LKE I + ++   S++   ++     +      QN    +RSPL+P
Sbjct: 837 SVIITSDHADAVDKLKEAIDHVVSERGSSMEGERVEHVDGILRRMDEQNLLYLDRSPLRP 896

Query: 924 TVLQPNQLPEN-------WRYGLRSPPKDQLSKSNGELKRHQD--NETLEENVNKISR 972
              + N+   N        +    SP K  +       KR     N+  EE +NK+SR
Sbjct: 897 ANFKMNKSERNSPNRSSPCKSVSHSPCKQPVCHPRINYKRSLTDLNDGQEEGLNKLSR 954

 Score =  314 bits (804), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 154/188 (81%), Positives = 170/188 (90%)

Query: 1   MGSSPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGI 60
           M + P   GED EELNITVAVR RGRNEREI+AKSSVVVSVPDV GS+EV+INTT DVGI
Sbjct: 1   MVAMPQASGEDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGI 60

Query: 61  TAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTG 120
           TAQ+NSKTY VD+VFGPSANQ L+F++IAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTG
Sbjct: 61  TAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTG 120

Query: 121 DEKLYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSS 180
           DEKLY+ ELS+SAGIIPRILFKLFETL+L+ EDYVVKCSFVELYNEELKDLL DS E +S
Sbjct: 121 DEKLYDGELSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIAS 180

Query: 181 MRKLRIYD 188
            RKLRI+D
Sbjct: 181 SRKLRIFD 188

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
           CIN8Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 1000

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/667 (51%), Positives = 482/667 (72%), Gaps = 17/667 (2%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           D  +G+YIQNLQ+FHIT+A +GL LLQKGL++RQVA+TKMNDFSSRSHTIFTITLY++HQ
Sbjct: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 370

Query: 332 GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR 391
            E+F++SKMNLVDLAGSENI+RSGA +QRAKEAGSINQSLLTLGRVIN+L DKS H+PFR
Sbjct: 371 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR 430

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD 451
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTL+YASKAKNIKN+PQL SFIMKD
Sbjct: 431 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKD 490

Query: 452 ILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQ 511
           ILVKNIT ELAK+KSDLLSTK +EG+YMSQD+YK + +DLESYK E+QE KR IE L+S+
Sbjct: 491 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSK 550

Query: 512 NSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
           N+LL+KDK  S E  + Q  +++++K  +  L  +L+ QHK E E+ D    L+    + 
Sbjct: 551 NALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEVM 610

Query: 572 QSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQ 631
           Q  + +Y +RE  ++++ +M + +E  + +  L   +  ++       IL E     IQ 
Sbjct: 611 QMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQ----ESILQE---TNIQP 663

Query: 632 NLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRL 691
           NL++++ EV+ L+   Q++AE MYKD ++KIL E+P  F  +  K+D + V    +++ +
Sbjct: 664 NLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNI 723

Query: 692 TENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDH 751
            ENLSDISE  NN+KQY  +HFFKNNH+E+LN H+D TY+ ++   +  ++ FK++++DH
Sbjct: 724 AENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDH 783

Query: 752 LKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALS 811
           L +NK L+M++L +AT+  ID+EM LFEP+R KWE SFDLIN+CDS++N F   M + LS
Sbjct: 784 LDENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLS 843

Query: 812 DIKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYK 871
            IKST  +S++ ++ S+S +K +V+  E+A ++L  N     Q   +INK + L++ +  
Sbjct: 844 QIKSTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKN 903

Query: 872 SIKSSQGHISAFDELKERIRNTIAS----ENST---LHQNKIATTPPLGQNSERSPLKPT 924
           SI S+  HI+  D++   I N + +    EN+T   + +N +   P L   S++ PL+ +
Sbjct: 904 SITSTHSHITNVDDIYNTIENIMKNYGNKENATKDEMIENILKEIPNL---SKKMPLRLS 960

Query: 925 VLQPNQL 931
            +  N +
Sbjct: 961 NINSNSV 967

 Score =  291 bits (746), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 154/184 (83%), Gaps = 8/184 (4%)

Query: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72
           EELNITVAVR RGRNEREI  KSSVVV+VPD+ GS E++INTT D GITAQMN+K Y VD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132
           KVFGP A+Q LIF E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLYN ELSD+
Sbjct: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152

Query: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSS--------MRKL 184
           AGIIPR+L KLF+TL+L+  DYVVKCSF+ELYNEELKDLLD +   SS        M+KL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDSNSNGSSNTGFDGQFMKKL 212

Query: 185 RIYD 188
           RI+D
Sbjct: 213 RIFD 216

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
            Anc_6.16
          Length = 1004

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/723 (51%), Positives = 499/723 (69%), Gaps = 37/723 (5%)

Query: 272  DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
            ++ +G+YIQNLQ+FHIT+A++GL LLQKGL++RQVA+TKMNDFSSRSHTIFTITLY+EH+
Sbjct: 296  ENTNGIYIQNLQEFHITNAKEGLSLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKEHK 355

Query: 332  GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR 391
              +F++SKMNLVDLAGSENI+RSGA +QRAKE GSINQSLLTLGRVINSLADKS HVPFR
Sbjct: 356  DNLFRLSKMNLVDLAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADKSPHVPFR 415

Query: 392  ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD 451
            ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTL+YASKAKNIKN+PQL S I+KD
Sbjct: 416  ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSVILKD 475

Query: 452  ILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQ 511
            IL+KNIT+ELAKVKSDL+STK ++G+YMS ++Y+E+  +LES KTE+QESKR+IE+LSSQ
Sbjct: 476  ILLKNITSELAKVKSDLMSTKSKDGIYMSHEHYQELIMELESSKTEVQESKRMIEKLSSQ 535

Query: 512  NSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
            NS+LLKDK+++NEVNELQRIKL N+KD MS L+EKLE Q+ KE +L++    L+ +    
Sbjct: 536  NSMLLKDKRSANEVNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQLEKSREKL 595

Query: 572  QSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQN-GIQ 630
             S++K Y  ++ Q+  ++  IL +   + +++L          +S  D + + E N  ++
Sbjct: 596  NSLVKNYQTKQSQLKTQISNILNENLFELKKIL----------NSHKDAIRQSEGNFDVE 645

Query: 631  QNLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQR 690
             NL V++ E+  +L   Q + E MYK++IE+ LE+ P   Q I   V QVE  V  Y+  
Sbjct: 646  MNLKVIKDEITSMLEKTQHKTEMMYKEFIEEFLEQTPINLQKIFEHVTQVEFMVTGYYNE 705

Query: 691  LTENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDD 750
            +TENLSDISE YNNLKQY ++ FF+NNHE++LN HI+ T   L  S+  L  KFK MMD 
Sbjct: 706  ITENLSDISEEYNNLKQYLDNDFFQNNHEDLLNIHINATSDILAQSSAELFNKFKIMMDA 765

Query: 751  HLKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSAL 810
            HL +NK LM+ + ++AT + I KEM+LF+P+R KWEES +LIN CDSI+NGF+ +M   +
Sbjct: 766  HLMENKKLMIDNFRTATNDVITKEMELFKPKRNKWEESIELINRCDSINNGFHHNMTGQV 825

Query: 811  SDIKSTFGSSTDVISRSVSKVKDEV-----KGYEDASTILDGNEVVKRQIADIINKDSSL 865
            S IK+   SS+  I  +++ +K +V         D  T L+ + +  +   +II K+  L
Sbjct: 826  SKIKTNLASSSSSIHNAIASIKSQVLEQLSNDDSDVKTALENDPMFNKHFNEIIEKNMIL 885

Query: 866  RNGLYKSIKSSQGHISAFDELKERIRNTIASENSTLHQNKIATT------PPLGQNSERS 919
            +     +I  +   +   DEL E ++  IA  N     + +A T      P     S+  
Sbjct: 886  QKNRKNAINYTDKSLLNIDELSETVK--IALNNIV---DDVAITDGDDNSPGTKTKSKLR 940

Query: 920  PLKPT---VLQPNQLPENWRYGLRSPPKDQLSKSNGE-LKRHQDNETLEEN-----VNKI 970
            PL+     ++  NQ  EN   G+    + +L  SN + LK     + L+EN       KI
Sbjct: 941  PLRSASQLLINSNQNKENGVRGI-DVTESKLGNSNSQILKIRSKRKQLDENDGNLASKKI 999

Query: 971  SRL 973
            SRL
Sbjct: 1000 SRL 1002

 Score =  271 bits (694), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 135/196 (68%), Positives = 156/196 (79%), Gaps = 17/196 (8%)

Query: 10  EDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTY 69
           E+  ELNITVAVR RGRNEREI +KS VVV+VPD+ G+ E++INTT + GITAQMNSKTY
Sbjct: 24  EEDTELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGITAQMNSKTY 83

Query: 70  AVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE- 128
            VDKVFGP+A+Q LIF+E+AEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY +  
Sbjct: 84  TVDKVFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDEKLYQNGT 143

Query: 129 -LSDSAGIIPRILFKLFETLDLRDE--------DYVVKCSFVELYNEELKDLLD-DSVEN 178
            LSD+AGIIPRILFKLF+TLD            D+VVKCSFVELYNE+LKDLL+ DS + 
Sbjct: 144 MLSDAAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDLLNYDSNDE 203

Query: 179 SSM------RKLRIYD 188
                    RKLRI+D
Sbjct: 204 QQQQQQLGSRKLRIFD 219

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
           YEL061C (REAL)
          Length = 1002

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/658 (52%), Positives = 482/658 (73%), Gaps = 17/658 (2%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           D  +G+YIQNLQ+FHIT+A +GL+LLQKGL++RQVA+TKMNDFSSRSHTIFTITLY++HQ
Sbjct: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372

Query: 332 GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR 391
            E+F++SKMNLVDLAGSENI+RSGA +QRAKEAGSINQSLLTLGRVIN+L DKS H+PFR
Sbjct: 373 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR 432

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD 451
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTL+YASKAKNIKN+PQL +FIMKD
Sbjct: 433 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 492

Query: 452 ILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQ 511
           ILVKNIT ELAK+KSDLLSTK +EG+YM+QD+YK + +DLESYK E+QE KR IE L+S+
Sbjct: 493 ILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTSK 552

Query: 512 NSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
           NSLL+K+K  S E  + Q  +++++K  +  L  +L+ QHK E E+      L+    + 
Sbjct: 553 NSLLVKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEVM 612

Query: 572 QSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQ 631
           Q  +++Y +RE  ++++ +  +  E    +  L + +  ++      +IL E +   IQ 
Sbjct: 613 QMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQ----RNILQETD---IQP 665

Query: 632 NLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRL 691
           NL++++ EV+ L+   Q++AE MYKD ++KIL E+P  F AI  K+D + V    +++ +
Sbjct: 666 NLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNI 725

Query: 692 TENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDH 751
            ENLSDISE  NNLKQYF +HFF+NNH+E+L+ H+D TY++++   +  ++ FK+ ++DH
Sbjct: 726 AENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDH 785

Query: 752 LKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALS 811
           L++NK L+MK+L + T+  ID+EM LFEP+R KWE SFDLIN CDS++N F   M + LS
Sbjct: 786 LEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLS 845

Query: 812 DIKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYK 871
            IKST  +S++ +++S+S +K +V+  E+A ++L  N     Q   +INK + L++ +  
Sbjct: 846 QIKSTVDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILKDNIES 905

Query: 872 SIKSSQGHISAFDELK---ERIRNTIAS-ENST---LHQNKIATTPPLGQNSERSPLK 922
           SI S+  HI+  D++    E+I N   + EN+T   + +N +   P L   S+R PL+
Sbjct: 906 SITSTNSHITNIDDIYNTIEKIMNNYGNKENATKDEMIENLLNEIPNL---SKRMPLR 960

 Score =  290 bits (743), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 136/184 (73%), Positives = 153/184 (83%), Gaps = 8/184 (4%)

Query: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72
           EELNITVAVR RGRNEREI  KSSVVV+VPD+ GS E++INTT D GITAQMN+K Y VD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132
           KVFGP A+Q LIF E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLYN ELSDS
Sbjct: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152

Query: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLD--------DSVENSSMRKL 184
           AGIIPR+L KLF+TL+L+  DYVVKCSF+ELYNEELKDLLD        +  +   M+KL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNSSSNNGFDGQFMKKL 212

Query: 185 RIYD 188
           RI+D
Sbjct: 213 RIFD 216

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
            Anc_6.16
          Length = 1069

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/695 (50%), Positives = 494/695 (71%), Gaps = 32/695 (4%)

Query: 272  DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
            D+ +G+YIQNLQ+FHI++A++GL LLQKGL+ RQVA+TKMNDFSSRSHTIFTITLY+EHQ
Sbjct: 342  DNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQ 401

Query: 332  GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR 391
            G +F++SKMNLVDLAGSENI+RSGA +QRAKE GSINQSLLTLGRVINSLAD++ H+PFR
Sbjct: 402  GTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFR 461

Query: 392  ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD 451
            ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTL+YASKAKNIKN+PQL S I KD
Sbjct: 462  ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKD 521

Query: 452  ILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQ 511
            IL+KNIT EL++VKSDLLSTK +EG+YMSQ++Y+++ N+L+++KTE  ESKRIIERLSSQ
Sbjct: 522  ILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQ 581

Query: 512  NSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
            N+LLLKDK+ SNEVNELQRIKL   +D ++ L EK+E Q+ KEQ LV     L+++    
Sbjct: 582  NALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTF 641

Query: 572  QSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQ 631
            + +I+ Y  ++  +  +++ IL  + L  R +L ++   I+T +SG D         I  
Sbjct: 642  KKMIENYECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDF-------DIGS 694

Query: 632  NLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRL 691
            NL++++ EV+++LG  Q++AEK YK +IE  L++ P  F+ I   ++ + + +  +H  +
Sbjct: 695  NLDMIQNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAV 754

Query: 692  TENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDH 751
             +NLSDISE YNNLKQY N++ F+NNHE+++N+HI+ T Q L  SAD L   FK MM+ H
Sbjct: 755  AQNLSDISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKH 814

Query: 752  LKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALS 811
            L+ N+ LM+ S ++AT E I+KEM+LF P++KKWEES DLIN CDS++NGF  ++   LS
Sbjct: 815  LESNRNLMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLS 874

Query: 812  DIKSTFGSSTDVISRSVSKVKDEVK----GYEDAST--ILDGNEVVKRQIADIINKDSSL 865
              +S   +S + +  + +++K E+     GY   +T  +++ N++++ Q  ++  K+S  
Sbjct: 875  YTRSKITASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIF 934

Query: 866  RNGLYKSIKSSQGHISAFDELKERIRNTIASENSTLHQNKIATTPPLG--------QNSE 917
            ++ +  S+K +   ++  + L++ I+  +          +I   P  G        +N +
Sbjct: 935  QDNVENSLKCAVASVNNLNHLEDSIKMAV-------RDTRIKGGPTEGEVGVPFKKENGK 987

Query: 918  RSPLKPTVLQPNQLPENWRYGLRSPPKDQLSKSNG 952
              P KP  LQP Q P N  +   +  +DQ   +NG
Sbjct: 988  EGPTKPG-LQPLQ-PTNEIF--LNSQQDQQHTTNG 1018

 Score =  301 bits (770), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 161/179 (89%), Gaps = 5/179 (2%)

Query: 15  LNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKV 74
           LNITVAVR RGRNEREI+ KSSV+V+VPD+ GS+EV+INTTDDVGITAQMNSKTY VDKV
Sbjct: 52  LNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKV 111

Query: 75  FGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDSAG 134
           FGPSANQQLIF E+AEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLYN ELS+SAG
Sbjct: 112 FGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAG 171

Query: 135 IIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDD-----SVENSSMRKLRIYD 188
           IIPRILFKLF+TL++  EDYVVKCSF+ELYNE+LKDLL+D     +   S++ KLRI+D
Sbjct: 172 IIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLNDNNNSINNSKSNINKLRIFD 230

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..12123)
            [3015 nt, 1005 aa]
          Length = 1004

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/721 (47%), Positives = 512/721 (71%), Gaps = 37/721 (5%)

Query: 272  DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
            D  +G+YIQNL++FHITSA++G++LLQ+GL+ RQVA+TKMNDFSSRSHTIFTI LY+EH 
Sbjct: 298  DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357

Query: 332  GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR 391
            G++F++SKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSLADK+ H+PFR
Sbjct: 358  GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417

Query: 392  ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD 451
            ESKLTRLLQDSLGGNTKTALIATISPAK+NSEETCSTL+YA+KAK+IKN+PQL S I KD
Sbjct: 418  ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477

Query: 452  ILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQ 511
            ILVKNI +ELAKVK+DLLSTK R+GVYMSQ +YKE+TNDLESYKTE+QE KR+I+ L++Q
Sbjct: 478  ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537

Query: 512  NSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
            N LLLKDKKASNEV+ LQ+IKLQ+MKD +S L + +E QH+KEQ LVD+   LKS     
Sbjct: 538  NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597

Query: 572  QSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQ 631
            Q+ IK + +RE+    +M+ I  +E L+ + +L+ N+E I      N+         +  
Sbjct: 598  QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINN-------TDLGM 650

Query: 632  NLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRL 691
            N+  ++ EV  ++   Q  A  +YKD +E++++E+P +  ++++ + +++   + Y+++L
Sbjct: 651  NIEKIKDEVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQL 710

Query: 692  TENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDH 751
            + ++S+++  +N+LKQY N  FFK++HEE+LN HI+KTY  ++ ++ G++++ K  ++ +
Sbjct: 711  SISISELNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELY 770

Query: 752  LKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALS 811
            L++++ +++ SL++ T++ +  EM+LF P++KKWE+SF++IN CDS++N + GD+ + LS
Sbjct: 771  LEESRNIIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLS 830

Query: 812  DIKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYK 871
            ++K++  S++D++   VS+++        ++ + + ++ + +Q  +++ K+S L + L +
Sbjct: 831  NMKTSVTSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNE 890

Query: 872  SIKSSQGHISAFDELKERIRNTIASENSTLHQNKIA----TTPPLGQNS---------ER 918
            SI  ++  I+AFD+L E I +     N+    N I+    +T  + QN          E 
Sbjct: 891  SITMNESSINAFDKLSESIHSAFEKYNTA---NTISRLDESTNLMKQNKDGDISLDRVEM 947

Query: 919  SPLKPT---------VLQPNQLPENWRYGLRSPPKDQLSKSNGELKRHQDNETLEENVNK 969
             PL P          VL P+++  N      S  K Q SK    L   +D + +   V K
Sbjct: 948  LPLSPIFFSENKNNHVLSPSKVVVN-----SSAKKIQASKYQKRLNSTEDMDPIATKVQK 1002

Query: 970  I 970
            I
Sbjct: 1003 I 1003

 Score =  293 bits (751), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 141/189 (74%), Positives = 164/189 (86%), Gaps = 3/189 (1%)

Query: 1   MGSSPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGI 60
           M   P  G  D  ELNI VAVR RGRNEREI+AKSSVVVSVPDV GS E+AINTT+DVGI
Sbjct: 1   MSLDPDKGNGD--ELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGI 58

Query: 61  TAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTG 120
             QMNSKTY VDKVFGPSANQ+LIF+E+AEPLF DF++GYNCTVLVYGMTSTGKTYTMTG
Sbjct: 59  AGQMNSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTG 118

Query: 121 DEKLYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDS-VENS 179
           DE+LYN ELSDSAGIIPR+LFKLF+ ++ +++DY++KCSF+ELYNEELKDLLD+    NS
Sbjct: 119 DERLYNGELSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINS 178

Query: 180 SMRKLRIYD 188
           + +KLRI+D
Sbjct: 179 TAKKLRIFD 187

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/696 (48%), Positives = 476/696 (68%), Gaps = 21/696 (3%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEM 334
           S +YIQNLQ+FHIT+A+DG+ LLQ+GL++RQVA+TKMNDFSSRSHTIFTI LY+ H GE+
Sbjct: 259 SAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHNGEV 318

Query: 335 FKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESK 394
           F+VSKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSLADK+AH+PFRESK
Sbjct: 319 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESK 378

Query: 395 LTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILV 454
           LTRLLQDSLGGNTKTALIATISPAKIN+EET STL+YA+KAKNIKN+PQL + +MKDILV
Sbjct: 379 LTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMKDILV 438

Query: 455 KNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSL 514
           KNIT ELAK+KSD LSTK ++G+YM+QD+YKE+T+DLE+YKTE+QE KR IE+++SQN L
Sbjct: 439 KNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNSQNVL 498

Query: 515 LLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSV 574
           LLKDK+AS+EV+ELQRIK++++ D ++ L +K++ QHK EQ+LV     LK  +   Q+ 
Sbjct: 499 LLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYTVQNS 558

Query: 575 IKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLN 634
           +K     + Q    M+ +L      F+Q +   +  ++ +HS   +       GI  N++
Sbjct: 559 LKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHL-------GIDGNID 611

Query: 635 VLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTEN 694
           ++++E+ ++L      +  + +  +EKILE  P  F++I   +  +   V++Y   L +N
Sbjct: 612 IIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKN 671

Query: 695 LSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKD 754
           L DISE YNN ++Y N+H FKNNHEE L+ H+DKTY  L+ SA  L  KFK+MMD HL++
Sbjct: 672 LGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEE 731

Query: 755 NKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIK 814
           NK+LM+KSL++A+ E + KE++LF P ++KWE S + IN CDS++N F+  ++ AL  ++
Sbjct: 732 NKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLE 791

Query: 815 STFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIK 874
                S +    +   VKD +K ++  S +L  N  V   I ++  K + LR+ + ++  
Sbjct: 792 GNIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVERTSS 851

Query: 875 SSQGHISAFDELKERIRNTIASE------------NSTLHQNKIATTPPLGQNSERSPLK 922
             +     F+ + + IR  I  +            N  L Q       P+G  S R+P  
Sbjct: 852 YIEAANEKFEGIDQFIRQIIDKKLPTHLVGNGELVNVMLEQLGKTHLKPIGSAS-RTPSS 910

Query: 923 PTVLQPNQLPENWRYGLRSPPKDQLSKSNGELKRHQ 958
            +V     L  N   G+ SP K ++ ++  +  + Q
Sbjct: 911 RSVSPMKTLDNNIFNGI-SPSKRKVDETENDRSKSQ 945

 Score =  310 bits (795), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 141/179 (78%), Positives = 167/179 (93%)

Query: 10  EDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTY 69
           E+ +ELNITV+VR RGRNEREI+AKSSVVV+VPDV GS+EV+INTTD++GITAQMNSKTY
Sbjct: 12  ENGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTY 71

Query: 70  AVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDEL 129
            VDKVFGPSA+Q LIFK+IAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDE+LY+ EL
Sbjct: 72  TVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGEL 131

Query: 130 SDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYD 188
           SD+AGIIPRILFKLF+TL+ +DEDY+VKCSF+ELYNEELKDLL++  E+  ++KLRI+D
Sbjct: 132 SDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKLRIFD 190

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/658 (51%), Positives = 478/658 (72%), Gaps = 17/658 (2%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           D  +G+YIQNLQ+FHIT+A +GL LLQ+GL++RQVA+TKMNDFSSRSHTIFTITLY++HQ
Sbjct: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369

Query: 332 GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR 391
            E+F++SKMNLVDLAGSENI+RSGA +QRAKEAGSINQSLLTLGRVIN+LADKS H+PFR
Sbjct: 370 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFR 429

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD 451
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTL+YASKAKNIKN+PQL +FIMKD
Sbjct: 430 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 489

Query: 452 ILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQ 511
           ILVKNIT ELAK+KSDLLSTK +EG+YMSQD+YK + +DLESYK E+QE KR IE LSS+
Sbjct: 490 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSK 549

Query: 512 NSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
           NSLLLKDK  S +  + Q  +++++K  ++ L  +L+ QHK E E+      L+    + 
Sbjct: 550 NSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIM 609

Query: 572 QSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQ 631
           Q  +++Y +RE  ++++ +  + +E    +  L + +  +  N+         ++  IQ 
Sbjct: 610 QLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNI-------SQETNIQP 662

Query: 632 NLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRL 691
           NL++++ EV+ L+   Q++AE MYKD ++KIL E+P  F  I  K+D + V    ++  +
Sbjct: 663 NLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNI 722

Query: 692 TENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDH 751
            ENLSDISE  NNLKQY  +HFFKNNH+E+LN HID TY+ ++      ++ FK  ++DH
Sbjct: 723 AENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDH 782

Query: 752 LKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALS 811
           L++NK L+M++L +AT+  I++EM LFEP+R KWE SFDLIN CDS++N F  +M + LS
Sbjct: 783 LEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLS 842

Query: 812 DIKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYK 871
            IK+T  +S++ +++S+S +K +V+  E+A ++L  N+    Q   ++NK + L++ +  
Sbjct: 843 QIKNTVDTSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNIEN 902

Query: 872 SIKSSQGHISAFDELKERIRNTIAS----ENSTLHQ---NKIATTPPLGQNSERSPLK 922
           SI S+  HI+  D++ + I N + +    EN+  ++   N +   P L   S+R PL+
Sbjct: 903 SITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSL---SKRVPLR 957

 Score =  290 bits (743), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 154/188 (81%), Gaps = 8/188 (4%)

Query: 9   GEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKT 68
           G   EELNITVAVR RGRNEREI  KSSVVV+VPD+ GS EV+INTT D GITAQMN+K 
Sbjct: 29  GVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKR 88

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           Y VDKVFGP A+Q LIF E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLYN E
Sbjct: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148

Query: 129 LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLD--------DSVENSS 180
           LSD+AGIIPR+L KLF+TL+L+  DYVVKCSF+ELYNEELKDLLD        +  E   
Sbjct: 149 LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPF 208

Query: 181 MRKLRIYD 188
           M+KLRI+D
Sbjct: 209 MKKLRIFD 216

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/631 (51%), Positives = 442/631 (70%), Gaps = 14/631 (2%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEM 334
           S +YIQ+LQ+FHIT A++GL+LLQKGL +RQVA+TKMND SSRSHTIFT+TLY+   GE 
Sbjct: 267 SAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGET 326

Query: 335 FKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESK 394
           F+VSK+NLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSLADK+AH+PFRESK
Sbjct: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESK 386

Query: 395 LTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILV 454
           LTRLLQDSLGGNTKTALIATISPAKINSEET STL+YA+KAKNIKN+PQL SF+MKDILV
Sbjct: 387 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILV 446

Query: 455 KNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSL 514
           KNI+ ELAK+KSD LSTK +EG+YMS  +Y E+ ND+E+YKTEIQES+R IE+LSSQN L
Sbjct: 447 KNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQL 506

Query: 515 LLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSV 574
           L KDKK+S +  E QR++++N++  M  L EK++ +HK E EL +M   LK  +   Q  
Sbjct: 507 LHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGA 566

Query: 575 IKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQN-GIQQNL 633
           +K +   E+++   +Q +L    L++R+ +   +++++            EQ+  I  ++
Sbjct: 567 LKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQ--------QALEQSFTIDDDI 618

Query: 634 NVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTE 693
           N ++  +  LL   +K A  M ++  +K++ + P  F ++ ++++ +   V+ +  RL E
Sbjct: 619 NNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKE 678

Query: 694 NLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLK 753
            LS I+   NNLK Y + HFF+NNH+E+LN H DKTY QL  S+  L+ K   ++ DH++
Sbjct: 679 GLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVE 738

Query: 754 DNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDI 813
            N+TL+M +L++ATTE I +EM  FEP RK WE+SF+ IN CDS+SN F  D   +L+ +
Sbjct: 739 QNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSL 798

Query: 814 KSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSI 873
           KS   S+    S    K+KD +  ++D + I +    +   + DI NK S LR+ L K++
Sbjct: 799 KSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELEKNV 858

Query: 874 K----SSQGHISAFDELKERIRNTIASENST 900
                SS+G   A D   +RI N    E  T
Sbjct: 859 SFIHASSEG-FKAIDSSLKRIMNFRMPEGKT 888

 Score =  300 bits (768), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 168/187 (89%), Gaps = 2/187 (1%)

Query: 4   SPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQ 63
           S   G  + +ELNITVAVR RGRNE+EI+AKSSVVV+ PDV+G++EV+INT+ D+GITA+
Sbjct: 2   SATNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITAR 61

Query: 64  MNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEK 123
           MNSKTY VDKVFGPSA+Q L+FKEIA+P+F DF+KGYNCT+LVYGMTSTGKTYTMTGDEK
Sbjct: 62  MNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEK 121

Query: 124 LYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVEN--SSM 181
           LY+ ELS++AGIIPR+LFKLF+TL++++ DY+VKCSF+ELYNEELKDLLDD  ++  ++ 
Sbjct: 122 LYDGELSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNS 181

Query: 182 RKLRIYD 188
           RKLRIYD
Sbjct: 182 RKLRIYD 188

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/658 (46%), Positives = 450/658 (68%), Gaps = 13/658 (1%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEM 334
           S ++IQNLQ+FHI  A++G++LLQ+GLR+RQVA+TKMND SSRSHTIFTI LY++  GE 
Sbjct: 236 SAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGES 295

Query: 335 FKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESK 394
           F+VSKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSLADKS H+PFRESK
Sbjct: 296 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESK 355

Query: 395 LTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILV 454
           LTRLLQDSLGGNTKTALIATISPAKINSEET STL+YA+KAKNIKN+PQ+ SFIMKD+L+
Sbjct: 356 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLL 415

Query: 455 KNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSL 514
           K++TAEL K+KSDLLSTK ++G+YMSQ+NYKE+TN+LE+YKTE++E KR +E++S+QNSL
Sbjct: 416 KSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSL 475

Query: 515 LLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSV 574
           L+K+K+ SNEVNE Q++KL+ + + +  L +K++ QHK EQEL ++   L   L   Q  
Sbjct: 476 LIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQS 535

Query: 575 IKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTN--HSGNDILHEGEQNGIQQN 632
           ++ Y  + ++    M+ +L      F++ L++ IE ++ N   +G+D         ++ N
Sbjct: 536 LRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKINVDENGDD---------VEVN 586

Query: 633 LNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLT 692
           ++ +  E+  +         ++++++I+K+ ++ P  F+ I ++V+ +   V++Y   L 
Sbjct: 587 VDAVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESITSVVSSYSSNLM 646

Query: 693 ENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHL 752
            +LS ISE YNNLK Y N+HFFKNN +E L+ H+D+TY QL+ SA+ +  K ++M+++ L
Sbjct: 647 IHLSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEEL 706

Query: 753 KDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSD 812
             NK  MM+SL+ A +E + KEM L +P ++ WE S + IN CD ++N F   +   +++
Sbjct: 707 DTNKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNE 766

Query: 813 IKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKS 872
           I  T          +    K E+     A + L  N ++ + +  I  K + L++ +  S
Sbjct: 767 IFKTIDQGQKTSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDS 826

Query: 873 IKSSQGHISAFDELKERIRNTIASENSTLHQNKIATTPPLGQNSERS--PLKPTVLQP 928
               Q     F E+   I++ + ++     Q++      L Q +++S  PL P+   P
Sbjct: 827 ANYMQAATQKFGEIDNSIQDLLNAQTIPQPQSENPIDGLLEQLNDKSLKPLGPSGKTP 884

 Score =  294 bits (752), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 133/178 (74%), Positives = 160/178 (89%)

Query: 11  DAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYA 70
           D EELNITVAVR RGRNE+E++A+SSVVV+VPDV G++EV+INTT D GITAQ+NSKTY 
Sbjct: 3   DDEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYT 62

Query: 71  VDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELS 130
           VDKVFGPSA+Q LIFK IAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDE+LY+ ELS
Sbjct: 63  VDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS 122

Query: 131 DSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYD 188
           + AGIIPR+LFKLF+ L  + +DY++KCSF+ELYNEELKDLLD++ ++S  +KLRI+D
Sbjct: 123 EGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFD 180

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/594 (50%), Positives = 423/594 (71%), Gaps = 7/594 (1%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           D  + +YIQNL++FHITSA +GLQLLQKGL+ RQVA+TKMNDFSSRSH+IFTITLY+E  
Sbjct: 304 DQSASIYIQNLEEFHITSAMEGLQLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKEQN 363

Query: 332 GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR 391
           GE+F+VSKMNLVDLAGSENISRSGA +QRAKEAGSINQSLLTLGRVINSLADKS H+PFR
Sbjct: 364 GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD 451
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTL+YASKAKNIKN+PQL +FIMKD
Sbjct: 424 ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483

Query: 452 ILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQ 511
           ILV++IT+ELAK+KSDLLSTK +EGVYMS ++YK++  D+E YKTE++ESKR IE L++Q
Sbjct: 484 ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQ 543

Query: 512 NSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
           N++L +++ +  + N   +  + ++KD +  L   L+ Q  KE  +  +  +++      
Sbjct: 544 NAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEM 603

Query: 572 QSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQ 631
           +  I  +  +++++ + +   +  E    R  L  +IE ++ N    D         I  
Sbjct: 604 KKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKD-------TEISG 656

Query: 632 NLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRL 691
           NL  L +EVV+++  A++ A K Y + ++ +L+E P +F+++S ++D +       H ++
Sbjct: 657 NLMRLEKEVVKVIKAAEEEASKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKI 716

Query: 692 TENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDH 751
            E LSD+SE YNNLKQY  ++FFKNNHEE+L+ H+  TY QL+ ++  L+Q F  M+D H
Sbjct: 717 AETLSDVSEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKH 776

Query: 752 LKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALS 811
           +++NK  M++++   T E I+ E+Q+F  QR KWE+S  LIN CDS+++ F+  + S L 
Sbjct: 777 IQENKRHMLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLV 836

Query: 812 DIKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSL 865
           +I+    SS D I  ++S ++   +  +    ++ GN+V+++QI  I  K+ SL
Sbjct: 837 EIRDVVSSSRDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQKNKSL 890

 Score =  290 bits (741), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 158/178 (88%), Gaps = 2/178 (1%)

Query: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72
           EELNI VAVR RGRNEREI+AKSSVVV VPD   ++EV+INTTDDVGI A+MNSKTY VD
Sbjct: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89

Query: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132
           KVFGPSA+Q+L+++EIAEPLF DF+KGYNCT+LVYGMTSTGKTYTMTGDEKL+N EL D+
Sbjct: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149

Query: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLD--DSVENSSMRKLRIYD 188
           AGIIPR+LF+LF+TL+   +DY+VKCSFVELYNEELKDLLD  ++  NS  +KLRI+D
Sbjct: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFD 207

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/626 (47%), Positives = 445/626 (71%), Gaps = 7/626 (1%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEM 334
           + +YIQNL++FHI +AR+G+QLLQKGL+ RQVA+TKMND SSRSHTIFTI LY+EH+GE+
Sbjct: 236 ASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEI 295

Query: 335 FKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESK 394
           FK+SKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINS+ADK+ H+PFRESK
Sbjct: 296 FKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESK 355

Query: 395 LTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILV 454
           LTRLLQDSLGGNTKTALIATISPAK+N+EETCSTL+YA+KAK+IKN+PQL S IMKD+ +
Sbjct: 356 LTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRL 415

Query: 455 KNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSL 514
           K++  ELAK+K DL STK ++GVYM+Q++YK++TNDLESYKTEIQE  RI++ L  QN+L
Sbjct: 416 KDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNAL 475

Query: 515 LLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSV 574
           LLKDKKASNEVN+LQ + L  M + +S +   LE QHKKEQ LV+   + +      ++V
Sbjct: 476 LLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKTV 535

Query: 575 IKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLN 634
           IKEY ++E++I   M+ I   E ++ +++L+ N+  I      N I+    Q  ++ N+ 
Sbjct: 536 IKEYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIA---KENLIV----QTNVKDNIK 588

Query: 635 VLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTEN 694
           +++ +V+ ++  +Q+ ++K++ ++ ++I++E P + +  S+ V + +    TY   L EN
Sbjct: 589 LIKDDVISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFEN 648

Query: 695 LSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKD 754
           L  I + Y+ L +YF++ FFK+NH  ++N H++ T   ++ S   + ++F+Q M+   + 
Sbjct: 649 LESIKQQYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQ 708

Query: 755 NKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIK 814
           N+ L++++L++ +++ I  EM  F+  + +W+ SF  IN+CD ++N ++  M + L ++K
Sbjct: 709 NEKLILENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMK 768

Query: 815 STFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIK 874
               SS ++I + ++++K  V        +L+ +  +      II+K   L + L  S+ 
Sbjct: 769 GKLQSSDEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLN 828

Query: 875 SSQGHISAFDELKERIRNTIASENST 900
           S+Q  +  FDE+ + I+   A+ + T
Sbjct: 829 STQNSLLVFDEICKSIQFAFANYSKT 854

 Score =  305 bits (782), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 138/190 (72%), Positives = 169/190 (88%), Gaps = 3/190 (1%)

Query: 1   MGSSPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDV-- 58
           M + P    +D +E+NI VAVR RGRN+REI++KSSV+VSVPDVMGS+E++INT+DD+  
Sbjct: 1   MSADPQKIEDDTDEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVS 60

Query: 59  GITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTM 118
           G+TAQ+NSKTY VDKVFGPSANQ+LIF+EIAEPLF DFL+GYNCTVLVYGMTSTGKTYTM
Sbjct: 61  GLTAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTM 120

Query: 119 TGDEKLYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVEN 178
           TGDEKLY  +LSDSAGIIPR+LFKLFET++ + ++YV+KCSF+ELYNEELKDLL DS  N
Sbjct: 121 TGDEKLYKGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDS-NN 179

Query: 179 SSMRKLRIYD 188
           + ++KLRI+D
Sbjct: 180 TKLKKLRIFD 189

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/668 (47%), Positives = 440/668 (65%), Gaps = 25/668 (3%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           D  +G+YIQNLQ+FHIT+A++G++LLQKGL+ RQVA+TKMNDFSSRSHTIFTITL++E +
Sbjct: 285 DQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVK 344

Query: 332 GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR 391
           GE+F++SKMNLVDLAGSENI+RSGA +QRAKEAGSINQSLLTLGRVINSLADK+ HVPFR
Sbjct: 345 GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFR 404

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD 451
           ESKLTRLLQDSLGGNTKTALIATISPAK+  EETCSTL+YASKAKNIKN+PQL SFIMKD
Sbjct: 405 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKD 464

Query: 452 ILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQ 511
           IL+KNIT EL K+KSDLLSTK ++G+YM Q +YKE+T DL++YKTEIQE KR IE L+SQ
Sbjct: 465 ILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQ 524

Query: 512 NSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
           N+LLLKDK+  NE NELQRIK+Q M + M  L  K+E Q   E EL         T S  
Sbjct: 525 NALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKL 584

Query: 572 QSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQ 631
             +I E   RE  ++ + + +L        + L   IE+ +      +         + +
Sbjct: 585 TKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNF-------TVDE 637

Query: 632 NLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRL 691
           NL +++ E+  LL  A+   EK Y++ I K L + P +F  I++ V  ++   + Y+ ++
Sbjct: 638 NLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQI 697

Query: 692 TENLSDISEGYNNLKQYFNDHFF---KNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMM 748
            ENLSD+SE YNN KQ+  D F+   K +  E+LN +I+ T   ++ S++ ++   + ++
Sbjct: 698 AENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLL 757

Query: 749 DDHLKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRS 808
           ++HL+ NK L++ SL + TTE +  E+   +P+  KWEES +LIN  D+++N FN ++ S
Sbjct: 758 NEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVES 817

Query: 809 ALSDIKSTFGSSTDVISRSVSKVKDEVKGYEDAST---ILDGNEVVKRQIADIINKDSSL 865
           +++ +      + D I+ ++ K+ +  K  + A +   ++D N ++K     I  K+S L
Sbjct: 818 SMTTMTDKIKQTNDSINNNIKKINEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRL 877

Query: 866 RNGLYKSIKSSQGHISAFDELKERIRNT---------IASENSTL---HQNKIATTPPLG 913
              + +    +   +   +EL   IR           I   NS L   H++    T PL 
Sbjct: 878 HEFVKEGYLVTNESMKKLNELDTSIRTVLKDIDYEKDIKETNSPLKPSHKHDYNHTIPLD 937

Query: 914 QNSERSPL 921
            + +RS L
Sbjct: 938 NDKKRSFL 945

 Score =  307 bits (786), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 161/178 (90%), Gaps = 2/178 (1%)

Query: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72
           EELNITVAVR RGRN+REI AKSSVVV+VPD+MGS EVAINT++D+G TAQMNSKTY VD
Sbjct: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74

Query: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132
           KVFGPSA Q LIF EIAEPLF DF+KGYNCT+LVYGMTSTGKTYTMTGDEKLYN+ELSDS
Sbjct: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134

Query: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLL--DDSVENSSMRKLRIYD 188
           AGIIPRILFKLFETL+  +ED++VKCSFVELYNEELKDLL  D + +N + +KLRI+D
Sbjct: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFD 192

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/620 (46%), Positives = 426/620 (68%), Gaps = 7/620 (1%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEM 334
           S +YIQNLQ+FHIT+AR+G+ +LQKGL++RQVA+TKMNDFSSRSHTIFTI LY+ ++GE+
Sbjct: 245 SAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGEL 304

Query: 335 FKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESK 394
           F++SKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSLADKS H+PFRESK
Sbjct: 305 FRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESK 364

Query: 395 LTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILV 454
           LTRLLQDSLGGNTKTALIATISPAKIN++ET STL+YA+KAKNIKNRPQL SF+MKDILV
Sbjct: 365 LTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKDILV 424

Query: 455 KNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSL 514
           K+I++EL+K+KSD LSTK +EG+YMS ++Y+E+ NDLE+Y+TEIQESKR +E  SSQNSL
Sbjct: 425 KSISSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQNSL 484

Query: 515 LLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSV 574
           LLKDKKAS ++NELQ +K+  +++ +  L +K+E QH+ E +LV     LK  L   +  
Sbjct: 485 LLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTMKGS 544

Query: 575 IKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLN 634
           ++ Y   E ++   ++ +L Q    +R+ +  ++E ++T     ++        I  N++
Sbjct: 545 LQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNL-------SINHNMD 597

Query: 635 VLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTEN 694
            +R    E L   +     M  + ++ + ++  T +Q     +  ++  V TY   LT  
Sbjct: 598 EIRTIFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVTLTNK 657

Query: 695 LSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKD 754
           L++++E  NN+K+Y ++HF KNN++E+L+  ++K Y + + ++D L+     MM+ H+++
Sbjct: 658 LTEMTEENNNMKEYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALISSVVSMMESHMEE 717

Query: 755 NKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIK 814
           ++ LM+ S++ A +E IDKE+++F+P +++W  SF+ IN CD+    F       L+++K
Sbjct: 718 SRNLMLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLK 777

Query: 815 STFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIK 874
               +S         +V++ V  +E         E + +Q+ DI +K   L +    +IK
Sbjct: 778 ELADNSVVAADDVAKQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHFENNIK 837

Query: 875 SSQGHISAFDELKERIRNTI 894
             +     F+E+   I+  I
Sbjct: 838 YFKESSKGFEEMDCSIKKII 857

 Score =  293 bits (751), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 133/176 (75%), Positives = 160/176 (90%), Gaps = 2/176 (1%)

Query: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72
           EELNITVAVR RGRNEREI+AKS+VVV+VPDV GS+EV+INTT D+GI  +MNS+TY VD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVD 78

Query: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132
           +VFGPSA+Q+LIFK IAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY+ ELSDS
Sbjct: 79  QVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDS 138

Query: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYD 188
           AGIIPR+LF+LF+TL+  + D++VKCS++ELYNEELKDLLDD+ + S  ++LRI+D
Sbjct: 139 AGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYS--KRLRIFD 192

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/633 (47%), Positives = 433/633 (68%), Gaps = 18/633 (2%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           D+ + +YIQNLQ+F+I +A DG++LLQKGLR+R+VA+TKMND SSRSHTIFTITLY+EH 
Sbjct: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388

Query: 332 GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR 391
           G +++VSKMNLVDLAGSENI++SGAQHQRAKEAGSINQSLLTLGRVINSLADKS H+PFR
Sbjct: 389 GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 448

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD 451
           ESKLTRLLQDSLGGNTKT LI+TISPAKIN +ET STL+YASKAKNIKN+P L SFIMKD
Sbjct: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKD 508

Query: 452 ILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQ 511
           +L+KNIT EL K+KSDL+ST+L++GVYMSQ +YKE+ NDLESYKTE+QESKR  ERL SQ
Sbjct: 509 VLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQ 568

Query: 512 NSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
           N  LLKDKKASNE+NELQRI+++   + +  L E L+  +K+E  LV++   LK+  +  
Sbjct: 569 NGSLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLKNVGTSM 628

Query: 572 QSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDI----------- 620
           QS I+ Y +R+ +I E  + IL  EF    + L N +  I +N +GN I           
Sbjct: 629 QSTIENYRERDLEIEESTKKILENEF----KFLKNELSQILSNINGNIIDNLKSSIISNN 684

Query: 621 --LHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVD 678
             +   + +  Q+N++++    +++L   Q++++ +Y   IE+IL + P +      +++
Sbjct: 685 SSIEAIDSSNFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEIN 744

Query: 679 QVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSAD 738
            ++   N    ++TENLSD+SE YNN K+Y N+ F +NN+E +L +H++    Q++  ++
Sbjct: 745 SIDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSN 804

Query: 739 GLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSI 798
            LL    + +++    N  L  + L +   + + KE +  +P ++KW +S ++IN+ D I
Sbjct: 805 NLLLNINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKI 864

Query: 799 SNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVK-DEVKGYEDASTILDGNEVVKRQIAD 857
           +N F+ DM + +  I +    S + I+ S++ +K +E++  E  + IL  N      I +
Sbjct: 865 NNTFHNDMNNRILQINNLILQSHNDINNSINDIKVNEIRENEAVNEILSSNTEYVNNINE 924

Query: 858 IINKDSSLRNGLYKSIKSSQGHISAFDELKERI 890
           +  K+   +  L    KSS+  I+  D  K+ I
Sbjct: 925 LKIKNMDYQEKLKCIGKSSENSINYLDSTKQVI 957

 Score =  310 bits (793), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 165/177 (93%), Gaps = 1/177 (0%)

Query: 12  AEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAV 71
            EELNITVAVR RGRNERE++AKSSVVVSVPD+MGS+EV+INT+D+VGI A MNSKTY V
Sbjct: 8   GEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTV 67

Query: 72  DKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSD 131
           DKVFGPSA+Q L+FKEIAEPLF DF+KGYNCT+LVYGMTSTGKTYTMTGDEKLY+ ELSD
Sbjct: 68  DKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSD 127

Query: 132 SAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYD 188
           SAGIIPR+LFKLFE+ ++ ++DY++KCSFVELYNE+LKDLLDDSV+N + +KLRI+D
Sbjct: 128 SAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDN-TYKKLRIFD 183

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  527 bits (1357), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 283/672 (42%), Positives = 435/672 (64%), Gaps = 15/672 (2%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEM 334
           +G+YIQNL+DFHI++A++GLQLLQ+GL+ RQVATTK+ND SSRSHTIFTITLY++ + ++
Sbjct: 268 TGIYIQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVSSRSHTIFTITLYKKFKDDL 327

Query: 335 FKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESK 394
           +++SK+NLVDLAGSEN++++GA + RAKE+GSINQSLLTLGRVINSLADKSAH+PFRESK
Sbjct: 328 YRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPFRESK 387

Query: 395 LTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILV 454
           LTRLLQDSLGGNTKT LIATISPAKI +EETCSTL+YASKAKNIKN+PQL SFI+KDIL+
Sbjct: 388 LTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKDILL 447

Query: 455 KNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSL 514
           K+++ EL K+++DL  TK +EG+Y+SQ NYKE+ +DL+++KTE+ E KR  + L  +N L
Sbjct: 448 KDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQENEL 507

Query: 515 LLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSV 574
           L K+KK+  E  +  + +L N++  +  ++ KL   + +  +L +   ++    +  +S+
Sbjct: 508 LGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTELKSL 567

Query: 575 IKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLN 634
           I+ Y Q+ +    + Q +L  E       +++  + ++  +SGN  +H         +++
Sbjct: 568 IEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVNSGNYQIH--------THID 619

Query: 635 VLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTEN 694
            +R EV+ LL   ++ AE +YK  I+ +L+E P +FQ IS+ V  +      ++  +  N
Sbjct: 620 SIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARN 679

Query: 695 LSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKD 754
            SD+SE +N  KQY +  FF+NNH E++ +H D     +Q  +D LLQ  +  + ++L  
Sbjct: 680 FSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLST 739

Query: 755 NKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIK 814
           N  ++  S+     + I+KEM LF P++ KWEES DLIN  DS+SN F  +M  ++ DI 
Sbjct: 740 NAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDIA 799

Query: 815 STFGSSTDVISRSVSKVKDEVKGYE-DASTILDGNEVVKRQIADIINKDSSLRNGLYKSI 873
           S   +S + + RS+S +K  +   + ++   ++ NE++      I  K +++ + +   +
Sbjct: 800 SVIRNSNESMDRSISTIKKHIIENDINSQEQINSNELLTNSFKAIQEKSNNILHLVTGDL 859

Query: 874 K-SSQGHISAFDELKERIRNTIASENSTLHQNKIATTPPLGQNSERS----PLKPTVLQP 928
             ++Q  +     L   IR T+   +  +H  K    PP  +  E      PLKP+    
Sbjct: 860 TVTAQESMDGIQNLDRSIR-TLIHGDQYIHSTKGVHIPPQNRGPELHSTLIPLKPSSSNL 918

Query: 929 NQLPENWRYGLR 940
           N+L ++ +   R
Sbjct: 919 NRLSDSTKSSPR 930

 Score =  214 bits (545), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 119/209 (56%), Positives = 153/209 (73%), Gaps = 24/209 (11%)

Query: 1   MGSSPAG--GGEDA---EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTT 55
           +G+ P G  G   A   +++NITVAVR RGRN+REI AKS +VV+VPDV  + EV+INT+
Sbjct: 6   LGNDPGGEIGSASAMEKDDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTS 65

Query: 56  DDVGITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKT 115
              GI AQ+ +KTY VDKV+GP ++Q+L+F++ AEPLF DF++GYNCT+LVYGMTSTGKT
Sbjct: 66  GGSGIEAQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKT 125

Query: 116 YTMTGDEKLYND-ELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLL-- 172
           YTMTGD ++  + +++  AGI PRIL KLFE L    +DYVVKCSFVELYNE+L+DLL  
Sbjct: 126 YTMTGDVEMGAEGDVNGQAGIAPRILVKLFECL---QDDYVVKCSFVELYNEDLRDLLSE 182

Query: 173 --DD---SVENSSM--------RKLRIYD 188
             DD     ENSS         +KLRI+D
Sbjct: 183 GQDDFSNGTENSSKQPESLNASKKLRIFD 211

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  470 bits (1210), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 244/623 (39%), Positives = 411/623 (65%), Gaps = 7/623 (1%)

Query: 278 YIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKV 337
           YIQNL++FHIT+A++G+QLL +GL+NRQ+A++K   +SSR+ TIFTI LY+E +GE+F+V
Sbjct: 258 YIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRV 317

Query: 338 SKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTR 397
           SK N VDLAG+E+  +    +QR K+   INQ +  L +++NSL +K + +PF++SKLT 
Sbjct: 318 SKWNFVDLAGAEHSHKIEGTNQRFKDINIINQGIQNLNKIVNSLHEKESVIPFKDSKLTY 377

Query: 398 LLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNI 457
           L++D+L GN+K+  I T+   K + +E   TL++ +K +++K  P L   I K+ L+K+I
Sbjct: 378 LIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSI 437

Query: 458 TAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLK 517
           + ELAKVKSDLLSTK +EGVYMS ++Y  +T DL+ +K EI + K++I+ L+ Q++ L K
Sbjct: 438 SNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRK 497

Query: 518 DKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKE 577
           DK+A  EVNE+QRIKLQ+M+D +S +   +E Q ++E +L++ T  LK T++     I  
Sbjct: 498 DKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNMNVTIAR 557

Query: 578 YGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLR 637
           Y  RE  +  +M+ +  +E  + + ML+ N+     N   +++        I+ NLN   
Sbjct: 558 YTDRESSVQTQMKTLFNEELSKLKSMLLKNLRQFEKNELIDNL-------EIENNLNKAH 610

Query: 638 QEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSD 697
           +E+ ++L +++   + ++ D I+K+ EE+P +F +    V ++E + +  +  L E LSD
Sbjct: 611 EEIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLSD 670

Query: 698 ISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKT 757
           +SE +NNLKQY N+ FFKNNHEE+L ++++KTY Q+Q S+D  L KF  +++ +L+ NK+
Sbjct: 671 VSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKS 730

Query: 758 LMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTF 817
           +++++++SAT+E I+ EM  F PQ++KWE+S +LI      SN F    R  +  ++ T 
Sbjct: 731 VLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTL 790

Query: 818 GSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQ 877
             +++ +  ++S++K ++   + A+ I++ NEVV  +   I+ K+  L++ L  ++ S++
Sbjct: 791 KGTSESLFDTLSEMKSKINELQKAANIIENNEVVTEEFISIMKKNGILKDTLNINMTSTE 850

Query: 878 GHISAFDELKERIRNTIASENST 900
             I AFD+L + IRN   +E  T
Sbjct: 851 ESIVAFDKLDDSIRNVFKNEIDT 873

 Score =  132 bits (332), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 115/192 (59%), Gaps = 18/192 (9%)

Query: 4   SPAGGGEDAEELNITVAVRSRGR--NEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGIT 61
           S + G +D  E NI V  R +G+  NE+    +  +++  P +     +     DD    
Sbjct: 2   SLSDGVKDKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-----IKFKGKDDAV-- 54

Query: 62  AQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGD 121
                + + +D +F     Q+ ++ +  +P+F DF+ GYNC+ LVYG T +GKTYT++G+
Sbjct: 55  ----KREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGE 110

Query: 122 EK--LYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDD---SV 176
           E   L+++    S G+IPR+L +LF+ L   + D+VVKCS+VE+YNEELKDLL D   S+
Sbjct: 111 EDSLLHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSL 170

Query: 177 ENSSMRKLRIYD 188
            ++S++KLRI D
Sbjct: 171 LSASIKKLRIVD 182

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  445 bits (1145), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 301/967 (31%), Positives = 525/967 (54%), Gaps = 85/967 (8%)

Query: 10  EDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVM-GSHEVAINTTDDVGITAQMNSKT 68
           E A+  NITVAVR R   + E  + S  ++S+ D   G+    I   +  G       K 
Sbjct: 3   ESAKMENITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG-----RKKI 57

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDE---KLY 125
           Y +D V+G   +Q+ +F E   P +  F  GYN +++ YG   +GK YT+ G+    +  
Sbjct: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117

Query: 126 NDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVE-------- 177
           N+  S++ G++PR+L +LF+ L+    D+++KCSFVE+YN+EL+DLL D+          
Sbjct: 118 NNAESENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSN 177

Query: 178 ---NSSMRKLRIYDXXXXXXXXXXXXXXXXXXXPKLVTDPMIN----RRRM--RTVPLSS 228
               S+ +KLRI D                     L     I     R+RM  R++P ++
Sbjct: 178 GATGSTGKKLRIVDSASNGLRSAGSSNSSTRDNSPLTNSKKIPTAMMRKRMGKRSLPPNN 237

Query: 229 SLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDSPSGVYIQNLQDFHIT 288
           S++                                        +  + +YIQNLQ+  IT
Sbjct: 238 SISNNTANNNRLSLSRTNSFSDYSLQSSH--------------ERLNSIYIQNLQEITIT 283

Query: 289 SARDGLQLLQKGLRNRQVATT----KMNDFSSRSHTIFTITLYREHQ-GEMFKVSKMNLV 343
              +G+ +++KGL+NR++A+T      N+FS RSH+IF ITLY+E +  E+F++SK++ V
Sbjct: 284 EIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFV 343

Query: 344 DLAGSE----NISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLL 399
           + AGSE    N S++GA           N +L +  ++IN + + S +  F +SKLT+LL
Sbjct: 344 NFAGSEYGDNNTSKNGA----------FNSNLQSFNKMINGMVNNSTYASFLDSKLTQLL 393

Query: 400 QDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITA 459
           Q++  G T+T  IA I+P K   + TCS L  A+K K IKN P+  S I K+ L+K ++ 
Sbjct: 394 QNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSN 453

Query: 460 ELAKVKSDLLSTKLRE-GVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKD 518
           EL K KSDLLS K  + G+YM + +Y E+T  LESYK +IQ SK  I  L+ + + +  +
Sbjct: 454 ELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIE 513

Query: 519 KKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEY 578
           K+   E+NE QRIKLQN+++ +S L+  LE Q K+E EL ++   L S L   Q  +++Y
Sbjct: 514 KRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKY 573

Query: 579 GQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQ 638
             +E  +  +++++  +E ++ +  L +N  DI+ N   +D       + +  N++ ++ 
Sbjct: 574 SDKEIHLQNKLKLLYDKELVKLKNSLESNFADIK-NRMPDD------NDNMNTNIDNIKA 626

Query: 639 EVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDI 698
           E++++   +Q + +++  +   ++L+ +P  F+ +   +  +E +V   H + +E LSDI
Sbjct: 627 EILKIANQSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDI 686

Query: 699 SEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTL 758
           SE +NNL  Y ND+F K++HEE+++++I++TY ++Q  +    + FK+++D +++ N   
Sbjct: 687 SEEFNNLNNYINDNFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNTKS 746

Query: 759 MMKSLQSATTEAIDKEMQLFEPQRKKWE-ESFDLINNC-DSISNGFNGDMRSALSDIKST 816
           + KS+ S T+E ++ E+  F P++KKWE  S ++I N  +SI+   N +    L+ + S 
Sbjct: 747 LSKSITSLTSEIVENELTQFNPEKKKWELASNEIIENFNESITKNKNKN-SEILAKLLSE 805

Query: 817 FGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSS 876
             S++++   ++S +K  V+  E+ S I + N+++K +  +IINK+  L++ +  +  SS
Sbjct: 806 STSTSELFINNMSSIKKNVEIVEEFSEIFNSNDLIKSEFLEIINKNKKLKDLITDNFNSS 865

Query: 877 QGHISAFDELKERIRNTIASE------NSTLH---------QNKIATTPPLGQNSERSPL 921
           +  I +FD LKE ++N   +E      N TL+         Q K+       + + +  L
Sbjct: 866 ENSIDSFDNLKEAMQNVFKNEMKESYSNDTLNLKEIFEQMEQQKLGVNSSSKKKAYKQNL 925

Query: 922 KPTVLQP 928
            P+ + P
Sbjct: 926 SPSKISP 932

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  245 bits (625), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 139/295 (47%), Positives = 203/295 (68%), Gaps = 21/295 (7%)

Query: 273 SPSG--VYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTIT--LYR 328
           SP+G  ++++ +++ +I SA++GL+LL  G   R+VA TK ND SSRSHTIFTIT  + +
Sbjct: 245 SPNGYSIFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTIFTITTNVTK 304

Query: 329 EH--QGEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKS 385
            H   GE + KV K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D S
Sbjct: 305 IHPISGEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 364

Query: 386 AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLR 445
            H+P+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET STL+YA++AK+IKN PQ+ 
Sbjct: 365 QHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSIKNTPQVN 424

Query: 446 SFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESK--- 502
             + K+  +     E+ +++ +L ++  +EG+Y++Q+ ++  T +  S   E Q++K   
Sbjct: 425 QLMAKESCIIEYIQEIERLRKELRASHSKEGIYITQEKFE--TYESNSILVEEQQAKIDN 482

Query: 503 ------RIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDV---MSGLSEKLE 548
                 R+ E+   Q  L+ +      E++   R  L+  KD+   ++G+  KLE
Sbjct: 483 LQEQLRRLKEKFLEQTKLIKEKDGQIKELDVANRKYLEQSKDLTIYINGIHSKLE 537

 Score =  149 bits (375), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 86/197 (43%), Positives = 112/197 (56%), Gaps = 25/197 (12%)

Query: 10  EDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTY 69
           E   E NI V VR R RNEREIR KSSVV+S     G   +  N           ++KTY
Sbjct: 48  EGEPEYNIKVYVRCRSRNEREIREKSSVVISTLGNNGREVILTNP-------GTGSNKTY 100

Query: 70  AVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE- 128
             D+VFG  ++Q+ +F ++A     + ++GYNCTV  YG T TGKTYTM+GD  +     
Sbjct: 101 TFDRVFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITMMGSSE 160

Query: 129 -------LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLL----DDSVE 177
                  LS+ AGIIPR+L +LF  L    EDY VK SF+ELYNE+L+DLL    D S+E
Sbjct: 161 DDPNFVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLLVDDKDVSLE 220

Query: 178 NSSM------RKLRIYD 188
           + +         +RIYD
Sbjct: 221 DHNFNGMAPPESIRIYD 237

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  241 bits (615), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 167/216 (77%), Gaps = 8/216 (3%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL------YR 328
           S + ++ +Q+  I SA +GL LL +G   R+VA TK ND SSRSHT+FTIT        +
Sbjct: 239 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIEQDSK 298

Query: 329 EH-QGEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA 386
           EH Q + F K+ K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D S 
Sbjct: 299 EHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 358

Query: 387 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRS 446
           H+P+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STL+YA++AK+IKN PQ+  
Sbjct: 359 HIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNSPQVNQ 418

Query: 447 FIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQD 482
            + KD  +K+   E+ K+++DL +++ ++G++++QD
Sbjct: 419 SLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 454

 Score =  150 bits (378), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 84/197 (42%), Positives = 113/197 (57%), Gaps = 16/197 (8%)

Query: 5   PAGGGEDA-EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQ 63
           P     +A  E NI V VR R RN REI  KSSVV+S     G   +  N +     +++
Sbjct: 40  PICNNSNATSESNIHVYVRCRSRNRREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK 99

Query: 64  MNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEK 123
              KTY  D+VFG  ++Q+++F   A+    + L GYNCT+  YG T TGKTYTM+GD  
Sbjct: 100 ---KTYQFDQVFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDIN 156

Query: 124 LYNDE-------LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLL---- 172
           +  D        L + AGIIPR+L  LF+ L   +++Y VK SF+ELYNE LKDLL    
Sbjct: 157 ILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLKDLLSDNE 216

Query: 173 -DDSVENSSMRKLRIYD 188
            DD   N S +++RI+D
Sbjct: 217 DDDPTANDSKKQIRIFD 233

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  241 bits (615), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 137/278 (49%), Positives = 187/278 (67%), Gaps = 11/278 (3%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTI----TLYREH 330
           S + ++ +++ +I SA +GLQLL +G   R+VA+TK+ND SSRSHTIFTI    T     
Sbjct: 338 SSITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSHTIFTIITNVTKVDPV 397

Query: 331 QGEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVP 389
            G+ F K  K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D+S H+P
Sbjct: 398 TGKHFVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDRSHHIP 457

Query: 390 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIM 449
           +RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STL+YA++AK+IKN PQ+   + 
Sbjct: 458 YRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIKNTPQINQSLS 517

Query: 450 KDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDL-ESYKTEIQESKRIIERL 508
           KD  +     E+ +++++L   + +EG+Y++QD       DL ES    I E K  I+ +
Sbjct: 518 KDTFIHEYINEIDRLRNELKLARTKEGIYITQDQL-----DLYESNSILITEQKAKIDNM 572

Query: 509 SSQNSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEK 546
             Q            E N +   KL+  +D    LSEK
Sbjct: 573 EDQIKRFKAKYVEETESNRILLNKLEQSEDANQKLSEK 610

 Score =  117 bits (293), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 76/220 (34%), Positives = 104/220 (47%), Gaps = 63/220 (28%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEV-------AINTTDDVGIT------- 61
           NI V VR R R +REI  KSSVV+S     G+  +        +  T+  G T       
Sbjct: 51  NIKVYVRCRSRTQREIDEKSSVVISTLGANGNKVILSPNQSRKLYNTNANGSTRTKNNTN 110

Query: 62  -------------AQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYG 108
                           N +TY  DKVFG  ++Q+ +F+ +A+    + L+GYNCTV  YG
Sbjct: 111 LNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYEMLQGYNCTVFAYG 170

Query: 109 MTSTGKTYTMTGDEKLYND-------ELSDSAGIIPRILFKLF----------------- 144
            T TGKTYTM+GD  +  +        L + AGIIPR+L  LF                 
Sbjct: 171 QTGTGKTYTMSGDLNILGNLDSKDKILLGEHAGIIPRVLVYLFKELSKNDTITNTKVNNN 230

Query: 145 ------------ETLDLRDEDYVVKCSFVELYNEELKDLL 172
                       E ++L++ +Y VK SF+ELYNE+L DLL
Sbjct: 231 KNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLL 270

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  240 bits (613), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 143/334 (42%), Positives = 214/334 (64%), Gaps = 14/334 (4%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL------YR 328
           S + ++ +Q+  I SA +GL LL +G   R+VA TK ND SSRSHT+FTIT        +
Sbjct: 238 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSK 297

Query: 329 EH-QGEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA 386
           +H Q + F K+ K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D S 
Sbjct: 298 DHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 357

Query: 387 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRS 446
           H+P+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET STL+YA++AK+IKN PQ+  
Sbjct: 358 HIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQ 417

Query: 447 FIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDL-ESYKTEIQESKRII 505
            + KD  +K+   E+ K+++DL +++ ++G++++QD       DL ES    I E    I
Sbjct: 418 SLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQL-----DLYESNSILIDEQNLKI 472

Query: 506 ERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLK 565
             L  Q      +     +VN   + + + + +V+   +    + + + Q++      L 
Sbjct: 473 HNLRGQIKKFKGNYLNQLDVNNFLQSEKEKLINVIRNFNVDFSNFNSEIQKIHHTNLELM 532

Query: 566 STLSLTQSVIKEYGQREKQISERMQMILGQEFLQ 599
           + ++L + + +E  Q +   S+ +Q  + Q+ LQ
Sbjct: 533 NEITLQRDLSQETSQEQYTTSQELQTKITQQVLQ 566

 Score =  147 bits (372), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 111/198 (56%), Gaps = 15/198 (7%)

Query: 3   SSPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITA 62
           + P        + NI V VR R RN+REI  KSSVV+S     G   +  N +     + 
Sbjct: 38  TPPIYNSAATSDSNIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQ---SY 94

Query: 63  QMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDE 122
             + KTY  D+VFG  ++Q+ +F   A+    + L GYNCT+  YG T TGKTYTM+GD 
Sbjct: 95  SSSKKTYQFDQVFGAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDI 154

Query: 123 KLYNDE-------LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLL--- 172
            +  D        L + AGIIPR+L  LF+ L   +++Y VK +F+ELYNE LKDLL   
Sbjct: 155 NILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLLSDN 214

Query: 173 --DDSVENSSMRKLRIYD 188
             DD   N S R++RI+D
Sbjct: 215 EDDDPAVNDSKRQIRIFD 232

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  240 bits (613), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 167/216 (77%), Gaps = 8/216 (3%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL------YR 328
           S + ++ +Q+  I SA +GL LL +G   R+VA TK ND SSRSHT+FTIT        +
Sbjct: 239 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSK 298

Query: 329 EH-QGEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA 386
           +H Q + F K+ K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D S 
Sbjct: 299 DHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 358

Query: 387 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRS 446
           H+P+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET STL+YA++AK+IKN PQ+  
Sbjct: 359 HIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQ 418

Query: 447 FIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQD 482
            + KD  +K+   E+ K+++DL +++ ++G++++QD
Sbjct: 419 SLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 454

 Score =  137 bits (345), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 111/195 (56%), Gaps = 15/195 (7%)

Query: 6   AGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMN 65
              G    + NI V VR R RN+REI  KSSVV+S     G   +  N +     +++  
Sbjct: 42  CNNGAATSDSNIHVYVRCRSRNKREIEEKSSVVISTLGPQGKEIILSNGSHQSYSSSK-- 99

Query: 66  SKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLY 125
            KTY  D+VFG  ++Q+ +F   A+    + L GYNCT+  YG T TGKTYTM+GD  + 
Sbjct: 100 -KTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINIL 158

Query: 126 NDE-------LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVE- 177
            D        L + AGIIPR+L  LF+ L   +++Y VK SF+ELYNE LKDLL DS + 
Sbjct: 159 GDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNENLKDLLSDSEDD 218

Query: 178 ----NSSMRKLRIYD 188
               N   R++RI+D
Sbjct: 219 DPAVNDPKRQIRIFD 233

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  240 bits (612), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 167/216 (77%), Gaps = 8/216 (3%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL------YR 328
           S + ++ +Q+  I SA +GL LL +G   R+VA TK ND SSRSHT+FTIT        +
Sbjct: 239 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSK 298

Query: 329 EH-QGEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA 386
           +H Q + F K+ K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D S 
Sbjct: 299 DHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 358

Query: 387 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRS 446
           H+P+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STL+YA++AK+IKN PQ+  
Sbjct: 359 HIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTPQVNQ 418

Query: 447 FIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQD 482
            + KD  +K+   E+ K+K+DL +++ ++G++++QD
Sbjct: 419 SLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQD 454

 Score =  136 bits (343), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 109/185 (58%), Gaps = 15/185 (8%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKVF 75
           NI V VR R RN+REI  KSSVV+S     G   +  N +     +++   KTY  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQFDQVF 108

Query: 76  GPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE------- 128
           G  ++Q+ +F   A+    + L GYNCT+  YG T TGKTYTM+GD  +  D        
Sbjct: 109 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDKLL 168

Query: 129 LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDS-----VENSSMRK 183
           L + AGIIPR+L  LF+ L   + +Y VK SF+ELYNE LKDLL DS     V N + R+
Sbjct: 169 LGEHAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLKDLLSDSDDDDPVVNDTKRQ 228

Query: 184 LRIYD 188
           +RI+D
Sbjct: 229 IRIFD 233

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  238 bits (607), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 117/214 (54%), Positives = 164/214 (76%), Gaps = 5/214 (2%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL----YREHQ 331
            + ++ +++ +I SA++GL+LL +G   RQVA+TK ND SSRSHT+FTIT          
Sbjct: 251 SIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHTVFTITTNVTKVDPLS 310

Query: 332 GEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPF 390
           GE + K  K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D S H+P+
Sbjct: 311 GEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPY 370

Query: 391 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMK 450
           RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STL+YA++AK+IKN PQ+   + K
Sbjct: 371 RESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSIKNTPQINQSMTK 430

Query: 451 DILVKNITAELAKVKSDLLSTKLREGVYMSQDNY 484
           D  +     E+ +++ +L +T+ ++G+Y++Q+ Y
Sbjct: 431 DSCITEYIHEIDRLRKELRATRTKDGIYITQEKY 464

 Score =  148 bits (374), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 83/190 (43%), Positives = 113/190 (59%), Gaps = 12/190 (6%)

Query: 11  DAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYA 70
           D+   NI V VR R RN+REI  KSSVV+S     G   +  N +     +     KTY 
Sbjct: 49  DSPGYNIKVYVRCRSRNKREIGEKSSVVISTMGAQGRDVILSNPSSSSSGSLTNVKKTYT 108

Query: 71  VDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKL-----Y 125
            D+VFG  ++Q+++F  +A+    + L+GYNCTV  YG T TGKTYTM+GD  +     +
Sbjct: 109 FDRVFGAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTTH 168

Query: 126 NDE-----LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDS--VEN 178
           N +     LS+ AGIIPR+L  LF+ L     DY VK SF+ELYNE LKDLL DS   ++
Sbjct: 169 NHDQSSILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLLADSNKEDD 228

Query: 179 SSMRKLRIYD 188
           ++   +RI+D
Sbjct: 229 NNAESIRIFD 238

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  237 bits (605), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 132/286 (46%), Positives = 196/286 (68%), Gaps = 11/286 (3%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL----YREH 330
           S + ++ +++ +I SA  GLQLL  G   R+VA TK ND SSRSHT+FTIT         
Sbjct: 240 SSIMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDPV 299

Query: 331 QGEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVP 389
            GE + K  K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D + H+P
Sbjct: 300 SGEQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHIP 359

Query: 390 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIM 449
           +RESKLTRLLQDSLGG TKT +IATISPAKI+ +ET STL+YA++AK+IKN PQ+   + 
Sbjct: 360 YRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSMS 419

Query: 450 KDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITND---LESYKTEIQESKRIIE 506
           KD  +     E+ +++ +L +++ ++G+ ++QD +    ++   ++  KT+IQ  +  I+
Sbjct: 420 KDSCINEYVHEIERLRQELKTSRQKDGISITQDQFDLYESNGILVDEQKTKIQNMEEQIQ 479

Query: 507 RLSS---QNSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLES 549
           R      + + L K+ ++  + NELQ I+L++ +  +  L E  +S
Sbjct: 480 RFKDKYVKQTELNKNLESRLKQNELQTIQLKSQRTQLLSLLENFQS 525

 Score =  142 bits (357), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 79/180 (43%), Positives = 107/180 (59%), Gaps = 14/180 (7%)

Query: 17  ITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKVFG 76
           I V VR R RNEREI+ KSSVV+S    +G+ +       +  +      +TY  D+VFG
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVIST---LGAPQSTQLLLSNPLLPLAYAKRTYTFDRVFG 117

Query: 77  PSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE-------- 128
             ++Q+ +F + A+    + L+GYNCTV  YG T TGKTYTM+GD  +   +        
Sbjct: 118 AESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMVL 177

Query: 129 LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYD 188
           L + AGIIPR+L +LF  LD  +E Y VK SF+ELYNE LKDLL  + E S    +RI+D
Sbjct: 178 LGEHAGIIPRVLVELFRWLD-GNEGYSVKVSFLELYNERLKDLL--ASEQSEEENIRIFD 234

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  236 bits (602), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 166/218 (76%), Gaps = 5/218 (2%)

Query: 273 SPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTIT--LYREH 330
           S   + ++ +++ +I SA++GL+LL +G   R+VA T+ ND SSRSHTIFTIT  + + H
Sbjct: 251 SGHSIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHTIFTITTNVTKIH 310

Query: 331 --QGEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAH 387
              GE + K+ K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D S H
Sbjct: 311 PISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQH 370

Query: 388 VPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSF 447
           +P+RESKLTRLLQDSLGG TKT +IAT+SPAK + EET STL+YA++AK+IKN PQ+   
Sbjct: 371 IPYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKSIKNTPQINQL 430

Query: 448 IMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYK 485
           + K+  +     E+ K++ +L +   +EG+Y++++ Y+
Sbjct: 431 MAKESCILGYIKEIEKLRKNLKANHAKEGIYITEEKYE 468

 Score =  147 bits (370), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 79/172 (45%), Positives = 102/172 (59%), Gaps = 15/172 (8%)

Query: 9   GEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKT 68
           G + +  NI V VR R RN REI+ KSSVVVS     G   +  N +         N+KT
Sbjct: 49  GSEEQGYNIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREIILSNQSTG-------NNKT 101

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           Y  D+VFG  ++Q+ +F ++A     + L+GYNCTV  YG T TGKTYTM+GD  +    
Sbjct: 102 YTFDQVFGVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGAS 161

Query: 129 LSDS--------AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLL 172
           L D         AGIIPR+L +LF+ L    EDY VK SF+ELYNE+L+DLL
Sbjct: 162 LEDPNYVLLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLL 213

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  236 bits (601), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 124/241 (51%), Positives = 175/241 (72%), Gaps = 11/241 (4%)

Query: 277 VYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREH----QG 332
           + ++ +++ +I SA +GLQLL KG   R+VA TK ND SSRSHTIFTI  +        G
Sbjct: 268 ITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIVTHVARTDPVSG 327

Query: 333 EMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR 391
           E + K+ K+NLVDLAGSENI+RSGA++ RA+EAG IN+SLLTLGRVIN+L + S+H+P+R
Sbjct: 328 EQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINALVEHSSHIPYR 387

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD 451
            SKLTRLLQDSLGG TKT +IATISPA+I+ +ET STL+YA++AK+IKN PQ+   + KD
Sbjct: 388 GSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKNTPQVNQSLSKD 447

Query: 452 ILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDL-ESYKTEIQESKRIIERLSS 510
             +     E+ +++ +L +++ REG+Y++Q+ Y     DL ES    ++E K +I+ +  
Sbjct: 448 SCIMEYIYEIERLRQELKASRQREGMYITQEQY-----DLYESNSLLVEEQKVVIQNMGE 502

Query: 511 Q 511
           Q
Sbjct: 503 Q 503

 Score =  147 bits (371), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 82/180 (45%), Positives = 107/180 (59%), Gaps = 13/180 (7%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKVF 75
           NI V VR R RN+REI  KSSVVVS     G   +  N +  +        KTY  D+VF
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVVSTMGRKGKSVILSNPSSPLS----HPKKTYMFDEVF 99

Query: 76  GPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYND-------E 128
           G  ++Q+ IF E+A+    + L+GYNCTV  YG T TGKTYTM+GD  ++ D        
Sbjct: 100 GADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIWGDLDSQDKIL 159

Query: 129 LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYD 188
           L + AGIIPR+L  LF+ L     ++ VK SF+ELYNE LKDLL D+  +S    +RI+D
Sbjct: 160 LGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLLADN--DSDEDNIRIFD 217

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  235 bits (600), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 139/347 (40%), Positives = 213/347 (61%), Gaps = 56/347 (16%)

Query: 277 VYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQG---- 332
           + ++ +++F+I SA +GL+LL  G   R+VA TK ND SSRSHT+FTIT           
Sbjct: 248 IMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTITTNVARTDPVSN 307

Query: 333 -EMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR 391
            +  K+ K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D S H+P+R
Sbjct: 308 EQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQHIPYR 367

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD 451
           ESKLTRLLQDSLGG TKT +IATISPAKI+ +ET STL+YA++AK+IKN PQ+   + K+
Sbjct: 368 ESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQSMSKN 427

Query: 452 ILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQ 511
             +     E+ +++ +L +++ +EG+Y+++D ++                      L   
Sbjct: 428 SCLGEYIHEIERLRQELKASRQKEGMYITEDQFQ----------------------LYES 465

Query: 512 NSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
           NS+L+++          Q++++QNM+D +     K   Q        +++ + +  L  +
Sbjct: 466 NSILVEE----------QKVRIQNMEDQILKFKAKYVEQ-------TNLSKDAEKRLKQS 508

Query: 572 QSVIKEYGQREKQISERMQMILGQEFLQFRQML---VNNIEDI-RTN 614
           Q + K+    + ++SE  Q         FRQ     V+++EDI R+N
Sbjct: 509 QLLCKKLSIEKAEMSENFQ--------SFRQTCTEYVDSVEDIHRSN 547

 Score =  145 bits (365), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 77/180 (42%), Positives = 106/180 (58%), Gaps = 13/180 (7%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKVF 75
           N+ V VR R RNE+EI  KSSVV+S     G   +  N    +      + +TY  D+VF
Sbjct: 41  NMRVYVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNGAGSLS----HSKRTYTFDQVF 96

Query: 76  GPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYND-------E 128
           G  ++Q+ +F E+A+    + L+GYNCTV  YG T TGKTYTM+GD  +  D        
Sbjct: 97  GAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISILGDLDSQDKIL 156

Query: 129 LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYD 188
           L + +GIIPR+L  LF+ L     +Y VK SF+ELYNE+LKDLL +S +      +RI+D
Sbjct: 157 LGEHSGIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLLAESEQEE--ENIRIFD 214

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  234 bits (596), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 163/216 (75%), Gaps = 5/216 (2%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTI----TLY 327
           ++ S + ++ +++ +I SA +GLQLL  G   R+VA+TK ND SSRSHT+FTI    T  
Sbjct: 284 NASSSIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATNITKI 343

Query: 328 REHQGEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA 386
               GE + K  K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D S 
Sbjct: 344 DPISGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQ 403

Query: 387 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRS 446
           H+P+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET STL+YA +AK+IKN PQ+  
Sbjct: 404 HIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQINQ 463

Query: 447 FIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQD 482
            + KD  +    +E+ +++ +L +++ ++G+ ++QD
Sbjct: 464 SMSKDTCINEYVSEIERLRLELKTSRQKDGICITQD 499

 Score =  142 bits (359), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 106/180 (58%), Gaps = 14/180 (7%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKVF 75
           NI V VR R R+EREI+ KSSVV+S     G+  +  N +  +        K+Y+ D+VF
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYPK----KSYSFDRVF 163

Query: 76  GPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYND-------E 128
           G  ++Q+ +F + A+    + L GYNCTV  YG T TGKTYTM+GD  +  +        
Sbjct: 164 GAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLESKDMIL 223

Query: 129 LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYD 188
           L + AGIIPR+L  LF+ L L + DY VK SF+ELYNE LKDL   +   S    +RI+D
Sbjct: 224 LGEHAGIIPRVLVNLFKMLALEN-DYSVKISFLELYNERLKDLFAQN--ESEEETIRIFD 280

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  230 bits (586), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 165/215 (76%), Gaps = 5/215 (2%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREH---- 330
           S + ++ +++ +I SA +GLQLL +G   R+VA+TK ND SSRSHTIFTIT         
Sbjct: 252 SSIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKCNDLSSRSHTIFTITTNITKIDPV 311

Query: 331 QGEMF-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVP 389
            GE + K+ K+NLVDLAGSENISRSGA++ RA+EAG IN+SLLTLGRVIN+L D S H+P
Sbjct: 312 SGEQYVKIGKLNLVDLAGSENISRSGAENMRAQEAGLINKSLLTLGRVINALVDHSQHIP 371

Query: 390 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIM 449
           +RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STL+YA++AK+IKN PQ+   + 
Sbjct: 372 YRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYATRAKSIKNTPQINQSMS 431

Query: 450 KDILVKNITAELAKVKSDLLSTKLREGVYMSQDNY 484
           KD+ +     E+ +++ +L +++ ++GVY++Q+ +
Sbjct: 432 KDVCINEYVQEIERLRQELKASRQKDGVYITQEQF 466

 Score =  147 bits (371), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 106/180 (58%), Gaps = 13/180 (7%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKVF 75
           NI V VR R RN+REI  KSSVV+S    MG+    +  +D   + +    KTY  D+VF
Sbjct: 59  NIQVYVRCRSRNQREIEEKSSVVIST---MGAQGKEVVLSDPSSVLSH-TKKTYIFDQVF 114

Query: 76  GPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYND-------E 128
           G  ++Q+++F   A+    + L+GYNCT+  YG T TGKTYTM+GD  +  D        
Sbjct: 115 GVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINILGDLESQDKIL 174

Query: 129 LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYD 188
           L + AGIIPR+L  LF+ L     +Y VK SF+ELYNE LKDLL  S E      +RI+D
Sbjct: 175 LGEHAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLLSQSKETE--ESIRIFD 232

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  171 bits (433), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 102/201 (50%), Positives = 135/201 (67%), Gaps = 31/201 (15%)

Query: 273 SPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTIT-----LY 327
           S S + ++ +Q+  I +A +GL LL KG   R+V +TK+ND SSRSHTIFTIT     L 
Sbjct: 204 SDSSIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTKLNDLSSRSHTIFTITTNIIKLD 263

Query: 328 REHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAH 387
            +   E  K+ K+NLVDLAGSENI++SG +  R++E G IN+SLLTLGRVIN+L+DK+ +
Sbjct: 264 NQTNKEYIKIGKLNLVDLAGSENITKSGLK--RSQETGLINKSLLTLGRVINALSDKTNN 321

Query: 388 ------------------------VPFRESKLTRLLQDSLGGNTKTALIATISPAKINSE 423
                                   +P+RESKLTRLLQDSLGG TKT +IATISPAK   +
Sbjct: 322 THGSNNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKTCLD 381

Query: 424 ETCSTLQYASKAKNIKNRPQL 444
           ET STL+YA++A +IKN P++
Sbjct: 382 ETISTLEYATRAMSIKNNPKI 402

 Score =  129 bits (323), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 95/172 (55%), Gaps = 24/172 (13%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKVF 75
           NI V VR R RN++EI  KSSVVVS     G+  +  N+T         N   Y  D VF
Sbjct: 9   NIKVYVRCRSRNQKEIDEKSSVVVSTLGQNGNQIIISNST---------NKNKYIFDNVF 59

Query: 76  GPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYND-------E 128
           G  ++Q+ IF  +A     + + GYNCT+  YG T TGKTYTM+GD  +  D        
Sbjct: 60  GVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNIIGDLNSTKNIL 119

Query: 129 LSDSAGIIPRILFKLFETL--------DLRDEDYVVKCSFVELYNEELKDLL 172
           L + AGIIPR+L +LF +L        +   + Y VK SF+ELYNE LKDLL
Sbjct: 120 LGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNERLKDLL 171

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  139 bits (349), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 118/175 (67%), Gaps = 8/175 (4%)

Query: 278 YIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREH---QGEM 334
           +++ L +F +    + L+ +++G R R V  T MN+ SSRSH IFTI++ +      G++
Sbjct: 198 FVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISIKQSETTLAGDL 257

Query: 335 F-KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAH--VPFR 391
             + S + LVDLAGSE +S +GA+  R KE  +IN+SL TLGRV++ LA K+    +P+R
Sbjct: 258 TERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNRPKLIPYR 317

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRS 446
           +S LT +L+++LGGN+KT +IA +SP   + EET STL+YA+ AK +KN  ++ S
Sbjct: 318 DSALTWVLKENLGGNSKTVMIACVSPC--DYEETISTLRYATTAKEVKNTARVNS 370

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 93/191 (48%), Gaps = 26/191 (13%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPD--VMGSHEVAINTTDDVGITAQMNSKTYAVDK 73
           NI VAVR R    RE        V+ P   V+  H   I+T+  +        K +  D 
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSPTSFVIQQH---ISTSSLLATEEFTQGKIFTFDH 60

Query: 74  VFGPSAN----QQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDE---KLYN 126
            F  S N    Q++I+  I        L GYN  +L YG T +GK++TM G E     +N
Sbjct: 61  CFKYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHN 120

Query: 127 DE------LSDSA-GIIPRILFKLFETLDL--RDED-----YVVKCSFVELYNEELKDLL 172
           ++      + DSA GIIPR+   LF+  ++   +ED     + + CS++E+YNE+++DLL
Sbjct: 121 NQTALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQVRDLL 180

Query: 173 DDSVENSSMRK 183
            +      +R+
Sbjct: 181 SEDGSKCRVRE 191

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  140 bits (352), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 111/174 (63%), Gaps = 8/174 (4%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL-YREHQGE 333
           SG+Y++ L   ++TS ++ L  +++G   R V++T MN  SSRSH+I  I L  R    E
Sbjct: 195 SGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIVRINLEKRNALEE 254

Query: 334 MFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLAD-------KSA 386
             + S + LVDLAGSE + ++ A     +EA  IN SL  LG VIN+L          SA
Sbjct: 255 NIQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINALTQVESKSKRTSA 314

Query: 387 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKN 440
           H+P+R+SKLTRLLQDSLGGN+KT LI   S ++ N +ET STL++ S+AK IKN
Sbjct: 315 HIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSRAKKIKN 368

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 75/129 (58%), Gaps = 11/129 (8%)

Query: 61  TAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTG 120
           + Q N + +  D+VF   + Q+ +++ +A  +   F +GYN T+L YG T +GK++TM G
Sbjct: 67  STQNNDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFG 126

Query: 121 DEKLYNDELSDSAGIIPRI---LFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVE 177
            +        ++ G+IPRI   +FK  ET D  D  + V  SF+E+Y E++ DLL  S+E
Sbjct: 127 PK--------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLLAQSLE 178

Query: 178 NSSMRKLRI 186
             + +++ +
Sbjct: 179 KPADKRISL 187

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  135 bits (340), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 112/173 (64%), Gaps = 8/173 (4%)

Query: 278 YIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKV 337
           +++ LQ+F + S  + L  L++G   + V  T +N+ SSRSHTIFTI + ++    +  V
Sbjct: 169 FVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHV 228

Query: 338 ----SKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAH--VPFR 391
               S + L+DLAGSE  + SGA  +R KE  +IN+SL TLGRVI  LA K     +P+R
Sbjct: 229 LERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYR 288

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQL 444
           ++ LT +L++SLGGN+KT +IA +SP     EET STL+YA+ A+++K   QL
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCDF--EETMSTLRYATLARSVKTFAQL 339

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 57/100 (57%), Gaps = 15/100 (15%)

Query: 80  NQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDSAGIIPRI 139
           +Q  +++++A       L GYN  +  YG T +GK++TMTG  +L         GI+PR+
Sbjct: 62  DQAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL--------PGIVPRM 113

Query: 140 LFKLFETLDLRDED-------YVVKCSFVELYNEELKDLL 172
             +LFE  ++ +         + ++CS++E+YNE ++DLL
Sbjct: 114 CQELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLL 153

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  135 bits (339), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 72/173 (41%), Positives = 115/173 (66%), Gaps = 8/173 (4%)

Query: 278 YIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKV 337
           +++ L++F ++S  D L  +++G   R + +T +N++SSRSHTIFTI++ ++ +  +  V
Sbjct: 169 FVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALGHV 228

Query: 338 ----SKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAH--VPFR 391
               S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ LA +     +P+R
Sbjct: 229 IERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIPYR 288

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQL 444
           ++ LT +L++SLGGN+KT +IA +SP   + EET STL+YA+ A+N+K   QL
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPC--DYEETLSTLRYATLARNVKTCAQL 339

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 86/168 (51%), Gaps = 29/168 (17%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKVF 75
           NI VAVR R   ERE+    S++  V D  G+    I   D      +  ++++  D+ F
Sbjct: 4   NIKVAVRLRRPLEREV--DESIIARVED--GN---VIQVKDR---NQKNETRSFHFDQCF 53

Query: 76  GPS----ANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSD 131
             S    A+Q  ++++++       L GY+  V  YG T +GK++TMTG          +
Sbjct: 54  AYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGS--------PE 105

Query: 132 SAGIIPRILFKLFETLDLRDED-------YVVKCSFVELYNEELKDLL 172
           S GI+ R+  +LFE  ++ +         + ++CS++E+YNE ++DLL
Sbjct: 106 SPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLL 153

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  131 bits (329), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 111/174 (63%), Gaps = 5/174 (2%)

Query: 278 YIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKV 337
           ++Q++  F +    + L+ L  G   R VA+T+MN  SSRSH IFT+++ ++      + 
Sbjct: 149 FVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIKQQEPDGSIRE 208

Query: 338 SKMNLVDLAGSE--NISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAH-VPFRESK 394
           S + LVDLAGSE  N +      +R KE  +IN+SL TLGR I+ LA  S H +P+R+S 
Sbjct: 209 SDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIPYRDSL 268

Query: 395 LTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFI 448
           LT +L+++LGGN+KT +IA ISP  I+ EE+ STL+YA+ AK IK R  +   +
Sbjct: 269 LTWVLKENLGGNSKTCMIACISP--IDLEESLSTLRYATTAKEIKLRATMNEIV 320

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 61/111 (54%), Gaps = 11/111 (9%)

Query: 67  KTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 126
           +++  D +F  S++Q  I  E+        L+GYN  +  YG T +GKTYTM G      
Sbjct: 35  RSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRGT----- 89

Query: 127 DELSDSAGIIPRILFKLFETLDLRDEDYV--VKCSFVELYNEELKDLLDDS 175
              + + GIIP +   LF+ L+L D+  V  V  ++ E+YNE+L DLL D+
Sbjct: 90  ---NSNPGIIPLLCRDLFDALEL-DKTTVSSVSITYFEIYNEKLIDLLGDT 136

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/178 (38%), Positives = 109/178 (61%), Gaps = 8/178 (4%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           DS  G+ + NL      + +D + L+ +G  NR  + T  N+ SSRSH +  I + ++++
Sbjct: 247 DSIKGISVANLSHHTPQTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAVLQINVVQKNR 306

Query: 332 ----GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA----D 383
                E    + ++++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L      
Sbjct: 307 TAELSEAHTFATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRR 366

Query: 384 KSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
            + HVP+R+SKLTRLL+ SLGGN KT +I  I+P+  + +ET +TL+YA++AK IK +
Sbjct: 367 STCHVPYRDSKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIKTK 424

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 64/120 (53%), Gaps = 13/120 (10%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F   A Q  +++    PL    L G+N TV  YG T  GKT+T++G        
Sbjct: 136 FVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 187

Query: 129 LSDSAGIIPRILFKLFETL-DLRDEDYV-VKCSFVELYNEELKDLLDDSVENSSMRKLRI 186
             +  G+I   + +LF+ + DL+D  +  +  S++E+YNE ++DLL   +   S +KL I
Sbjct: 188 TPEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLLSPDI---SSKKLVI 244

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  124 bits (312), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 77/180 (42%), Positives = 114/180 (63%), Gaps = 10/180 (5%)

Query: 272 DSPSGV-YIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREH 330
           D P  V YI+ L D  + S  + L+ +++G   R VA T +N+ SSRSH I TI + ++ 
Sbjct: 166 DGPRKVTYIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINI-QQT 224

Query: 331 QGEMF-----KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA-DK 384
           + + F     +VS + LVDLAGSE    S  + +R KE  +IN+SL+TL RV+  L+ +K
Sbjct: 225 EIDSFGDTVERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNK 284

Query: 385 SAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQL 444
              VP+RES LTR+L+D+L GN+ T ++A ISP   + EE+ STL+YAS AK+++    L
Sbjct: 285 VTGVPYRESLLTRVLRDNLDGNSITCILACISPC--DYEESISTLRYASTAKHVRTEAHL 342

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/169 (32%), Positives = 86/169 (50%), Gaps = 29/169 (17%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVM---GSHEVAINTTDDVGITAQMNSKTYAVD 72
           NI VA+R R +  RE         S P V+    S+E+ +   +   +   +   T+  D
Sbjct: 4   NIKVAIRIRDKISRE--------TSRPSVIKRKTSNEITLQKDNTANVITTVE-HTFYFD 54

Query: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132
           +VF  S+NQ+ I+ E+A       L+GY+  V+ YG T  GKTYTM G E+         
Sbjct: 55  QVFDESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTEQ--------E 106

Query: 133 AGIIPRILFKLFETLDLR-----DED----YVVKCSFVELYNEELKDLL 172
            GIIP +  +LF+ +D+      DED    + V  S+ ++YNE++ D+L
Sbjct: 107 PGIIPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDML 155

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  127 bits (319), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 69/178 (38%), Positives = 109/178 (61%), Gaps = 8/178 (4%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           D+ S + + NL   H T+  D + L+ +G  NR  + T+ N+ SSRSH +  I + + ++
Sbjct: 264 DTQSHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 332 ----GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA----D 383
                     + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      
Sbjct: 324 LVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 384 KSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
           +S H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA++AK IK +
Sbjct: 384 RSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 61/106 (57%), Gaps = 10/106 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F  +++Q  ++KE   PL    L G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 129 LSDSAGIIPRILFKLFETL-DLRDE-DYVVKCSFVELYNEELKDLL 172
                GII   + +LF  + DLRDE ++ +  S++E+YNE ++DLL
Sbjct: 206 -PSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDLL 250

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  127 bits (318), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 107/179 (59%), Gaps = 9/179 (5%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           DS   + + NL  ++     D + L+ KG  NR  + T  N+ SSRSH +  I + + ++
Sbjct: 239 DSNESIRVSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIMQHNR 298

Query: 332 GEMFK----VSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA----- 382
               K     + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      
Sbjct: 299 TADLKSDHTFATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLNDGT 358

Query: 383 DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
            +S HVP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA++AK IK +
Sbjct: 359 RRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKTK 417

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 68/122 (55%), Gaps = 13/122 (10%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D++F   + Q+ +++    PL    L G+N TV  YG T  GKTYT++G        
Sbjct: 128 FVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGS------- 180

Query: 129 LSDSAGIIPRILFKLFETLD-LRD-EDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRI 186
             ++ GII + + +LF  ++ L+D + + +  SF+E+YNE ++DLL      +S +KL I
Sbjct: 181 -PENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLL---CPETSSKKLVI 236

Query: 187 YD 188
            +
Sbjct: 237 LE 238

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  126 bits (316), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 110/178 (61%), Gaps = 8/178 (4%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           D+ + + + NL   H T+  D + L+ +G  NR  + T+ N+ SSRSH++  I + + ++
Sbjct: 264 DTQNHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIMQTNK 323

Query: 332 ----GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA----D 383
                     + ++++DLAGSE  S +  +  R  E  +IN+SLL LG  IN+L      
Sbjct: 324 LVDLTSQHTFATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 384 KSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
           ++ H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA++AK IK +
Sbjct: 384 RTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 60/106 (56%), Gaps = 10/106 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F  +++Q  ++KE   PL    L G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 129 LSDSAGIIPRILFKLFETL-DLRDE-DYVVKCSFVELYNEELKDLL 172
                GII   + +LF  + DL+DE ++ +  S++E+YNE + DLL
Sbjct: 206 -PSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLL 250

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  126 bits (316), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 71/179 (39%), Positives = 108/179 (60%), Gaps = 9/179 (5%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           DS   + + NL    +++  D + L+ KG  NR  + T  N+ SSRSH +  + + + ++
Sbjct: 236 DSHRHITVANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQRNR 295

Query: 332 G----EMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA----- 382
                E  K + ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L      
Sbjct: 296 TAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRK 355

Query: 383 DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
               HVP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA++AK IK +
Sbjct: 356 RGGYHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKTK 414

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 61/107 (57%), Gaps = 10/107 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D+VF   ++Q  +++    PL    L G+N TV  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 176

Query: 129 LSDSAGIIPRILFKLFETL-DLRD-EDYVVKCSFVELYNEELKDLLD 173
             ++ GII   + +LF  + +L+D + + +  S++E+YNE ++DLL+
Sbjct: 177 TPENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLLE 223

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  124 bits (312), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/178 (37%), Positives = 109/178 (61%), Gaps = 8/178 (4%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           D+ + + + NL   H T+  D + L+ +G  NR  + T+ N+ SSRSH +  I + + ++
Sbjct: 264 DTQNHIKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 332 ----GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA----D 383
                     + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      
Sbjct: 324 LVDLTSQHTFATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 384 KSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
           ++ H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA++AK IK +
Sbjct: 384 RTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 61/106 (57%), Gaps = 10/106 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F  +++Q  ++KE   PL    L GYN TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFAYGATGCGKTYTVSGT------- 205

Query: 129 LSDSAGIIPRILFKLFETL-DLRDE-DYVVKCSFVELYNEELKDLL 172
                G+I   + +LF  + DL+DE ++ +  S++E+YNE ++DLL
Sbjct: 206 -PSQPGVIFLAMEELFNKIDDLKDEKNFEISLSYLEIYNERIRDLL 250

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  123 bits (308), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 105/171 (61%), Gaps = 6/171 (3%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREH--QGE 333
           GVY+Q+     ++   + L  +  G   R  ++T MN  SSRSH I  I L +    +G 
Sbjct: 215 GVYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIVKINLLKRDNLEGS 274

Query: 334 MFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKS---AHVPF 390
           + K S + LVDLAGSE +S++ A     +EA  IN SL +LG VIN+L  K     H+P+
Sbjct: 275 IQK-SDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINALTQKDKKRTHIPY 333

Query: 391 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
           R+S+LTRLL+DSLGGN+KT LI   +  K N  ET +TL++ S+AK I+N+
Sbjct: 334 RDSQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQIENK 384

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 75/129 (58%), Gaps = 12/129 (9%)

Query: 59  GITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTM 118
           G+  +  S+++  D VFG ++ Q  ++  +AE +   F  GYN T+L YG T +GK+YTM
Sbjct: 77  GVQGESPSRSFHFDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTM 136

Query: 119 TGDEKLYNDELSDSAGIIPRILFKLFETLDL----RDEDYVVKCSFVELYNEELKDLLDD 174
            G          D+ G+IPRI  ++FE + L     D +YVV  SF+E+Y E++ DLL +
Sbjct: 137 FGP--------IDNRGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLEKVYDLLGE 188

Query: 175 SVENSSMRK 183
           S+  S+  K
Sbjct: 189 SINKSASPK 197

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  124 bits (310), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 110/181 (60%), Gaps = 13/181 (7%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           D+ S + + NL      + +D + L+ KG  NR  + T  N+ SSRSH +  I + + ++
Sbjct: 257 DNESKISVANLSHHRPKTVQDVMDLIIKGNINRTTSATDANETSSRSHAVLQIHISQTNR 316

Query: 332 ------GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA--- 382
                   +F  + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L    
Sbjct: 317 TVDLTSSHVF--ATLSIIDLAGSERAASTKNRGERLYEGANINKSLLALGNCINALCLND 374

Query: 383 --DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKN 440
              +S HVP+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA++AK IK 
Sbjct: 375 GTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKT 434

Query: 441 R 441
           +
Sbjct: 435 K 435

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 61/107 (57%), Gaps = 10/107 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F   ++Q  +++     L    L G+N TV  YG T  GKTYT++G        
Sbjct: 146 FIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGT------- 198

Query: 129 LSDSAGIIPRILFKLFETLD-LRD-EDYVVKCSFVELYNEELKDLLD 173
             +  GII   + +LF+ ++ ++D +++ +  S++E+YNE ++DLL+
Sbjct: 199 -PEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLLN 244

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  123 bits (309), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 107/179 (59%), Gaps = 9/179 (5%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           DS + + + NL      +  D + L+  G  NR  + T  N+ SSRSH +  I + +  +
Sbjct: 240 DSENRISVANLSHHRPKTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQINIVQSSR 299

Query: 332 GEMFK----VSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA----- 382
                     +K++++DLAGSE  + +  + +R +E  +IN+SLL LG  IN+L      
Sbjct: 300 TAEITSDHTFAKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINALCISDGT 359

Query: 383 DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
            ++ HVP+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA++AK IK +
Sbjct: 360 RRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTK 418

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 10/106 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F  +A Q+ ++      L    L G+N TV  YG T  GKTYT++G        
Sbjct: 129 FVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGT------- 181

Query: 129 LSDSAGIIPRILFKLFETL-DLRD-EDYVVKCSFVELYNEELKDLL 172
             +  G+I   + +LF  + +L D   + +  S++E+YNE ++DLL
Sbjct: 182 -PERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRDLL 226

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  123 bits (309), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 67/178 (37%), Positives = 108/178 (60%), Gaps = 8/178 (4%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           D+ + + + NL   H  +  D + L+ +G  NR  + T+ N+ SSRSH +  I + + ++
Sbjct: 264 DTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 332 ----GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA----D 383
                     + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      
Sbjct: 324 LVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 384 KSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
           +S H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA++AK IK +
Sbjct: 384 RSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 61/106 (57%), Gaps = 10/106 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F  +++Q  ++KE   PL    L G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 129 LSDSAGIIPRILFKLFETL-DLRDE-DYVVKCSFVELYNEELKDLL 172
                GII   + +LF  + DL+DE D+ +  S++E+YNE ++DLL
Sbjct: 206 -PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLL 250

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  123 bits (308), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 107/183 (58%), Gaps = 17/183 (9%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL----- 326
           DS   + + NL      S +D L L+ +G  NR  + T+ N  SSRSH +  I +     
Sbjct: 254 DSNEKISVSNLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRSHAVLQIHIMQRNK 313

Query: 327 ---YREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLAD 383
               +EHQ        ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L  
Sbjct: 314 LVDLKEHQ----TFGTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCINALCS 369

Query: 384 -----KSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNI 438
                ++ HVP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA++AK I
Sbjct: 370 NDGSHRNQHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANRAKEI 429

Query: 439 KNR 441
           K +
Sbjct: 430 KTK 432

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 59/114 (51%), Gaps = 10/114 (8%)

Query: 61  TAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTG 120
           T   +   +  DK+F    +Q+ +++     L    L G+N TV  YG T  GKTYT++G
Sbjct: 135 TGSADETKFVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSG 194

Query: 121 DEKLYNDELSDSAGIIPRILFKLFETLDLR--DEDYVVKCSFVELYNEELKDLL 172
                     ++ GII R + +LF  +D     +D+ +  SF+E+YNE + DLL
Sbjct: 195 TR--------ENPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNETIHDLL 240

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  122 bits (305), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 73/170 (42%), Positives = 105/170 (61%), Gaps = 5/170 (2%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREH--QGE 333
           GVY++      ++   + L  +  G   R   +T MN  SSRSH I  I L +    +G 
Sbjct: 188 GVYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDMNLESSRSHAIVKINLLKRDNLEGN 247

Query: 334 MFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA--DKSAHVPFR 391
           + K S + LVDLAGSE ++++ A     +EA  IN SL +LG VIN+L   +K  H+P+R
Sbjct: 248 IQK-SDLFLVDLAGSEKVAKTNAVGATLEEAKKINLSLSSLGNVINALTQKEKRTHIPYR 306

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
           +S+LTRLL+DSLGGN+KT LI   +  K N  ET +TL++ S+AK+IKN+
Sbjct: 307 DSQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRFGSRAKHIKNK 356

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 69/122 (56%), Gaps = 12/122 (9%)

Query: 66  SKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLY 125
           ++ +  D VFG  A Q+ +F  +AE +   F  GYN T+L YG T +GK+YTM G     
Sbjct: 57  ARAFRFDYVFGTDARQEEVFDYVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGP---- 112

Query: 126 NDELSDSAGIIPRILFKLFETLDL----RDEDYVVKCSFVELYNEELKDLLDDSVENSSM 181
                   G+IPRI  ++FE + L     D +YVV  SF+E+Y E++ DLL +S+  +S 
Sbjct: 113 ----PGHRGLIPRICQQIFERIGLLKNCADIEYVVSVSFLEIYLEKVYDLLGESINKASS 168

Query: 182 RK 183
            K
Sbjct: 169 PK 170

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  122 bits (306), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/174 (39%), Positives = 105/174 (60%), Gaps = 9/174 (5%)

Query: 277 VYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQG---- 332
           + + NL    + +  D + L+ KG  NR  + T  N+ SSRSH +  + + ++++     
Sbjct: 241 ITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQKNRTAELT 300

Query: 333 EMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA-----H 387
           E  K + ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L          H
Sbjct: 301 EDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGGKRGGGFH 360

Query: 388 VPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
           VP+R+SKLTRLL+ SLGGN KT +I  ISP   + +ET +TL+YA++AK IK +
Sbjct: 361 VPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKTK 414

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 67/117 (57%), Gaps = 15/117 (12%)

Query: 64  MNSK-----TYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTM 118
           MNS+      +  D+VF   A+Q+ +++    PL    L G+N TV  YG T  GKTYT+
Sbjct: 115 MNSRRSGEQKFVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVFAYGATGCGKTYTV 174

Query: 119 TGDEKLYNDELSDSAGIIPRILFKLFETLD-LRD-EDYVVKCSFVELYNEELKDLLD 173
           +G         +++ GII   + +LF  ++ L+D + + +  S++E+YNE ++DLL+
Sbjct: 175 SGT--------AENPGIIFLTMQELFAKMEQLKDTKKFELTASYLEIYNESIRDLLE 223

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  120 bits (302), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 108/180 (60%), Gaps = 10/180 (5%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           D+ + + + NL     T+ ++ + L+ +G  NR  + T+ N+ SSRSH +  I + ++++
Sbjct: 267 DTDNKITVANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIVQKNR 326

Query: 332 GEMFK----VSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA----- 382
               K       ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      
Sbjct: 327 TPDIKEEHTFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCINGND 386

Query: 383 -DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
                HVP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA++AK IK +
Sbjct: 387 ERPRCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 446

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 61/106 (57%), Gaps = 10/106 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F   A Q+ +++     L    L G+N TV  YG T  GKTYT++G        
Sbjct: 156 FVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 207

Query: 129 LSDSAGIIPRILFKLFETL-DLRD-EDYVVKCSFVELYNEELKDLL 172
             ++ GI+ + + +LF+ + DL+D + + +  SF+E+YNE ++DLL
Sbjct: 208 TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLL 253

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  120 bits (302), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/178 (38%), Positives = 110/178 (61%), Gaps = 8/178 (4%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYR--- 328
           D  S + + NL      + +D + L+ +G  NR  + T+ N+ SSRSH++  I + +   
Sbjct: 206 DQNSKISVTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVKQVLK 265

Query: 329 --EHQGEMFKV-SKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA--D 383
             +  G   ++ S ++++DLAGSE    +  +  R  E  +IN+SLL LG  IN+L    
Sbjct: 266 NFDDIGSTNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINALCINK 325

Query: 384 KSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
           KS H+P+R+SKLTRLL+ SLGGN KT +I  +SP+ ++ +ET +TL+YA++AK IK +
Sbjct: 326 KSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIKTK 383

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 59/109 (54%), Gaps = 13/109 (11%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F   + Q+ IF++   PL    L G+N TV  YG T  GKTYT+ G        
Sbjct: 92  FIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTING-------- 143

Query: 129 LSDSAGIIPRILFKLFETLDLRDED-----YVVKCSFVELYNEELKDLL 172
            S+  GII R + +LF  +++  +D       +  S++E+YNE ++DLL
Sbjct: 144 TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIRDLL 192

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  121 bits (303), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/180 (36%), Positives = 110/180 (61%), Gaps = 10/180 (5%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           D  + + + NL   +  + ++ + L+ KG  NR  + T+ N+ SSRSH +  I + + ++
Sbjct: 262 DGANKISVSNLSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQTNR 321

Query: 332 GEMFK----VSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA----- 382
                     + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L      
Sbjct: 322 TADLTSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCLTDGG 381

Query: 383 -DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
            ++S H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA++AK IK +
Sbjct: 382 TNRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 62/106 (58%), Gaps = 10/106 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F   A+Q+ +++     L    L G+N TV  YG T  GKTYT++G        
Sbjct: 151 FVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------- 203

Query: 129 LSDSAGIIPRILFKLFETL-DLRD-EDYVVKCSFVELYNEELKDLL 172
             +  GII R++ +LFE + DL+D + + +  S++E+YNE ++DLL
Sbjct: 204 -PEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLL 248

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  121 bits (303), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 105/178 (58%), Gaps = 8/178 (4%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           DS S   + NL      +  D + L+ +G  NR  + T  N+ SSRSH +  + + +  +
Sbjct: 239 DSDSTTTVANLSYHTPETVEDVMDLVIRGNVNRTTSPTDANETSSRSHAVLQVHVVQSSR 298

Query: 332 GEMFKVSKM----NLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA----D 383
               K  KM    +++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L      
Sbjct: 299 TVDLKEDKMYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRR 358

Query: 384 KSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
              HVP+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA++AK+IK +
Sbjct: 359 AVCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 416

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 63/107 (58%), Gaps = 10/107 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F   A+QQ +F+    PL    L G+N TV  YG T  GKT+T++G        
Sbjct: 128 FMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 129 LSDSAGIIPRILFKLFETL-DLRD-EDYVVKCSFVELYNEELKDLLD 173
             DS GII   + +LF+ + +L+D + + +  S++E+YNE ++DLL+
Sbjct: 180 TPDSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIYNETIRDLLE 226

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  120 bits (301), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 106/178 (59%), Gaps = 8/178 (4%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           D+ +   + NL      S +D + L+ KG  NR  + T  N+ SSRSH +  I + +  +
Sbjct: 241 DTDNTTTVANLSYHTPRSVQDVMDLVIKGNINRTTSPTDANETSSRSHAVLQIHVVQSSR 300

Query: 332 GEMFKVSK----MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKS-- 385
               K  K    ++++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L      
Sbjct: 301 SVDLKEDKTYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRR 360

Query: 386 --AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
              HVP+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA++AK+IK +
Sbjct: 361 TYCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 418

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 61/107 (57%), Gaps = 10/107 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F   A QQ +F     PL    + G+N TV  YG T  GKT+T++G        
Sbjct: 130 FMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGATGCGKTFTISG-------- 181

Query: 129 LSDSAGIIPRILFKLFETLD-LRD-EDYVVKCSFVELYNEELKDLLD 173
             ++ GII   + +LF+ ++ L+D + + +  S++E+YNE ++DLL+
Sbjct: 182 TPENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIYNEMIRDLLE 228

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  117 bits (294), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 108/192 (56%), Gaps = 22/192 (11%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREH----- 330
            +YI+N+ +  +++    ++ ++ G RNR   +T MN  SSRSH I +IT+ R       
Sbjct: 188 SMYIENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSITIKRTDIDLNT 247

Query: 331 QGEMFKVSKMNLVDLAGSENISRSGAQHQ-RAKEAGSINQSLLTLGRVINSLADK----- 384
              +   S    VDLAGSE  + +   H  R KE  SIN+SL TL RV+ SL  +     
Sbjct: 248 NSSIISDSICRFVDLAGSERSTATQNCHNDRLKEGNSINKSLSTLRRVLTSLKKREELKY 307

Query: 385 ------SAH---VPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKA 435
                 SAH   VPFRES LT +L+D+LGGN+KT +IA ISP   N EE+ STL+YA  A
Sbjct: 308 NSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPT--NFEESASTLRYADIA 365

Query: 436 KNIKNRPQLRSF 447
           + IK    + ++
Sbjct: 366 QTIKTNSIINTY 377

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 69/127 (54%), Gaps = 17/127 (13%)

Query: 70  AVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDEL 129
             D+ FG   +Q   +K        D L GYNC +L YG T +GKTYTM G+ K      
Sbjct: 62  CFDEGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------ 115

Query: 130 SDSAGIIPRI---LFKLFETLDLRD-------EDYVVKCSFVELYNEELKDLLD-DSVEN 178
           +D+ G+IPR    LF   E++ ++D        +Y V CS  E+YNE++ DLL+ + V++
Sbjct: 116 NDTRGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLLEMNEVQS 175

Query: 179 SSMRKLR 185
            S  ++R
Sbjct: 176 CSKYRVR 182

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  119 bits (299), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 108/188 (57%), Gaps = 23/188 (12%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIF--------- 322
           D  S + + NL   +  S +D + L+ +G  NR  ++T+ N+ SSRSH +          
Sbjct: 302 DKDSKISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIHIMQTNT 361

Query: 323 TITLYREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA 382
            I L  EH       + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L 
Sbjct: 362 KIDLTSEHT-----FATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINALC 416

Query: 383 DKS---------AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAS 433
             +          H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA+
Sbjct: 417 IPTNNTRRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYAN 476

Query: 434 KAKNIKNR 441
           +AK IK +
Sbjct: 477 RAKEIKTK 484

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 65/113 (57%), Gaps = 10/113 (8%)

Query: 62  AQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGD 121
           A+ N   +  DK+F  +++Q  ++      L    L G+N TV  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 122 EKLYNDELSDSAGIIPRILFKLFETL-DLRDED-YVVKCSFVELYNEELKDLL 172
           +        ++ GII R++ +LFE + DL+DE  + +  S++E+YNE + DLL
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLL 288

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/180 (37%), Positives = 107/180 (59%), Gaps = 10/180 (5%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           DS +  ++ NL      +  + + L+ KG  NR  + T  N+ SSRSH +  I + + ++
Sbjct: 235 DSYNRTFVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANETSSRSHAVLQIHVAQMNR 294

Query: 332 GEMFK----VSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKS-- 385
               K     + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L   S  
Sbjct: 295 TADIKQDQTFATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCVSSTR 354

Query: 386 ----AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
                HVP+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA++AK IK +
Sbjct: 355 TGFSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKEIKTK 414

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 67/120 (55%), Gaps = 13/120 (10%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D++F     QQ +++    PL    L G+N TV  YG T  GKT+T++G        
Sbjct: 124 FIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT------- 176

Query: 129 LSDSAGIIPRILFKLFETLD-LRD-EDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRI 186
            S+  GII   + +LF  ++ L+D + + ++ SF+E+YNE++ DLLD    N S +KL I
Sbjct: 177 -SEQPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNEQIHDLLD---PNISSKKLVI 232

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 105/179 (58%), Gaps = 9/179 (5%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           DS   + + NL      + ++ +  + +G  NR  + T  N+ SSRSH +  I + +  +
Sbjct: 239 DSDQKITVSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIHIAQTDR 298

Query: 332 GEMF----KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA----- 382
                     + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L      
Sbjct: 299 TPDLISNSTFATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISDGT 358

Query: 383 DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
            ++ HVP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL YA++AK+IK +
Sbjct: 359 RRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIKTK 417

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 66/120 (55%), Gaps = 13/120 (10%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F  +ANQ  ++      L    L G+N TV  YG T  GKT+T++G        
Sbjct: 128 FVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 129 LSDSAGIIPRILFKLFETLD-LRDEDYV-VKCSFVELYNEELKDLLDDSVENSSMRKLRI 186
             +  GII   + +LF+ ++ L+D   + +  S++E+YNE ++DLL+ +V   S +KL I
Sbjct: 180 TPEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLLNPNV---SSKKLVI 236

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  114 bits (285), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 109/178 (61%), Gaps = 11/178 (6%)

Query: 278 YIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE--HQ--GE 333
           +++ L++  + +  + +  + KG  NR V +T MN  SSRSH IF I++ ++  H+  G 
Sbjct: 179 FVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIFHISVNQKETHKKTGT 238

Query: 334 MFKV-SKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLAD----KSAHV 388
           + +  S   LVDLAGSE +  + A  +  +E  SIN+SL  LGRVI+ LA+    +S  +
Sbjct: 239 VVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVISLLAEGDRQRSQMI 298

Query: 389 PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRS 446
           P+RES LT +L+++LGGN+ T L+A +SP   N  E+ STL+YAS  K +K    + S
Sbjct: 299 PYRESALTWILKENLGGNSNTCLVACVSPE--NYYESLSTLRYASLTKKVKTNATINS 354

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 69/134 (51%), Gaps = 25/134 (18%)

Query: 66  SKTYAVDKVFGPS----ANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGD 121
           +K +  D  FG +     +Q +I++ +        L+GYN  +L YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 122 EKLYNDELSDSAGIIPRILFKLFETLDLRDE---------DYVVKCSFVELYNEELKDLL 172
           +         + GI+PR   +LFE   +  +         D+ VKCSF E+YNE++ DLL
Sbjct: 109 K--------GNEGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

Query: 173 DDSVENSSMRKLRI 186
                + S RK +I
Sbjct: 161 S----SLSQRKCKI 170

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 101/176 (57%), Gaps = 13/176 (7%)

Query: 277 VYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLY-REHQGEMF 335
            Y+ N++ F I +  D + L+ K    R  ++T +N  SSRSH IF I L    H+    
Sbjct: 562 TYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYLEGYNHKTNEK 621

Query: 336 KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL------------AD 383
            +SK+NLVDLAGSE I+ S  Q  R KE  SIN+SL  LG VI++L              
Sbjct: 622 CISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRGNKNHLNSNDLQ 681

Query: 384 KSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK 439
           K+ H+PFR SKLT LL+ SL G++KT +   +S  + +  ET ++L++A+K  N K
Sbjct: 682 KTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATKVNNTK 737

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 59/116 (50%), Gaps = 16/116 (13%)

Query: 65  NSKTYAV--DKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDE 122
           N+ TY+   D VF        +F EI E L    L GYN  +  YG T +GKTYTM    
Sbjct: 438 NNATYSFEFDHVFKQDEGNSEVFNEI-EQLIQSALDGYNVCIFAYGQTGSGKTYTM---- 492

Query: 123 KLYNDELSDSAGIIPRILFKLFETLDLRDE---DYVVKCSFVELYNEELKDLLDDS 175
                 L+ + G+IP  +  +F ++D   +   +Y V C F+ELYNE + DL  D+
Sbjct: 493 ------LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDLFRDN 542

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  115 bits (288), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 112/185 (60%), Gaps = 17/185 (9%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           D+ + + + NL  +   +  + + L+ +G  NR  ++T  N+ SSRSH +  I L ++++
Sbjct: 221 DANNKISVSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIHLTQQNK 280

Query: 332 --------GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLAD 383
                    ++F  S ++++DLAGSE  + +  + +   E  +IN+SLL LG  IN+L  
Sbjct: 281 LNNDINSTEQLF--STLSIIDLAGSERAASTKNRGETLLEGANINKSLLALGNCINALCI 338

Query: 384 KSA-------HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAK 436
            ++       H+P+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA++AK
Sbjct: 339 NTSSHSQQQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYANRAK 398

Query: 437 NIKNR 441
            IK +
Sbjct: 399 EIKTK 403

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 68/120 (56%), Gaps = 13/120 (10%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+   ++ QQ +F+   EPL    L GYN TV  YG T  GKTYT++G        
Sbjct: 110 FIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISGT------- 162

Query: 129 LSDSAGIIPRILFKLFETLD-LRD-EDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRI 186
             ++ GII   L  LF  ++ L+D ++  +  S++E+YNE +KDLLD ++   S +KL I
Sbjct: 163 -PENPGIIFLTLQSLFNKIENLKDTKEISISLSYLEIYNESIKDLLDPTI---SSKKLVI 218

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  112 bits (280), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 104/168 (61%), Gaps = 6/168 (3%)

Query: 277 VYIQNLQDFHITSARDGL-QLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMF 335
            YI N+    +  +RD + ++L++  + R  A+T  N+ SSRSH+IF I L  +++G   
Sbjct: 521 TYITNITTC-VLDSRDTVDKVLKRANKLRSTASTAANEHSSRSHSIFIIHLEGKNEGTGE 579

Query: 336 KVSK-MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPFR 391
           K    +NLVDLAGSE ++ S    +R +E  SIN+SL  LG VI++L        H+PFR
Sbjct: 580 KSQGILNLVDLAGSERLNSSMVVGERLRETQSINKSLSCLGDVIHALNSPDGQKRHIPFR 639

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK 439
            SKLT LLQ SL G++KT +   ISPA ++  ET ++L++ASK  N K
Sbjct: 640 NSKLTYLLQYSLIGSSKTLMFVNISPAALHLNETINSLRFASKVNNTK 687

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 53/107 (49%), Gaps = 14/107 (13%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F        IFKE+ + L    L GYN  +  YG T +GKTYTM          
Sbjct: 397 FKFDKIFDQQETNDEIFKEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM---------- 445

Query: 129 LSDSAGIIPRILFKLFETLD---LRDEDYVVKCSFVELYNEELKDLL 172
           L+   GI+P  +  +F  +D    R   Y V C F+E+YNE + DLL
Sbjct: 446 LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIVDLL 492

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score =  111 bits (277), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 101/173 (58%), Gaps = 6/173 (3%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLY--RE 329
           D+     ++NL+   +TS      +L+  ++ R  A+T  N+ SSRSH+IF I ++   E
Sbjct: 499 DASKTTVVENLETITLTSKESVDAVLKNAMKLRATASTSSNERSSRSHSIFIIKIHGINE 558

Query: 330 HQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA--- 386
             GE  +   +NL+DLAGSE +S S  Q +R KE   IN+SL  LG V+NSL    A   
Sbjct: 559 GLGEE-RNGLLNLIDLAGSERLSVSKVQSERIKETQHINKSLSFLGNVMNSLGSPDATTR 617

Query: 387 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK 439
           H+ FR+SKLT LLQ SL GN+KT ++  IS +  +  ET  +L +A K  + K
Sbjct: 618 HISFRDSKLTYLLQYSLTGNSKTLMVVNISSSSDHINETIKSLNFAKKVNSTK 670

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 65/117 (55%), Gaps = 16/117 (13%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           Y+ DKVF  +   Q IFKE++E L    L G+N  +  YG T +GKT+TM          
Sbjct: 383 YSFDKVFSQTDTNQEIFKEVSE-LIQSSLDGFNVCIFAYGQTGSGKTFTM---------- 431

Query: 129 LSDSAGIIPRILFKLFETLDLRDED---YVVKCSFVELYNEELKDLL--DDSVENSS 180
           L+   GIIP     +F+ +D   ++   Y V C F+E+YN+E+ DLL  DD+  NSS
Sbjct: 432 LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDEIYDLLRSDDNKSNSS 488

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score =  110 bits (276), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 96/318 (30%), Positives = 153/318 (48%), Gaps = 67/318 (21%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMF 335
           GV I  L +    ++++ ++ ++ G  NR+ + T+ N  SSRSH +  + L   +  +  
Sbjct: 266 GVKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHAVILVRLVTHNVIDGS 325

Query: 336 KVSK-MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA-------- 386
           K S  + L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +S         
Sbjct: 326 KTSSTLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVISKLSAESLSNSKHVSN 382

Query: 387 ----------------HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQ 430
                           H+P+R+SKLTRLLQ +L GN+    I TI P      ET +TL+
Sbjct: 383 PMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDPRMETYAETINTLR 442

Query: 431 YASKAKNIKNRPQL--------RSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQD 482
           +AS+AKN+  R  +        +S + KD ++K +T  L K K  +   KL+     S D
Sbjct: 443 FASRAKNVSLRFNIKKNLSTISKSEVEKDKIIKELTFRLEKQKETINDMKLKS----SHD 498

Query: 483 NYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVMSG 542
              + + D  +           I  L ++NS+L K              KL+N +++M+ 
Sbjct: 499 TSNKFSLDNPN-----------ISLLQTENSILKK--------------KLENYENIMN- 532

Query: 543 LSEKLESQHKKEQELVDM 560
             + +E Q  +  E++DM
Sbjct: 533 -KDMIELQDSQMSEIIDM 549

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 66/120 (55%), Gaps = 9/120 (7%)

Query: 61  TAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTG 120
           T   N+  Y  D VF P  +   I+K  A PL      G+N T+  YGMT +GKTYTM G
Sbjct: 125 TINTNNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMG 184

Query: 121 DEKLYNDELSDSAGIIPRILFKLF-ETLDLR-DEDYVVKCSFVELYNEELKDLLDDSVEN 178
           D +       +  GI+P  +  LF + L+ R D+ Y V  S++E+YNE++ DLLDD   N
Sbjct: 185 DNE-------NPDGIVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEKIYDLLDDDRTN 237

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 105/325 (32%), Positives = 151/325 (46%), Gaps = 38/325 (11%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL-YREH 330
           DS  GV +  L +  + S+ D L+ +  G  NR+   T  N  SSRSH I T+ L   + 
Sbjct: 273 DSKHGVRVMGLTEQRVYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNLACTDL 332

Query: 331 QGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKS----- 385
                  S ++L DLAGSE   R+  QH+R KE   IN+SLL LG VI+ L+  S     
Sbjct: 333 VSGAETTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSASSMHTTP 389

Query: 386 ----AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
               +H+P+R+SKLTR+LQ +L G +    I TI        ET +T+++AS+AKN+   
Sbjct: 390 SFGNSHIPYRDSKLTRILQPALSGESIVTTICTIDTRLDAMSETVNTIRFASRAKNV--- 446

Query: 442 PQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEI---------TNDLE 492
                     + VK   AELA  K D L   LR  +   Q+   E+         T DL 
Sbjct: 447 ---------SMTVKRNEAELAHEK-DALIHNLRRQLDEQQELIWELKRNQEKCEQTPDLY 496

Query: 493 SYKTEIQESKR---IIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLES 549
             + E    KR   + ERL  ++   ++D +    V  L       ++  + GL  +L S
Sbjct: 497 LLRKESDALKRKLQLCERLLDKDEAAVQDDQLVEIVEMLPPAVGALLESKIQGLQSQLRS 556

Query: 550 QHKKEQELVDMTCNLKSTLSLTQSV 574
                 +L     +L S LS  QS 
Sbjct: 557 HRDYSSQLERQLSDLDSRLSSHQST 581

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 78/152 (51%), Gaps = 12/152 (7%)

Query: 25  GRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKVFGPSANQQLI 84
           G N ++ R   SV + +     + +     +D+  I A  +   +  D VF P +N   +
Sbjct: 96  GENSQQYRGAISVSIRLKPTDANAKNPWFVSDEQTI-AHNDVGEFKFDNVFRPQSNNYEV 154

Query: 85  FKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDSAGIIPRILFKLF 144
           +++I +P+     +GYN  +  YGMT +GKT+TM+G          + AG+I   +  +F
Sbjct: 155 YQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTFTMSGT--------PEEAGLISLSVEHIF 206

Query: 145 ETL---DLRDEDYVVKCSFVELYNEELKDLLD 173
             +    L ++ + V  S++E+YNE++ DLL+
Sbjct: 207 AQIMSESLANKSFQVTVSYLEIYNEKIYDLLN 238

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 92/144 (63%), Gaps = 3/144 (2%)

Query: 295 QLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYR-EHQGEMFKVSKMNLVDLAGSENISR 353
           ++L++  + R  A+T  N+ SSRSH+IF I L+   H+ +      +NLVDLAGSE +  
Sbjct: 611 KVLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEESCGVLNLVDLAGSERVHS 670

Query: 354 SGAQHQRAKEAGSINQSLLTLGRVINSLADKSA--HVPFRESKLTRLLQDSLGGNTKTAL 411
           S    +R +E  +IN+SL  LG VI +L DK+   H+PFR SKLT LLQ SL GN+KT +
Sbjct: 671 SQVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQYSLVGNSKTLM 730

Query: 412 IATISPAKINSEETCSTLQYASKA 435
              ISP+  +  ET ++L++ASK 
Sbjct: 731 FVNISPSSSHINETINSLRFASKV 754

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 56/108 (51%), Gaps = 14/108 (12%)

Query: 68  TYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYND 127
           ++  DK+F    +   +FKE+ + L    L GYN  +  YG T +GKTYTM         
Sbjct: 471 SFKFDKIFDTGESNDEVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 520

Query: 128 ELSDSAGIIPRILFKLF---ETLDLRDEDYVVKCSFVELYNEELKDLL 172
            L  + G+IP  +  +F   E L  R  +Y + C FVE+YNE + DLL
Sbjct: 521 -LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLL 567

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  110 bits (276), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 69/169 (40%), Positives = 99/169 (58%), Gaps = 6/169 (3%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE--HQGE 333
           G YI N+    +TS      +L+K  + R  A T+ N+ SSRSH++F + +     H GE
Sbjct: 538 GTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVFMVHINGRNLHTGE 597

Query: 334 MFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPF 390
             +  K+NLVDLAGSE I+ S    +R +E  +IN+SL  LG VI +L    A   ++PF
Sbjct: 598 TSQ-GKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYALNTPDAGKRYIPF 656

Query: 391 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK 439
           R SKLT LLQ SL G++KT +   I P   +  ET ++L++ASK  + K
Sbjct: 657 RNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNSTK 705

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 78/163 (47%), Gaps = 20/163 (12%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVS-VPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKV 74
           NI V  R R     E +  S +++    +  G+  + IN  +      ++ S  +  D +
Sbjct: 366 NIRVYCRVRPPLLNEPQDMSHILIEKFNEAKGAQSLTINRNE-----GRILSYNFQFDMI 420

Query: 75  FGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDSAG 134
           F PS   + IF+EI + L    L GYN  +  YG T +GKTYTM          L+   G
Sbjct: 421 FEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------LNAGDG 469

Query: 135 IIPRIL---FKLFETLDLRDEDYVVKCSFVELYNEELKDLLDD 174
           +IP  L   FK    L  R  +Y ++C ++E+YNE + DLL D
Sbjct: 470 MIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLLRD 512

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score =  110 bits (275), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 106/343 (30%), Positives = 169/343 (49%), Gaps = 74/343 (21%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLY--REHQGE 333
           GV +  L + +++S ++ ++ +  G  NR+   T  N  SSRSH +  I ++   E  GE
Sbjct: 235 GVKVVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVFCTDEITGE 294

Query: 334 MFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA------- 386
              +S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +S+       
Sbjct: 295 QV-MSTLSLCDLAGSE---RATGQQERRKEGAYINKSLLALGTVISKLSMESSGLSTNVG 350

Query: 387 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK------- 439
           H+P+R+SKLTR+LQ +L G++  A I T+      S E+ +T+++AS+AKNI        
Sbjct: 351 HIPYRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNISLAVKRNE 410

Query: 440 -----NRPQLRSFIMKDILVKNITA------------------------ELAKVK----- 465
                ++ QL   + K +  + IT                         EL K+K     
Sbjct: 411 ADSNVSKSQLIQTLRKQVREQQITIDNLTRGKGFIGSGISSDTSLLRENELLKMKVEHYE 470

Query: 466 -------SDLLSTKLREGVYM-SQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLK 517
                  S L  T+L E + M  QD    +   L +  +++QESKR I +L S  +   +
Sbjct: 471 RLETLEPSILKDTELVEIIDMLPQDIGVMLETKLVNMDSQLQESKRYISQLESART---R 527

Query: 518 DKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDM 560
           D  A+    EL    L N+ D+   L++ L   H++EQEL+ +
Sbjct: 528 DASATAATAEL----LSNVSDI--DLTQVL---HEQEQELMQL 561

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 62/107 (57%), Gaps = 10/107 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D VF P  N   +++ +A P+     +G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 129 LSDSAGIIPRILFKLFETLD--LRDEDYVVKCSFVELYNEELKDLLD 173
                GIIP  +  +F+ ++  L  + + V+ S++E+YNE + DLL+
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNERIFDLLN 204

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  109 bits (273), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 96/159 (60%), Gaps = 7/159 (4%)

Query: 287 ITSARDGLQ-LLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ--GEMFKVSKMNLV 343
           I  ++D +  L++K  + R  ATT  N+ SSRSH+IF I L   +   GE      +NLV
Sbjct: 529 ILKSKDSVDFLIKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGES-SYGILNLV 587

Query: 344 DLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPFRESKLTRLLQ 400
           DLAGSE ++ S  +  R +E  +IN+SL  LG VI++L    A   H+PFR SKLT LLQ
Sbjct: 588 DLAGSERLNSSQVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQ 647

Query: 401 DSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK 439
            SL GN+KT +   ISP +   +ET ++L++ASK    K
Sbjct: 648 YSLTGNSKTLMFVNISPTQQQIQETLNSLRFASKVNTTK 686

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 56/107 (52%), Gaps = 14/107 (13%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D++F      + +F EI + L    L GYN  +  YG T +GKT+TM          
Sbjct: 397 FQFDRIFDQHEVNKDVFDEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 445

Query: 129 LSDSAGIIPRILFKLFE---TLDLRDEDYVVKCSFVELYNEELKDLL 172
           L+ + G+IP  +  +F+   +L  R  +Y V C FVE+YNE + DLL
Sbjct: 446 LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLL 492

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 84/263 (31%), Positives = 138/263 (52%), Gaps = 17/263 (6%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL-YREH 330
           DS  GV +  L +  + ++ D ++ +  G  NR+   T  N  SSRSH I  I L   + 
Sbjct: 268 DSKYGVKVIGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCTDL 327

Query: 331 QGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---- 386
           +  +   S ++L DLAGSE   R+ AQ +R KE   IN+SLL LG VI+ L+ +S     
Sbjct: 328 KSGLETTSTLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQNMG 384

Query: 387 -----HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK-- 439
                H+P+R+SKLTR+LQ +L G+     I T+     +S ET +T+++AS+AKNI   
Sbjct: 385 VGGGHHIPYRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNISLV 444

Query: 440 -NRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQD-NYKEITNDLESYKTE 497
             R ++     KD +++N+  +L +    +   K   G   + D    E    L+S    
Sbjct: 445 VKRNEMDISNEKDHIIENLRRQLEQQNETIAVLKSNNGTCRTTDAGASEDALSLQSENKV 504

Query: 498 IQESKRIIERLSSQNSLLLKDKK 520
           ++      E+L  ++S++L+D++
Sbjct: 505 LKLRLEHCEKLLDKDSMILQDQE 527

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 66/116 (56%), Gaps = 11/116 (9%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           ++ D VF P+ +   +++E A P+     +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGT------- 199

Query: 129 LSDSAGIIPRILFKLFETL---DLRDEDYVVKCSFVELYNEELKDLLDDSVENSSM 181
            S+  G+IP  +  +F  +    L ++ + VK S++E+YNE++ DLL+  V   S 
Sbjct: 200 -SNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEKIYDLLNYQVSKGSF 254

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score =  108 bits (269), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 92/149 (61%), Gaps = 6/149 (4%)

Query: 296 LLQKGLRNRQVATTKMNDFSSRSHTIFTITL--YREHQGEMFKVSKMNLVDLAGSENISR 353
           LL++  + R  A T  N+ SSRSH++F I L  Y  + GE  +   +NLVDLAGSE I+ 
Sbjct: 554 LLKRAAKLRSTAATGSNERSSRSHSVFIIKLRGYNSNTGEECQ-GTLNLVDLAGSERINA 612

Query: 354 SGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPFRESKLTRLLQDSLGGNTKTA 410
           S     R +E  +IN+SL  LG VI++LA   A   H+PFR SKLT LLQ SL G++KT 
Sbjct: 613 SQVTGDRLRETQNINKSLSCLGDVIHALASPDASKRHIPFRNSKLTYLLQYSLLGDSKTL 672

Query: 411 LIATISPAKINSEETCSTLQYASKAKNIK 439
           +   ISP   +  ET ++L++ASK  + +
Sbjct: 673 MFVNISPCLDHFNETLNSLRFASKVNSTR 701

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/168 (32%), Positives = 78/168 (46%), Gaps = 26/168 (15%)

Query: 20  AVRSRGRNE-REIRAKSSVVVSV-PDVMG----SHEVAINTTDDVGITAQMN------SK 67
            +R +  NE +E+R    V   + P + G    S  V IN  +D   T  MN        
Sbjct: 352 TMRRKLHNELQELRGNIRVFCRIRPLLQGEGSESCHVHINLFNDDEGTQSMNITRDSKKH 411

Query: 68  TYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYND 127
            +  DK+F P  +   IF+EI + L    L GYN  +  YG T +GKTYTM         
Sbjct: 412 EFKFDKIFDPENSNDDIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 461

Query: 128 ELSDSAGIIPRILFKLFETLDL---RDEDYVVKCSFVELYNEELKDLL 172
            L    G+IP  L  +F+ + L   R  +Y +   F+E+YNE + DLL
Sbjct: 462 -LHPQNGMIPSTLDHIFQWIHLLKERGWEYEISSQFIEIYNETIIDLL 508

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  107 bits (267), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 106/179 (59%), Gaps = 16/179 (8%)

Query: 272 DSPS-GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE- 329
           D P+ GV +  L +    S  + L  ++ G ++R+ ++T  N  SSRSH I  I L    
Sbjct: 225 DDPNYGVRVIGLTEKRCQSHEELLNWIKLGDKHRKTSSTDFNTRSSRSHAIILIRLISSD 284

Query: 330 -HQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADK---- 384
              GE+   S ++L DLAGSE ++   AQH+R +E   IN+SLL LG VI+ L+ +    
Sbjct: 285 LSSGEVV-TSTLSLCDLAGSERVT---AQHERRQEGSFINKSLLALGTVISKLSAEVNNS 340

Query: 385 -----SAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNI 438
                ++H+P+R+SKLTR+LQ +L GN+    I TI  +   + E+ +TL++AS+AKN+
Sbjct: 341 TESVNNSHIPYRDSKLTRILQPALSGNSIVTTICTIDTSVDATNESVNTLRFASRAKNV 399

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 63/118 (53%), Gaps = 12/118 (10%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           Y  D VF P A+   ++    +PL      G+N TV  YGMT +GKTYTM+G        
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG-------- 155

Query: 129 LSDSAGIIP----RILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMR 182
           +  +AG+IP     +  K+F++    ++ Y    S++E+YNE++ DLL+   +   +R
Sbjct: 156 VDGNAGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEKIYDLLETDFDPKPLR 213

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score =  107 bits (267), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 105/182 (57%), Gaps = 18/182 (9%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           DS  GV +  L++    S+ + ++ +++G  +R+ A T  N  SSRSH I  I L   + 
Sbjct: 274 DSKYGVRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNTNV 333

Query: 332 GEMFKVSK-MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL--------- 381
            +   +S  ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L         
Sbjct: 334 IDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTAASH 390

Query: 382 -----ADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAK 436
                A+ + H+P+R+SKLTR+LQ +L G++    I TI   K ++ ET +TL++AS+AK
Sbjct: 391 GNSPNANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASRAK 450

Query: 437 NI 438
           N+
Sbjct: 451 NV 452

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 55/105 (52%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D V+ P  +   I++ I +P+     +G+N TV  YGMT +GKTYTM G      D+
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGSGGDGGDD 194

Query: 129 LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLD 173
                  +  +  K+ E   + +  + V  S++E+YNE + DLLD
Sbjct: 195 DGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNERIYDLLD 239

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score =  107 bits (267), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 97/168 (57%), Gaps = 6/168 (3%)

Query: 277 VYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL--YREHQGEM 334
            +I N+    +TS     ++L++ L+ R  A T  N  SSRSH++F I L  Y    GE 
Sbjct: 531 THITNITVCKLTSREMVNRMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYNTISGEK 590

Query: 335 FKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPFR 391
                +NLVDLAGSE I     Q +R +E  +IN+SL  LG VI++L    A   H+PFR
Sbjct: 591 -STGTLNLVDLAGSERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSADASKRHIPFR 649

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK 439
            SKLT LLQ SL G++KT +   +SP   +  ET ++L++A+K  + K
Sbjct: 650 NSKLTYLLQYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 73/167 (43%), Gaps = 31/167 (18%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVG---ITAQMNSK--TYA 70
           NI V  R R   E E  + SS+ +               +D+ G   IT + +SK   + 
Sbjct: 363 NIRVFCRLRPALENENYSSSSIEIE------------KFSDETGMQSITIKRDSKQHKFT 410

Query: 71  VDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELS 130
            D+ F        +F EI + L    L GYN  +  YG T +GKT+TM          L+
Sbjct: 411 FDRCFSAQETNGDVFSEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTFTM----------LN 459

Query: 131 DSAGIIPRILFKLF---ETLDLRDEDYVVKCSFVELYNEELKDLLDD 174
            + GIIP  L  +F   E L      Y +   FVE+YNE +KDL  +
Sbjct: 460 PNDGIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIKDLFKE 506

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  106 bits (264), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 71/166 (42%), Positives = 99/166 (59%), Gaps = 6/166 (3%)

Query: 279 IQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREH--QGEMFK 336
           I N+    +TS     +LL++  + R  A+T  N+ SSRSH+IF + L  E+   GE   
Sbjct: 532 ITNVTTVPLTSKNTVDELLKRANKLRSTASTACNERSSRSHSIFIVHLSGENVLTGERSH 591

Query: 337 VSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPFRES 393
              +NLVDLAGSE I+ S    +R +E  SIN+SL  LG VI++L    A   H+PFR S
Sbjct: 592 -GILNLVDLAGSERINTSQVIGERLRETQSINKSLSCLGDVIHALGSADASKRHIPFRNS 650

Query: 394 KLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK 439
           KLT LLQ SL GN+KT +   IS    ++ ET ++L++ASK  + K
Sbjct: 651 KLTYLLQYSLTGNSKTLMFVNISGNPNHTNETLNSLRFASKVNSTK 696

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 54/107 (50%), Gaps = 14/107 (13%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D++F        +F+EI + L    L GYN  +  YG T +GKTYTM          
Sbjct: 403 FKFDRIFNEKETNYDVFQEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 451

Query: 129 LSDSAGIIPRILFKLF---ETLDLRDEDYVVKCSFVELYNEELKDLL 172
           L+ + GIIP  +  +F   + L  R   Y V C FVE+YNE + DLL
Sbjct: 452 LNPTDGIIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLL 498

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 93/153 (60%), Gaps = 12/153 (7%)

Query: 295 QLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSK-----MNLVDLAGSE 349
           ++L +  + R  A+TK N+ SSRSH+IF I L+    G+  K ++     +NLVDLAGSE
Sbjct: 554 KVLHRATKLRSTASTKSNEHSSRSHSIFIIHLH----GKNSKTNEDSYGILNLVDLAGSE 609

Query: 350 NISRSGAQHQRAKEAGSINQSLLTLGRVI---NSLADKSAHVPFRESKLTRLLQDSLGGN 406
            I+ S    +R +E   IN+SL  LG VI   NS   K  H+PFR SKLT LL+ SL GN
Sbjct: 610 RINSSQVSGERLRETQHINKSLSCLGDVIHALNSSEHKERHIPFRNSKLTHLLKYSLSGN 669

Query: 407 TKTALIATISPAKINSEETCSTLQYASKAKNIK 439
           +KT +   IS +  +  ET ++L++ASK  + K
Sbjct: 670 SKTLMFVNISASLNHVNETINSLRFASKVNSTK 702

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 69/141 (48%), Gaps = 19/141 (13%)

Query: 40  SVPDVMGSHEVAINTTDDVG-----ITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFG 94
           S+ D   SH    +  +D G     IT   N+  Y  DK+F    +   IFKE+ + L  
Sbjct: 387 SIEDPNTSHIKVYSLDNDHGTQTMEITKNNNTNKYKFDKIFDQFESNSEIFKEVGQ-LVQ 445

Query: 95  DFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDSAGIIP---RILFKLFETLDLRD 151
             L GYN  +  YG T +GKT+TM          L+ S GIIP   R +F   + L  R 
Sbjct: 446 SALDGYNVCIFAYGQTGSGKTFTM----------LNPSDGIIPSTVRHIFTWIDNLKERG 495

Query: 152 EDYVVKCSFVELYNEELKDLL 172
            +Y + C FVE+YNE + DLL
Sbjct: 496 WEYQINCQFVEIYNENIIDLL 516

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 113/206 (54%), Gaps = 19/206 (9%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYR-EH 330
           DS  GV + +L +  ++S  D ++ +  G RNR+   T  N  SSRSH I  + L R + 
Sbjct: 270 DSKYGVKVVDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTRYDL 329

Query: 331 QGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA-------- 382
           +      S ++L DLAGSE   R+  Q  R KE   IN+SLL LG VI  L+        
Sbjct: 330 KTGSEATSTLSLCDLAGSE---RAVTQIVRRKEGAFINKSLLALGTVIAKLSMLGSQANG 386

Query: 383 ----DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNI 438
                 + H+P+R+SKLTR+LQ +L G++    I TI     +S ET +T+++AS+AKNI
Sbjct: 387 LQPSPAAGHIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFASRAKNI 446

Query: 439 K---NRPQLRSFIMKDILVKNITAEL 461
                + ++ S   KD +++N+  +L
Sbjct: 447 ALNVRKNEMDSHAEKDTIIQNLRKQL 472

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 60/109 (55%), Gaps = 12/109 (11%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D VF      Q +++ +  P+     +GYN T+  YGMT +GKT+TM+G+++     
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNKQ----- 200

Query: 129 LSDSAGIIPRILFKLFETLDLRDED----YVVKCSFVELYNEELKDLLD 173
                G+IP+ +  +F+ +          Y VK S++E+YNE++ DLL+
Sbjct: 201 ---EPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEKIYDLLN 246

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 100/184 (54%), Gaps = 20/184 (10%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL-YREH 330
           D+  GV +  L +  + S+ D L+ ++ G  NR+   T  N  SSRSH I TI +   E 
Sbjct: 270 DARHGVRVVGLTEQQVHSSEDVLRKIELGNSNRRTGETDYNTRSSRSHAIVTIKVTCTEL 329

Query: 331 QGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKS----- 385
                  S ++L DLAGSE   R+  QH+R KE   IN+SLL LG VI+ L+  S     
Sbjct: 330 LSGTDTTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSAVSGASGG 386

Query: 386 -----------AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASK 434
                      +HVP+R+SKLTR+LQ +L G++    I TI        ET +T+++AS+
Sbjct: 387 GAATPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTTICTIDTKPDAMSETVNTIRFASR 446

Query: 435 AKNI 438
           AKN+
Sbjct: 447 AKNV 450

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 64/108 (59%), Gaps = 11/108 (10%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DKVF P  N   +++EI +P+     +GYN T+  YGMT +GKT+TM+G        
Sbjct: 140 FWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTR------ 193

Query: 129 LSDSAGIIPRILFKLFETL---DLRDEDYVVKCSFVELYNEELKDLLD 173
             D AG+I   + ++F  +    + ++ Y V+ S++E+YNE++ DLL+
Sbjct: 194 --DEAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEKIYDLLN 239

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 106/187 (56%), Gaps = 23/187 (12%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYR-EH 330
           D+  G+ +  L +   +S  D ++ ++ G +N++++ T+ N  SSRSH+I  + L   + 
Sbjct: 244 DAQYGIKVVGLSEHRCSSKDDLMKWVRIGDKNKKISETEYNSRSSRSHSILLVRLIATDL 303

Query: 331 QGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKS----- 385
           +  +   S ++L DLAGSE   ++ +Q +R KE   IN+SLL LG VI  L+ +S     
Sbjct: 304 ETGIVTTSTLSLCDLAGSE---KATSQQERRKEGAFINKSLLALGTVIAKLSSESNQHRN 360

Query: 386 --------------AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQY 431
                         +H+P+R+SKLTR+LQ +L GN+    I T+      S ET +TL++
Sbjct: 361 ADNVNHQETSNPNNSHIPYRDSKLTRILQPALSGNSIITTICTVDIRSDASSETLNTLRF 420

Query: 432 ASKAKNI 438
           AS+AKN+
Sbjct: 421 ASRAKNV 427

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 69/126 (54%), Gaps = 20/126 (15%)

Query: 56  DDVGITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKT 115
           DDVG         + +D++F    +   I+ E+ +PL      GYN T+  YGMT +GKT
Sbjct: 104 DDVG--------EFRLDRIFDCDVSNLEIYSELCKPLIDKLAMGYNATLFAYGMTGSGKT 155

Query: 116 YTMTGDEKLYNDELSDSAGIIPRILFKLFETLD----LRDEDYVVKCSFVELYNEELKDL 171
           +TM+G +        +  G+IP  +  LF T++    L  + Y +  S++E+YNE+L DL
Sbjct: 156 FTMSGTQ--------EDTGLIPLSISHLFNTINEENLLGKKKYEMLVSYMEIYNEKLYDL 207

Query: 172 LDDSVE 177
           LD +VE
Sbjct: 208 LDTNVE 213

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 93/150 (62%), Gaps = 8/150 (5%)

Query: 296 LLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSK---MNLVDLAGSENIS 352
           +L+K  + R  A T  N+ SSRSH++F I  Y + + E+   S    +NLVDLAGSE ++
Sbjct: 571 VLKKATKLRATAATNSNERSSRSHSVFMI--YLKGKNEITGDSSEGILNLVDLAGSERLN 628

Query: 353 RSGAQHQRAKEAGSINQSLLTLGRVINSLA---DKSAHVPFRESKLTRLLQDSLGGNTKT 409
            S A   R +E  +IN+SL  LG VI++L    +   H+PFR SKLT LLQ SL G++KT
Sbjct: 629 SSQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRNSKLTYLLQYSLTGSSKT 688

Query: 410 ALIATISPAKINSEETCSTLQYASKAKNIK 439
            +   ISP K +  ET ++L++ASK  + K
Sbjct: 689 LMFVNISPTKSHLNETINSLRFASKVNSTK 718

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 62/113 (54%), Gaps = 14/113 (12%)

Query: 66  SKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLY 125
           S+ Y  D++F  + +   +FKEI + L    L G+N  +  YG T +GKTYTM       
Sbjct: 427 SQIYKFDRIFDQADSNTEVFKEIGQ-LVQSSLDGHNVCIFAYGQTGSGKTYTM------- 478

Query: 126 NDELSDSAGIIPRILFKLF---ETLDLRDEDYVVKCSFVELYNEELKDLLDDS 175
              L+D+ G+IP  +  +F   E++  +   Y + C F+E+YNE + DLL D+
Sbjct: 479 ---LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLLRDN 528

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 93/153 (60%), Gaps = 8/153 (5%)

Query: 292 DGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ--GEMFKVSKMNLVDLAGSE 349
           DGL  L+K  R R  A+T  N+ SSRSH++F I L   +   GE      +NLVDLAGSE
Sbjct: 564 DGL--LRKANRLRSTASTSANERSSRSHSVFIIFLKGSNHLTGEQSD-GILNLVDLAGSE 620

Query: 350 NISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPFRESKLTRLLQDSLGGN 406
            I+ S    +R +E  +IN+SL  LG V+++L    A   H+PFR SKLT LLQ SL GN
Sbjct: 621 RINSSQVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGN 680

Query: 407 TKTALIATISPAKINSEETCSTLQYASKAKNIK 439
           +KT +   IS  + +  ET ++L++ASK  + K
Sbjct: 681 SKTLMFVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 65/133 (48%), Gaps = 17/133 (12%)

Query: 43  DVMGSHEVAINTTDDVGITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNC 102
           D  G   + I  +++ G +   N   +  D++F  +   + +F+EI + L    L GYN 
Sbjct: 405 DENGCQTMEIVKSNNTGNSIPQN---FKFDRIFDQNETNENVFEEIGQ-LVQSSLDGYNV 460

Query: 103 TVLVYGMTSTGKTYTMTGDEKLYNDELSDSAGIIPRIL---FKLFETLDLRDEDYVVKCS 159
            +  YG T +GKTYTM          L+   GIIP  +   F   E L  R  +Y + C 
Sbjct: 461 CIFAYGQTGSGKTYTM----------LNPRNGIIPATISHIFSWIENLKERGWNYEINCQ 510

Query: 160 FVELYNEELKDLL 172
           F+E+YNE + DLL
Sbjct: 511 FIEIYNENIADLL 523

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  104 bits (259), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/155 (41%), Positives = 101/155 (65%), Gaps = 7/155 (4%)

Query: 287 ITSARDGLQ-LLQKGLRNRQVATTKMNDFSSRSHTIFTITL--YREHQGEMFKVSKMNLV 343
           I S R  LQ L+Q+  + R+ A T MN+ SSRSH++F + +  + +   E  K   +NLV
Sbjct: 541 IESNRRELQELVQRLNKVRRTAKTAMNNRSSRSHSVFIVEVEGFNKDSEERCK-GVLNLV 599

Query: 344 DLAGSENISRSG-AQHQRAKEAGSINQSLLTLGRVINSLADKSA--HVPFRESKLTRLLQ 400
           DLAGSE ++RSG    +R +E   IN+SL ++G VI++L   S   H+PFR +KLT LL+
Sbjct: 600 DLAGSERMNRSGLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLK 659

Query: 401 DSLGGNTKTALIATISPAKINSEETCSTLQYASKA 435
            SL G++KT ++ T+SP+  +  ET ++L++A+K 
Sbjct: 660 HSLQGSSKTLMLVTVSPSNSSRNETMNSLRFATKV 694

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 57/112 (50%), Gaps = 14/112 (12%)

Query: 66  SKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLY 125
           S  +  DK+F    + + +F E+ E L    L G+N  +  YG T +GKTYTM       
Sbjct: 405 SVNFQFDKIFNYDESNRQVFGEVKE-LVQSALDGHNVCIFTYGQTGSGKTYTM------- 456

Query: 126 NDELSDSAGIIPRILFKLFE---TLDLRDEDYVVKCSFVELYNEELKDLLDD 174
              L++  GIIP  L  + +   ++      Y +K  FVE+YN+ + DLL+D
Sbjct: 457 ---LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYNDRIFDLLND 505

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score =  104 bits (259), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 100/181 (55%), Gaps = 17/181 (9%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           DS  GV I  L +    S+ + L+ ++ G ++R+   T  N  SSRSH I  I L +   
Sbjct: 257 DSKYGVKIVGLTERRCESSDELLKWIRIGDKSRKTGETTYNTRSSRSHAIVMIRLTKTDL 316

Query: 332 GEMFKVSK-MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKS----- 385
            E   VS  ++L DLAGSE   ++   ++R KE   IN+SLL LG VI+ L+ +S     
Sbjct: 317 KEGTSVSSTLSLCDLAGSE---KAVTHNERRKEGAFINKSLLALGTVISKLSAESTSHRN 373

Query: 386 --------AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKN 437
                    H+P+R+SKLTR+LQ +L GN     I TI      S ET +TL++AS+AKN
Sbjct: 374 GGSSSPVTGHIPYRDSKLTRILQPALSGNGVVTTICTIDTRPDASSETLNTLRFASRAKN 433

Query: 438 I 438
           +
Sbjct: 434 V 434

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 60/110 (54%), Gaps = 14/110 (12%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D VF  + N   ++ + ++P+     +G N TV  YGMT +GKT+TM G E      
Sbjct: 122 FKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAGTE------ 175

Query: 129 LSDSAGIIPRILFKLF-----ETLDLRDEDYVVKCSFVELYNEELKDLLD 173
             ++ G+IP  +  L+     E+L   D  + +  S++E+YNE++ DLLD
Sbjct: 176 --ETLGLIPLSVAYLYSRVMEESLQ-GDSRFEIAVSYLEIYNEKIYDLLD 222

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score =  103 bits (257), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 98/166 (59%), Gaps = 6/166 (3%)

Query: 279 IQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL--YREHQGEMFK 336
           I N+    +TS      +L++  R R  A T+ N+ SSRSH++F + +  + +  GE+  
Sbjct: 543 ITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVFMVHINGHNDQTGEVSH 602

Query: 337 VSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPFRES 393
             K+NL+DLAGSE I+ S     R +E  +IN+SL  LG VI +L    A   H+PFR S
Sbjct: 603 -GKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYALNSPDAAKRHIPFRNS 661

Query: 394 KLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK 439
           KLT LLQ SL G++KT +   I   + ++ ET ++L++ASK  + K
Sbjct: 662 KLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNSTK 707

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 57/110 (51%), Gaps = 14/110 (12%)

Query: 66  SKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLY 125
           S  +  DK+F P      +F+EI + L    L GYN  +  YG T +GKTYTM       
Sbjct: 414 SYNFHFDKIFEPHNTNADVFQEICQ-LVQCSLDGYNVCIFAYGQTGSGKTYTM------- 465

Query: 126 NDELSDSAGIIPRILFKLFE-TLDLRDED--YVVKCSFVELYNEELKDLL 172
              L+   G+IP  L  +F+ T DL +    Y + C ++E+YNE + DLL
Sbjct: 466 ---LNPGDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDLL 512

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score =  103 bits (256), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 97/167 (58%), Gaps = 8/167 (4%)

Query: 279 IQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ---GEMF 335
           I N+   ++ S      +L++  + R  A+T  N+ SSRSH+IF I L   +     E +
Sbjct: 531 ITNIVTRNLDSEETADNILKRANKLRSTASTGSNEHSSRSHSIFIIHLRGSNSLTGEESY 590

Query: 336 KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPFRE 392
            +  +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI++L        H+PFR 
Sbjct: 591 GI--LNLVDLAGSERINSSQVTGDRLRETQNINRSLSCLGDVIHALGGPDQGKRHIPFRN 648

Query: 393 SKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK 439
           SKLT LLQ SL GN+KT +   ISP+  +  ET ++L++ASK  + K
Sbjct: 649 SKLTYLLQYSLTGNSKTLMFVNISPSANHINETINSLRFASKVNSTK 695

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 59/125 (47%), Gaps = 19/125 (15%)

Query: 59  GITAQMNSKT-----YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTG 113
           GI    N+ T     +  DK+F  +     +FKE+ + L    L GYN  +  YG T +G
Sbjct: 389 GIEVNNNNATQIPQRFKFDKIFNQTDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSG 447

Query: 114 KTYTMTGDEKLYNDELSDSAGIIP---RILFKLFETLDLRDEDYVVKCSFVELYNEELKD 170
           KTYTM          L    GIIP   + +F   + L  R   Y + C FVE+YNE + D
Sbjct: 448 KTYTM----------LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNENIID 497

Query: 171 LLDDS 175
           LL  S
Sbjct: 498 LLRSS 502

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 91/147 (61%), Gaps = 4/147 (2%)

Query: 296 LLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ--GEMFKVSKMNLVDLAGSENISR 353
           +L+   + + +A T  N+ SSRSH++FTI ++  +   GE      +NLVDLAGSE I  
Sbjct: 541 VLRTANKTKSIAATNSNERSSRSHSVFTIRIHGTNSITGEASD-GVLNLVDLAGSERIDT 599

Query: 354 SGAQHQRAKEAGSINQSLLTLGRVINSLADKS-AHVPFRESKLTRLLQDSLGGNTKTALI 412
           S     R +E  +IN+SL  LG VI +L  K   H+PFR SKLT LLQ SL G++KT + 
Sbjct: 600 SNVTGDRLRETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLTYLLQYSLIGDSKTLMF 659

Query: 413 ATISPAKINSEETCSTLQYASKAKNIK 439
             +SP+  + +ET ++L++ASK  + K
Sbjct: 660 VNVSPSSNHVKETLNSLRFASKVNSTK 686

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 82/161 (50%), Gaps = 23/161 (14%)

Query: 16  NITVAVRSRGRNEREIRAKSSVVVSVPDVM-GSHEVAINTTDDVGITAQMNSKTYAVDKV 74
           NI V  R R   E E++  S + VS  D   GS  + I+  D        NS+ +  DKV
Sbjct: 358 NIRVYCRIRPPLENEVQDISHIHVSNFDNRNGSQAIEISNED-------RNSR-FLFDKV 409

Query: 75  FGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDSAG 134
           F  +A+ + +F+E+ + L    L GYN  +  YG T +GKTYTM          ++D  G
Sbjct: 410 FSSNASNRDVFEEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM----------MNDPDG 458

Query: 135 IIPRILFKLFETLDL---RDEDYVVKCSFVELYNEELKDLL 172
           +IP  L  +F+   L   R  DY  +  F+E+YNE++ DLL
Sbjct: 459 VIPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLL 499

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 100/195 (51%), Gaps = 31/195 (15%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331
           DS  GV +  L +    S+ + +  + KG + R+ A T  N  SSRSH I  I L     
Sbjct: 276 DSKYGVRVIGLTEKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTTSDM 335

Query: 332 GEMFKVSK-MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKS----- 385
            +   +S  ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +S     
Sbjct: 336 KDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSTESNKNRS 392

Query: 386 ----------------------AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSE 423
                                  H+P+R+SKLTRLLQ +L G++    I TI     +S 
Sbjct: 393 PTLPSPPLSSSSSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNESSA 452

Query: 424 ETCSTLQYASKAKNI 438
           ET +TL++AS+AKNI
Sbjct: 453 ETLNTLRFASRAKNI 467

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 78/163 (47%), Gaps = 27/163 (16%)

Query: 17  ITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVDKVFG 76
           ITVA+R +  +     + SS +V+    +          DDVG         +  D VF 
Sbjct: 101 ITVAIRPKPTSNPSDVSTSSWLVTDEKTIAH--------DDVG--------EFKFDHVFN 144

Query: 77  PSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDSAGII 136
              +   I++ I  P+     +G+N T+  YGMT +GKTYTM G       E     G+I
Sbjct: 145 SFVSNLEIYQVINRPMIDKLFQGFNSTIFAYGMTGSGKTYTMMG-----CPEREQKDGLI 199

Query: 137 PRILFKLF-----ETLDLRDEDYVVKCSFVELYNEELKDLLDD 174
           P  +  LF     ETLD  D+ + +  S++E+YNE++ DLL D
Sbjct: 200 PLSVSYLFTKIMEETLD-GDKKFEIVLSYLEIYNEKIYDLLGD 241

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 88/144 (61%), Gaps = 4/144 (2%)

Query: 296 LLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREH-QGEMFKVSKMNLVDLAGSENISRS 354
           +L+K  + R  A+T  N+ SSRSH+IF I L   + +        +NLVDLAGSE I+ S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVS 636

Query: 355 GAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPFRESKLTRLLQDSLGGNTKTAL 411
                R +E  +IN+SL  LG VI++L    +   H+PFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 412 IATISPAKINSEETCSTLQYASKA 435
              ISP+  +  ET ++L++ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 57/115 (49%), Gaps = 16/115 (13%)

Query: 61  TAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTG 120
           TAQ++   +  DK+F        +FKE+ + L    L GYN  +  YG T +GKT+TM  
Sbjct: 430 TAQVHE--FKFDKIFDQQDTNVDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM-- 484

Query: 121 DEKLYNDELSDSAGIIPRIL---FKLFETLDLRDEDYVVKCSFVELYNEELKDLL 172
                   L+   GIIP  +   F     L  +  DY V C F+E+YNE + DLL
Sbjct: 485 --------LNPGDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 67/154 (43%), Positives = 91/154 (59%), Gaps = 11/154 (7%)

Query: 296 LLQKGLRNRQVATTKMNDFSSRSHTIFTITL--YREHQGEMFKVSKMNLVDLAGSENISR 353
           +L++  + R  A+T  N+ SSRSH+IF I L    E  GE      +NLVDLAGSE I+ 
Sbjct: 603 ILRRANKLRSTASTLSNEHSSRSHSIFIIHLKGTNEITGEK-SYGILNLVDLAGSERINS 661

Query: 354 SGAQHQRAKEAGSINQSLLTLGRVINSLAD--------KSAHVPFRESKLTRLLQDSLGG 405
           S    +R +E  +IN+SL  LG VI++L          K  H+PFR SKLT LLQ SL G
Sbjct: 662 SQVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSLIG 721

Query: 406 NTKTALIATISPAKINSEETCSTLQYASKAKNIK 439
           N+KT +   ISP+     ET ++L++ASK  + K
Sbjct: 722 NSKTLMFVNISPSINYVNETLNSLRFASKVNSAK 755

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 57/114 (50%), Gaps = 14/114 (12%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F  +     +FKE+ + L    L GYN  +  YG T +GKTYTM          
Sbjct: 453 FKFDKIFNQNETNDDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 501

Query: 129 LSDSAGIIPRILFKLFE---TLDLRDEDYVVKCSFVELYNEELKDLLDDSVENS 179
           L    GIIP  +  +F     L  R   Y ++C FVE+YNE + DLL +  +N+
Sbjct: 502 LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNENIVDLLRNEHDNN 555

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 67/165 (40%), Positives = 93/165 (56%), Gaps = 12/165 (7%)

Query: 279 IQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVS 338
           I N+    + S      +L+K  + R  A+T  N+ SSRSH+IF I L     G   K  
Sbjct: 560 ITNVTSCQLESEERVDMILKKANKLRSTASTASNEHSSRSHSIFMIHL----SGSNAKTG 615

Query: 339 K-----MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPF 390
                 +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI++L    +   H+PF
Sbjct: 616 AQSYGTLNLVDLAGSERINISQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPF 675

Query: 391 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKA 435
           R SKLT LLQ SL G++KT +   ISP+  +  ET ++L++ASK 
Sbjct: 676 RNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKV 720

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 58/114 (50%), Gaps = 19/114 (16%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTM--TGDEKLYN 126
           +  DK+F      + +FKE+ + L    L GYN  +  YG T +GKT+TM  TGD     
Sbjct: 436 FKFDKIFDQQNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTMLNTGD----- 489

Query: 127 DELSDSAGIIPRIL---FKLFETLDLRDEDYVVKCSFVELYNEELKDLL-DDSV 176
                  GIIP  +   F     L  +  DY V C F+E+YNE + DLL +DS+
Sbjct: 490 -------GIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDLLRNDSI 536

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 88/148 (59%), Gaps = 12/148 (8%)

Query: 296 LLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSK-----MNLVDLAGSEN 350
           +L+K  + R  A+T  N+ SSRSH+IF I L     G   K        +NLVDLAGSE 
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHL----SGSNTKTGAQSYGTLNLVDLAGSER 632

Query: 351 ISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPFRESKLTRLLQDSLGGNT 407
           I+ S     R +E  +IN+SL  LG VI++L    +   H+PFR SKLT LLQ SL G++
Sbjct: 633 INISQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDS 692

Query: 408 KTALIATISPAKINSEETCSTLQYASKA 435
           KT +   ISP+  +  ET ++L++ASK 
Sbjct: 693 KTLMFVNISPSSSHINETLNSLRFASKV 720

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 57/115 (49%), Gaps = 16/115 (13%)

Query: 61  TAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTG 120
           TAQ++   +  DK+F        +FKE+ + L    L GYN  +  YG T +GKT+TM  
Sbjct: 430 TAQVHE--FKFDKIFDQKDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM-- 484

Query: 121 DEKLYNDELSDSAGIIPRIL---FKLFETLDLRDEDYVVKCSFVELYNEELKDLL 172
                   L+   GIIP  +   F     L  +  DY V C F+E+YNE + DLL
Sbjct: 485 --------LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score = 99.4 bits (246), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 99/177 (55%), Gaps = 18/177 (10%)

Query: 273 SPSGVYIQNLQDFHIT------SARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL 326
           +P    +  L++  IT      S    L+L+ +G RNR+V +T+ N  SSRSH +  + +
Sbjct: 214 APIACRLHGLKETTITLDDSEQSVSRVLELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRI 273

Query: 327 YREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRA--KEAGSINQSLLTLG---RVINSL 381
             +  G   +V  + L DLAGSE  S     H R    E G+IN+SL+ LG   R++N  
Sbjct: 274 T-DSMGSKARV--LTLCDLAGSERAS----VHDRGLRAEGGAINKSLMALGTVVRLLNET 326

Query: 382 ADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNI 438
              S HVP+R+SKLTRLL+ SL GN    ++ T+S +  + E++  TL++A +A  +
Sbjct: 327 GPSSTHVPYRDSKLTRLLKPSLSGNGLVTMVCTVSLSGTDYEQSLGTLRFARRASGV 383

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 51/109 (46%), Gaps = 23/109 (21%)

Query: 84  IFKEIAEPLF----GDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDSAGIIPRI 139
           IF    +PL      D + G   T++ YG T +GKTYTM G +           GI+   
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHGTKA--------EGGIVQLS 170

Query: 140 LFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYD 188
           +  L   L    ++  +  S++E+YNE L DLL D       ++LRI D
Sbjct: 171 IRDLLTQL---SKNCQITISYLEIYNERLHDLLCDGT-----KELRILD 211

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score =  100 bits (249), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 71/194 (36%), Positives = 103/194 (53%), Gaps = 31/194 (15%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE-- 329
           DS  GV +  L      ++ + L  + KG +NR+ + T+ N  SSRSH I  I L  +  
Sbjct: 264 DSECGVRVVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKDI 323

Query: 330 HQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVIN---------- 379
             GE   +  ++L DLAGSE   R   Q++R KE   IN+SLL LG VI+          
Sbjct: 324 RTGEQ-NIRTLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSH 379

Query: 380 ----------SLADKSA-----HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 424
                     SLA  +      H+P+R+SKLTRLLQ +L G++    + TI  A  +S E
Sbjct: 380 HTGRAANSQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSE 439

Query: 425 TCSTLQYASKAKNI 438
           T +TL++AS++KN+
Sbjct: 440 TLNTLRFASRSKNV 453

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 60/109 (55%), Gaps = 12/109 (11%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D VF    +   I+ +  +PL    ++GYN T+  YGMT +GKT+TM+G E      
Sbjct: 133 FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNATIFAYGMTGSGKTFTMSGTE------ 186

Query: 129 LSDSAGIIPRILFKLFETL----DLRDEDYVVKCSFVELYNEELKDLLD 173
             +  G+IP  +  LF +L    +  +E   V  S++E+YNE++ DLLD
Sbjct: 187 --EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVSYLEIYNEKINDLLD 233

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 88/146 (60%), Gaps = 6/146 (4%)

Query: 295 QLLQKGLRNRQVATTKMNDFSSRSHTIFTITL--YREHQGEMFKVSKMNLVDLAGSENIS 352
           ++L++  + R  A+T  N+ SSRSH+IF I L       G       +NLVDLAGSE I+
Sbjct: 575 RVLKRANKLRSTASTASNEHSSRSHSIFIIHLSGLNAKTGAQ-SYGTLNLVDLAGSERIN 633

Query: 353 RSGAQHQRAKEAGSINQSLLTLGRVINSLADKSA---HVPFRESKLTRLLQDSLGGNTKT 409
            S     R +E  +IN+SL  LG VI++L    +   H+PFR SKLT LLQ SL G++KT
Sbjct: 634 ISQVVGDRLRETQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKT 693

Query: 410 ALIATISPAKINSEETCSTLQYASKA 435
            +   ISP+  +  ET ++L++ASK 
Sbjct: 694 LMFVNISPSSSHINETLNSLRFASKV 719

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 53/107 (49%), Gaps = 14/107 (13%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+F      + +FKE+ + L    L GYN  +  YG T +GKT+TM          
Sbjct: 436 FKFDKIFDQRNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 484

Query: 129 LSDSAGIIPRIL---FKLFETLDLRDEDYVVKCSFVELYNEELKDLL 172
           L+   GIIP  +   F     L  +  DY V C F+E+YNE + DLL
Sbjct: 485 LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 98/184 (53%), Gaps = 20/184 (10%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYR-EH 330
           DS  GV + +L +  + S  + ++ +  G +NR+   T  N  SSRSH I  + L R E 
Sbjct: 271 DSKYGVKVVDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTRCEL 330

Query: 331 QGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL--------- 381
           +      S ++L DLAGSE   R+  Q  R KE   IN+SLL LG VI  L         
Sbjct: 331 KTGTEVTSTLSLCDLAGSE---RAVTQLVRRKEGAFINKSLLALGTVIAKLSANSAGSGS 387

Query: 382 -------ADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASK 434
                  +    H+P+R+SKLTR+LQ +L G++    I TI     ++ ET +T+++AS+
Sbjct: 388 GSNGQPPSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTVRFASR 447

Query: 435 AKNI 438
           AKNI
Sbjct: 448 AKNI 451

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 61/118 (51%), Gaps = 13/118 (11%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D VF        ++  + +P+     +GYN T+  YGMT +GKT+TM+G ++     
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTKQ----- 199

Query: 129 LSDSAGIIPRILFKLF-----ETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSM 181
                G+IP  +  +F     ET    +  Y VK S++E+YNE++ DLL  +  N ++
Sbjct: 200 ---DPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLLSITEANGAV 254

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 102/199 (51%), Gaps = 35/199 (17%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREH- 330
           DS  GV +  L +    S+ + L+ +  G ++R++  T  N  SSRSH I  I L   + 
Sbjct: 298 DSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTNV 357

Query: 331 QGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL-ADK----- 384
           +    + S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK     
Sbjct: 358 KNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMNSVG 414

Query: 385 -------------------------SAHVPFRESKLTRLLQDSLGGNTKTALIATISPAK 419
                                    S H+P+R+SKLTRLLQ +L G++    I T+    
Sbjct: 415 SNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRN 474

Query: 420 INSEETCSTLQYASKAKNI 438
             + ET +TL++AS+AKN+
Sbjct: 475 DAAAETMNTLRFASRAKNV 493

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 65/118 (55%), Gaps = 12/118 (10%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D VF        +++  ++P+    L G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 129 LSDSAGIIPRILFKLFETLDLR----DEDYVVKCSFVELYNEELKDLLDDSVENSSMR 182
           L    G+IP  +  LF  +  +    D+ + V  S++E+YNE + DLL+  +E S  R
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEESGSR 272

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 102/205 (49%), Gaps = 41/205 (20%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYR-EH 330
           DS  GV +  L +    S+ D L+ +  G ++R++  T  N  SSRSH I  I L   + 
Sbjct: 298 DSQYGVKVIGLTERRCESSEDLLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTDV 357

Query: 331 QGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL-ADK----- 384
           +    + S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK     
Sbjct: 358 RDGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTNSVG 414

Query: 385 -------------------------------SAHVPFRESKLTRLLQDSLGGNTKTALIA 413
                                          S H+P+R+SKLTRLLQ +L G++    I 
Sbjct: 415 SIIPTTPTSSGNSSSSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVTTIC 474

Query: 414 TISPAKINSEETCSTLQYASKAKNI 438
           T+      + ET +TL++AS+AKN+
Sbjct: 475 TVDTRNDAAAETMNTLRFASRAKNV 499

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 66/118 (55%), Gaps = 12/118 (10%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D VF        ++++ ++P+    L G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 129 LSDSAGIIPRILFKLFETLDLR----DEDYVVKCSFVELYNEELKDLLDDSVENSSMR 182
           L    G+IP  +  LF  +  +    D+ + V  S++E+YNE + DLL+  +E S  R
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNERIYDLLESGLEESGSR 272

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 101/313 (32%), Positives = 161/313 (51%), Gaps = 42/313 (13%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYRE--HQGE 333
           GV I  L +    S+ +  + +Q G +NR+ + T  N  SSRSH I  + L       GE
Sbjct: 250 GVRITGLTEKRCESSEELSRWIQIGDKNRKTSETIYNTRSSRSHAIVLVRLNNTDLRSGE 309

Query: 334 MFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVI--------------- 378
               S ++L DLAGSE   ++ +Q++R KE   IN+SLL LG VI               
Sbjct: 310 TVS-STLSLCDLAGSE---KAVSQYERRKEGAFINKSLLALGTVISKLSSESLSKNGPPT 365

Query: 379 ---NSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKA 435
               +  + + H+P+R+SKLTR+LQ +L GN+    I TI      + ET +T+++AS+A
Sbjct: 366 FTSTNPTEPNTHIPYRDSKLTRILQPALSGNSIITTICTIDTRNEAASETVNTIRFASRA 425

Query: 436 KN----IKNRPQL--RSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITN 489
           KN    +  RP +   S+  KD  ++N+T +L K    ++  K R  +  S  N  + T 
Sbjct: 426 KNVTLQVAKRPAVGTGSYNEKDQTIENLTQQLEKQHQLVMRLKQRTSMTSSSHN-DDSTV 484

Query: 490 DLESYKTEIQESKRIIE-RLSSQNSLLLKDKKASNEVNELQRIKLQNMK--DVMSGLSEK 546
           D  S  T ++   R+++ +LS+   LL KD   + E+ + + + + +M   DV S L  K
Sbjct: 485 DPNS--TLLKAENRVLKCKLSNCEKLLDKD---TIELEDSEMVAIIDMLPIDVGSVLETK 539

Query: 547 ---LESQHKKEQE 556
              LESQ ++ +E
Sbjct: 540 FQGLESQLRQYKE 552

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 63/114 (55%), Gaps = 12/114 (10%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D+VF  +     I++  + P+    L+G+N TV  YGMT +GKT+TMTG E      
Sbjct: 112 FTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTE------ 165

Query: 129 LSDSAGIIPRILFKLFETL---DLRD-EDYVVKCSFVELYNEELKDLLDDSVEN 178
             D AG+IP  +  LF  +    +R    Y V  S++E+YNE++ DLLD   EN
Sbjct: 166 --DEAGLIPLSVTYLFSKILEHSMRGTSKYEVVVSYLEIYNEKIYDLLDCESEN 217

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 100/199 (50%), Gaps = 35/199 (17%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYR-EH 330
           DS  GV +  L +    S  + L+ +  G ++R++  T  N  SSRSH I  I L   + 
Sbjct: 298 DSKYGVKVIGLTERRCESTEELLRWIGIGDKSRKIGETDYNTRSSRSHAIVLIRLTSTDV 357

Query: 331 QGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL-ADK----- 384
                + S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK     
Sbjct: 358 NNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTTSVD 414

Query: 385 -------------------------SAHVPFRESKLTRLLQDSLGGNTKTALIATISPAK 419
                                    S H+P+R+SKLTRLLQ +L G++    I T+    
Sbjct: 415 SNISTTPTGSSGSSSGSITGNSGIPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRN 474

Query: 420 INSEETCSTLQYASKAKNI 438
             + ET +TL++AS+AKN+
Sbjct: 475 DAAAETMNTLRFASRAKNV 493

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 66/119 (55%), Gaps = 14/119 (11%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D VF        +++   +P+    L G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 129 LSDSAGIIPRILFKLF-----ETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMR 182
           L    G+IP  +  LF     +++D  D+ + V  S++E+YNE + DLL+  +E S  R
Sbjct: 219 L----GLIPLSVSYLFSNIMEQSMD-GDKKFDVIISYLEIYNERIYDLLESGLEESGSR 272

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score = 93.6 bits (231), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 106/204 (51%), Gaps = 28/204 (13%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITL-YREHQGE 333
           S + I+NL+  ++TS  + L   +KG   R +A       SSRS  I  IT+  R++  E
Sbjct: 187 SSISIKNLRCVYVTSLLEALSYCEKG---RSLA-------SSRSSVIIRITVEQRDNVKE 236

Query: 334 MFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA----------- 382
           +FK     LVDL  S+ I +        +    INQS++TL  V  SLA           
Sbjct: 237 VFKTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSVKNGRP 296

Query: 383 -DKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK-- 439
              + ++P++ES LT+LLQ+++GGN KT L+   S AK + EET +TL + +  K +K  
Sbjct: 297 RSGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMKLVKNL 356

Query: 440 ---NRPQLRSFIMKDILVKNITAE 460
              N+    S  M D+L+K+  A+
Sbjct: 357 FQQNKAGTNSKAMLDLLMKDFDAK 380

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 63/132 (47%), Gaps = 20/132 (15%)

Query: 62  AQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGD----FLKGYNCTVLVYGMTSTGKTYT 117
           A  N K + VD++F P A      K+    + GD       GYN  ++ YG T +GKT T
Sbjct: 64  AGQNLKLFRVDQIFNPGAQT----KDTTSSIIGDSVAQLFNGYNVAIMAYGQTDSGKTST 119

Query: 118 MTGDEKLYNDELSDSAGIIPRILFKLFETLDLRDE---DYVVKCSFVELYNEELKDLLDD 174
           M G    YN       G+I  +  ++F T++   E   DY +  S +E+  E ++DLL  
Sbjct: 120 MFG----YN----KGDGVINGVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDLLAP 171

Query: 175 SVENSSMRKLRI 186
             E   + KLR+
Sbjct: 172 LSEQKPL-KLRL 182

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 94/179 (52%), Gaps = 19/179 (10%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ-GEM 334
           GV +  + +    +A + ++ +  G   R+   T  N  SSRSH I  + L   +     
Sbjct: 242 GVKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITTNLLNGT 301

Query: 335 FKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKS--------- 385
              + ++L DLAGSE  S    Q +R KE   IN+SLL LG VI+ L+ +S         
Sbjct: 302 THFNTLSLCDLAGSEKASE---QLERRKEGSFINKSLLALGTVISKLSAESNAHDSSRPS 358

Query: 386 ------AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNI 438
                 +H+P+R+SKLTRLLQ +L  ++    I TI P K    ET +TL++AS+AKN+
Sbjct: 359 SGSLNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFASRAKNV 417

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 78/180 (43%), Gaps = 25/180 (13%)

Query: 3   SSPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITA 62
           SSPA          ITVAVR        I+  +  V      +G   +A           
Sbjct: 80  SSPAATATRTNRATITVAVR--------IKPTAPNVDPQWHALGPRCIA----------- 120

Query: 63  QMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDE 122
             +   +  D VFGP+A  + +F E+   L      G N T+L YG T +GKTYTM G  
Sbjct: 121 HWDQGDFQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVG-- 178

Query: 123 KLYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMR 182
             +ND +    G    +  ++    D R     V  S++E+YNE++ DLL+ +  N  ++
Sbjct: 179 --HNDGIVKMCGDC--VFTRMLNAADERQVKRSVTVSYLEIYNEKICDLLNSNCRNEELK 234

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 86/145 (59%), Gaps = 5/145 (3%)

Query: 295 QLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ-GEMFKVSKMNLVDLAGSENISR 353
           QL++ G   R   +T MN+ SSRSH++F + +   ++  +     ++NLVDLAGSE + +
Sbjct: 526 QLIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHNRITQEHSTGRLNLVDLAGSERLQQ 585

Query: 354 SG--AQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTAL 411
                  +  KE  SIN+SL  L  VI+S+  +  ++PFR SKLT LL++SL   +KT +
Sbjct: 586 QEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPFRNSKLTYLLKNSLINKSKTLM 645

Query: 412 IATISPAKINS-EETCSTLQYASKA 435
              ISP  INS  ET ++L+ A K 
Sbjct: 646 YVNISP-NINSIRETINSLRLARKV 669

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 55/108 (50%), Gaps = 14/108 (12%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  DK+FG   +   +F +I + L    L GYN  +  YG T +GKTYTM          
Sbjct: 384 FTFDKIFGMQDDNYEVFDDI-KNLVQSSLDGYNVCIFTYGQTGSGKTYTM---------- 432

Query: 129 LSDSAGIIPRILFKLFE---TLDLRDEDYVVKCSFVELYNEELKDLLD 173
           L++  GII + +  +      L     +Y ++  F+E+YNE ++DLL+
Sbjct: 433 LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNETIRDLLN 480

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 67/199 (33%), Positives = 100/199 (50%), Gaps = 35/199 (17%)

Query: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYR-EH 330
           D+  GV +  L +    S+ + L+ +  G ++R++  T  N  SSRSH I  I L   + 
Sbjct: 298 DTQYGVKVIGLTERRCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTSTDL 357

Query: 331 QGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL-ADK----- 384
           +    + S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK     
Sbjct: 358 ESGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKINPTG 414

Query: 385 -SAHVP------------------------FRESKLTRLLQDSLGGNTKTALIATISPAK 419
            + H                          +R+SKLTRLLQ +L G++    I T+    
Sbjct: 415 SNIHTTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRN 474

Query: 420 INSEETCSTLQYASKAKNI 438
             + ET +TL++AS+AKN+
Sbjct: 475 DAAAETINTLRFASRAKNV 493

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 66/118 (55%), Gaps = 12/118 (10%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           +  D VF        +++  ++P+    L G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 129 LSDSAGIIPRILFKLFE-TLDLR---DEDYVVKCSFVELYNEELKDLLDDSVENSSMR 182
           L    G+IP  +  LF   ++L    D+ + V  S++E+YNE + DLL+  +E S  R
Sbjct: 219 L----GLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNERIYDLLESGLEESLSR 272

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 112/230 (48%), Gaps = 32/230 (13%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ-GEM 334
           G  ++NL+   + +  +   L+   L N++    + N+   RSHTI  +++ + ++  E 
Sbjct: 192 GFQVENLRTTQVLTLEELKILINICLLNQK---ERHNNLIQRSHTIMEVSIEKRNKLDES 248

Query: 335 FKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLA----------DK 384
             +S + +VDLAGS+ I ++ +     ++A  IN  + ++  VIN L           D 
Sbjct: 249 ITMSSLYIVDLAGSDPIGKNSSSGITTEDAKKINHQIKSVNDVINGLVVMNREGGIMTDI 308

Query: 385 SA---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
           S     VP++ S LTRLL D LGGN KT  + T S  K +  ET STL++    K+    
Sbjct: 309 STLMHKVPYKSSILTRLLLDPLGGNCKTTFLLTSSLKKNDWNETLSTLKFGYNCKSANTN 368

Query: 442 PQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDL 491
           P++  F +            +K   D+  T ++    + +DN+  ITN+L
Sbjct: 369 PRINRFGLN-----------SKATMDIFLTDMK----LKEDNFISITNNL 403

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 71/132 (53%), Gaps = 19/132 (14%)

Query: 51  AINTTDD--VGITA-QMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVY 107
           +IN TD    G +  Q+ +  Y  DKVF  S +  +  +E  E      L+GYN +++ Y
Sbjct: 52  SINFTDTQLTGFSKDQVVNTQYKFDKVFA-SNDTGVEHQEFIESNLESLLQGYNTSIVTY 110

Query: 108 GMTSTGKTYTMTGDEKLYNDELSDSAGIIPRILFKLFETLDL------RDEDYVVKCSFV 161
           G + TGK++ + G+++          G+I ++L KLF  +D       ++  Y VK SF+
Sbjct: 111 GQSGTGKSFELYGEQQ---------DGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKFSFL 161

Query: 162 ELYNEELKDLLD 173
           E+Y E++ DL+D
Sbjct: 162 EVYQEKMFDLMD 173

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 110/231 (47%), Gaps = 16/231 (6%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYR-EHQGEM 334
           G+ + NL+  H+ S ++ L    + +    V  +K ++   R++TIF I + + +   E 
Sbjct: 208 GLPVDNLRQVHVASFKETLYYFNQAM---SVLNSKHDNSFPRTNTIFNINIEKLDKLDES 264

Query: 335 FKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAH------- 387
              S + LVDLAGS+ I R  +    +++   IN S+ ++  +I SL+  S         
Sbjct: 265 TTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKNYEF 324

Query: 388 -----VPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRP 442
                VP+  SKL +LL++ LGGN KT  + TIS      ++    LQ  +  ++ K  P
Sbjct: 325 SLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSKTVP 384

Query: 443 QLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLES 493
           Q+  F + +    +I  E  K+K +    +  E V   ++    ITN  ES
Sbjct: 385 QINKFGLNENKTLSIALENFKLKENNFKIQQAESVKQIEELKSIITNKEES 435

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 61/112 (54%), Gaps = 14/112 (12%)

Query: 68  TYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYND 127
           ++    +F   +N  LI   I   +  + ++GYN  ++ YG   +GKTY+      LY +
Sbjct: 83  SFEFTHIFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYS------LYGN 136

Query: 128 ELSDSAGIIPRILFK-LFETLDLRDED------YVVKCSFVELYNEELKDLL 172
           ++ DS G + +I+FK LF  ++    D      ++VK SF+E++ +++ DLL
Sbjct: 137 DVDDSFG-LGQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVWLDKVVDLL 187

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 58/125 (46%), Gaps = 14/125 (11%)

Query: 53  NTTDDVGITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTST 112
           N T  + I  +     +  D+ FG   + + IF EI + L    L GYN  +  YG T +
Sbjct: 392 NGTQCITIKREAKYHKFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGS 450

Query: 113 GKTYTMTGDEKLYNDELSDSAGIIPRILFKLF---ETLDLRDEDYVVKCSFVELYNEELK 169
           GKTYTM          L+   GIIP  L  +F   E L      Y +   F+E+YNE +K
Sbjct: 451 GKTYTM----------LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIK 500

Query: 170 DLLDD 174
           DL  D
Sbjct: 501 DLFKD 505

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 66/127 (51%), Gaps = 12/127 (9%)

Query: 50  VAINTTDDVGITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGM 109
           V   T + +  T +    T+  DKVF  +A Q+ + K +  P+  D L GYN TV+ YG 
Sbjct: 56  VLFRTNNPLHETTKETHSTFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITYGP 115

Query: 110 TSTGKTYTMTGDEKLYNDELSDSAGIIPRILFKLFETLDLRDE----DYVVKCSFVELYN 165
           + +GK+Y++ G +        +S GI+P I   LF+TL+  +E     + V     E+Y 
Sbjct: 116 SFSGKSYSLIGSK--------ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEIYM 167

Query: 166 EELKDLL 172
           E+  DLL
Sbjct: 168 EKTYDLL 174

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 100/220 (45%), Gaps = 30/220 (13%)

Query: 279 IQNLQDFHITSARDGLQLLQ--KGLRNRQVATTKMNDFSSRSHTIFTITL-YREHQGEMF 335
           I+++   H+ S  D    +Q  + + NR     K     SRSH +F + +  R  + ++ 
Sbjct: 196 IKDICPAHVGSYEDLRSYIQAVQNVGNRMACGDKTE--RSRSHLVFQLHVEQRNRKDDIL 253

Query: 336 KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADK----------S 385
           K S + LVDL G+E   +             +NQS+  L   + SL+ K          S
Sbjct: 254 KNSSLYLVDLHGAEKFDKRTESTLSQDALKKLNQSIEALKNTVRSLSMKERDSAYSAKGS 313

Query: 386 AHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLR 445
               +RES+LT +L+DSLGGN KT +I T   + + +  T STL++    + I N+    
Sbjct: 314 HSSAYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT--TLSTLEFGDSIRQINNK---- 367

Query: 446 SFIMKDILVKNITAELAKVKSDLL--STKLREGVYMSQDN 483
                  +  N T    K K DL     K+++  Y++Q N
Sbjct: 368 -------VTDNTTGLNLKKKMDLFIQDMKIKDDNYVAQIN 400

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 58/125 (46%), Gaps = 14/125 (11%)

Query: 53  NTTDDVGITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTST 112
           N T  + I  +     +  D+ FG   + + IF EI + L    L GYN  +  YG T +
Sbjct: 392 NGTQCITIKREAKYHKFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGS 450

Query: 113 GKTYTMTGDEKLYNDELSDSAGIIPRILFKLF---ETLDLRDEDYVVKCSFVELYNEELK 169
           GKTYTM          L+   GIIP  L  +F   E L      Y +   F+E+YNE +K
Sbjct: 451 GKTYTM----------LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIK 500

Query: 170 DLLDD 174
           DL  D
Sbjct: 501 DLFKD 505

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 59/109 (54%), Gaps = 12/109 (11%)

Query: 68  TYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYND 127
           T+  DKVF  +A Q+ +   + +P   D L GYN T+L YG + +GK+Y++ G +     
Sbjct: 75  TFQFDKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFSGKSYSLIGPQ----- 129

Query: 128 ELSDSAGIIPRILFKLFETLDLRDE----DYVVKCSFVELYNEELKDLL 172
              D  GI+P I   LF TL+ R++    ++ V     E+Y E+  DLL
Sbjct: 130 ---DGGGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYMEKTYDLL 175

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 87/176 (49%), Gaps = 17/176 (9%)

Query: 279 IQNLQDFHITSARDGLQLLQ--KGLRNRQVATTKMNDFSSRSHTIFTITL-YREHQGEMF 335
           I++++  H+ S  D    +Q  +   NR   + K     SRSH +F + +  R  + ++ 
Sbjct: 197 IKDIRPAHVNSFEDLKSYIQSVQNPANRMGYSGKAE--RSRSHVVFQLHVEQRNRRHDIL 254

Query: 336 KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL---------ADKSA 386
           K S + L+DL G+E   +             +NQS+  L   + SL         + K++
Sbjct: 255 KNSSLYLIDLHGAEKFDKRIENTLSQDSLKKLNQSIEALKNTVQSLEIKSMDSVYSAKAS 314

Query: 387 HVP-FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNR 441
           H   +RES+LT +L+DSLGGN KT +I T   + + +  T STL++    + I NR
Sbjct: 315 HSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT--TLSTLKFGDSIRQINNR 368

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 60/109 (55%), Gaps = 12/109 (11%)

Query: 68  TYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYND 127
           T+  DKVF  +A Q+ +   +  P   D L GYN T+L YG + +GK+Y++ G +  YN+
Sbjct: 74  TFQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFSGKSYSLLGSQ--YNE 131

Query: 128 ELSDSAGIIPRILFKLFETLDLRDE----DYVVKCSFVELYNEELKDLL 172
                 G++P I   LFETL+  +E    ++ V     E+Y E+  DLL
Sbjct: 132 ------GVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYMEKSYDLL 174

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 100/208 (48%), Gaps = 37/208 (17%)

Query: 316 SRSHTIFTITL-YREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTL 374
           S+SH +F + +  R  + ++ K S + L+DL G+E   +             +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALKKLNQSIEAL 292

Query: 375 GRVINSLA---------DKSAHVP-FRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 424
             ++  LA          K++H   +RES+LT +L+DSLGGN K  +I T   + + +  
Sbjct: 293 KNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLSNVPT-- 350

Query: 425 TCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLL--STKLREGVYMSQ- 481
           T STL++    + I N+           ++ + T    K K DL     K+++  Y+SQ 
Sbjct: 351 TISTLEFGDNIRQIINK-----------VMSSTTGLNMKKKMDLFVQDMKIKDDNYVSQI 399

Query: 482 -------DNYKEITND---LESYKTEIQ 499
                  D+ K+++N+    E  KTE++
Sbjct: 400 NILKSELDSLKDLSNESSSREDMKTELE 427

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 12/109 (11%)

Query: 68  TYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYND 127
           T+  DKVF  +A Q+ +   +  P   D L GYN T++ YG + +GK+Y++ G +     
Sbjct: 74  TFKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIITYGPSFSGKSYSLLGSQ----- 128

Query: 128 ELSDSAGIIPRILFKLFETLDLRDE----DYVVKCSFVELYNEELKDLL 172
              +  GI+P I   LFETL+   E    ++ V     E++ E+  DLL
Sbjct: 129 ---EGEGILPNICKVLFETLEKNKETKGNNFSVSVLAFEIFMEKTYDLL 174

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 110/235 (46%), Gaps = 36/235 (15%)

Query: 279 IQNLQDFHITSARDGLQLLQKGLRNRQVATTKM----NDFSSRSHTIFTITL-YREHQGE 333
           I+++   HI S +D    L+  +++ Q    +M    N   S+SH +F + +  R    +
Sbjct: 196 IKDICPAHIRSYKD----LKSYIQSVQNTDNRMGYSGNTERSKSHLVFQLHVEQRNRNAD 251

Query: 334 MFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADK--------- 384
           + + S + L+DL G+E   +             +NQS+  L  ++  L+ K         
Sbjct: 252 ILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEALKNIVRLLSVKDRDSAYSVK 311

Query: 385 -SAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQ 443
            S    +RES+LT +L+DSLGGN KT +I T   + +++  T STL++    + I N+  
Sbjct: 312 ASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVST--TLSTLEFGECIRQITNK-- 367

Query: 444 LRSFIMKDILVKNITAELAKVKSDLL--STKLREGVYMSQDNYKEITNDLESYKT 496
                    ++ N T    K K DL     K+R+  Y S+ N   +  +++S KT
Sbjct: 368 ---------VIDNTTGLNLKKKMDLFIEDMKIRDNNYASRINI--LKAEIDSLKT 411

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 141/294 (47%), Gaps = 39/294 (13%)

Query: 278 YIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREH---QGEM 334
           +++NL    I S  D  +  + G +              RS++I    ++ E    + ++
Sbjct: 205 HVKNLSHIQIASLDDLQKWFKIGCQRSSAIINAGTAKEKRSNSIIISKIHLEQVNPKDQL 264

Query: 335 FKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPF---- 390
           +K+S ++ +DL G +  ++   Q     E   +N  + +   +I +L+D  + +P+    
Sbjct: 265 YKLSTLSFIDLYGIDKFTKKDIQLTN-DEMKKLNTLMSSFQNLITTLSDPKS-LPYTSSL 322

Query: 391 -RESKLTRLLQDSLGGNTKTALIATI-SPAKINSEETCSTLQYASKAKNIKNRPQLRSF- 447
            ++S L ++LQD +GGN+KT  I    SP+ I  EE    L++A   K+IKN   +  F 
Sbjct: 323 YKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELIEMLKFAMGLKSIKNPLIMNVFG 382

Query: 448 --IMKDILV---------KNITAELAKVKSDL-LSTKLREGVYMSQDNYKEITNDLES-- 493
             + K +L+         +N   ++  ++S+L L  KL E V  + D+++E  ND  S  
Sbjct: 383 LNLQKQMLLFIKSSKLREENCQTKINYLQSELALKNKLLEPV--ATDHHEENYNDESSCS 440

Query: 494 -------YKTEIQESKRIIERLS-SQNSLLLKDKKASNEVNELQRIKLQNMKDV 539
                   K +I+  ++++E +S S+N    K K  +NE +EL +  +   +DV
Sbjct: 441 DKETIMKLKLKIESLEQVLEHISTSENP---KSKTETNEHDELLKKLMDKCEDV 491

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 63/109 (57%), Gaps = 10/109 (9%)

Query: 67  KTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 126
           +T+++DKVF PSA+Q  +   +  P+  +   G N  +   G + TGKT+TM G + +  
Sbjct: 42  RTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTMLGQQGV-- 99

Query: 127 DELSDSAGIIPRILFKLFETLDLRDEDYVVKCSF--VELYNEELKDLLD 173
                S G++ RIL K+F+ ++  +E   V+ S   VEL N+++ DLL+
Sbjct: 100 -----SQGLLQRILTKVFQLMN-ENEGVTVQYSLSAVELVNDKVYDLLN 142

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 66/164 (40%), Gaps = 50/164 (30%)

Query: 66  SKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLY 125
           S  Y  DK+F P      I   ++     D  KGYN T + YG T TGKTYT+ G    +
Sbjct: 55  SNQYRFDKIFEPEKPDDEINSTLSFACINDLFKGYNSTYISYGQTGTGKTYTLYG--TAF 112

Query: 126 NDELSD-----------------------------------------SAGIIPRILFKLF 144
           ND  +D                                         + G+I ++   LF
Sbjct: 113 NDTPTDLDSKNINTNKNVKNDSNISSNSNIQTSASSNKSANSILQKKNYGLISKVGNDLF 172

Query: 145 ETLD-----LRDEDYVVKCSFVELYNEELKDLL--DDSVENSSM 181
           E +D      +   ++V  SFVE+Y EE+ DLL  DD++ N  +
Sbjct: 173 EMIDQIRAIRKGITFLVNISFVEVYKEEVYDLLQHDDTLSNKKL 216

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 71/133 (53%), Gaps = 5/133 (3%)

Query: 317 RSHTIFTITLYREHQGEMFKV-SKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLG 375
           RS TI  I L +  + E  +  S +  VDLAGS+  S+   +    + A   N+ + +L 
Sbjct: 265 RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAASKYNRVMDSLN 324

Query: 376 RVINSLADKSA----HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQY 431
            ++ +LA+  +       +R S LTR+L D L GN KT LI + S  K +  ET STL +
Sbjct: 325 SMVYTLANSESISINKSIYRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFSTLGF 384

Query: 432 ASKAKNIKNRPQL 444
           +S A ++ N+ ++
Sbjct: 385 SSYASSMSNQIKI 397

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 67/271 (24%), Positives = 132/271 (48%), Gaps = 34/271 (12%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMF 335
           G +I++L   H+TS  +    L+ G +N     + ++   S+    F +    + + ++ 
Sbjct: 196 GDHIRDLHQIHVTSPIEIKDTLKNGYKN----ISPLHHSKSQIFVRFEVQCI-DRKDDVT 250

Query: 336 KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADK----SAHVPFR 391
           + S +  +DL GS+ +++  A    + +    NQ +  L  +I +L ++    S+H  F+
Sbjct: 251 RCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSH--FK 308

Query: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMK- 450
           +S L ++L D LGG+TK  L+  I       E+    ++  +KAK IKN P +    +  
Sbjct: 309 DSSLNKILMDYLGGDTKMTLVVAIDGNTGGYED---AVKLGAKAKLIKNYPTMNKIGLNA 365

Query: 451 ----DILVKNITAE----LAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESK 502
               D+LV+++  +    LAK+  +LL T+++     +       +N LE+    +QE+ 
Sbjct: 366 KRKMDLLVQDMNVKEQNYLAKI--NLLQTEIKTLKTENDSTTNSTSNSLEN---ALQENS 420

Query: 503 RIIERLSSQNSLL----LKDKKAS--NEVNE 527
           ++  +L S   +L    L +  +S  NE+NE
Sbjct: 421 KLKLQLESLQQILGTMSLANPSSSNKNEMNE 451

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 54/104 (51%), Gaps = 6/104 (5%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           Y  D +F   + +   +  I + L  D  KGYN T++ YG TS+GK++ + GD    ND 
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPDSTNDG 145

Query: 129 LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLL 172
           L +   I  R+LF   E  +L+    +   S  ELY +++ DLL
Sbjct: 146 LINH--IADRLLFPQCED-NLK---TLCSISMWELYIDKVYDLL 183

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 83/170 (48%), Gaps = 18/170 (10%)

Query: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREH-QGE 333
           S + I+NL+  ++ S  +    L +G  NR      M   +SRS+ +  I L +   + +
Sbjct: 235 SSLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVIKINLEQVFLEDQ 289

Query: 334 MFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRE- 392
           + K S + L+D+A S+ I ++ +    AKEA  +N  + +    IN LA+ +   P+ + 
Sbjct: 290 LMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAE-TGTSPYDQQ 348

Query: 393 ----------SKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYA 432
                     S L  ++   +GGN KT  I+TISP   N  ET  TL+ +
Sbjct: 349 INGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITLRIS 398

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 69  YAVDKVFGPSANQQ-LIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKL 124
           + VDKVF     Q  L+  +I +    +   G+N +++ +G + TGK++TM G+  L
Sbjct: 51  FQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQSGTGKSFTMFGNNSL 107

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 82/358 (22%), Positives = 161/358 (44%), Gaps = 50/358 (13%)

Query: 316 SRSHTIFTITL-YREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTL 374
           SRS     IT+  R  + E  K S + L+DLA S+ + ++        E  S N S+  L
Sbjct: 224 SRSSAFLNITVEQRNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNL 283

Query: 375 GRVINSLAD--------KSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETC 426
            +V+  L++         S+    R S+L + LQ ++GG++KT  +   S  K + E T 
Sbjct: 284 HQVVYGLSELESPSSKNHSSKHTHRTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRENTV 343

Query: 427 STLQYASKAKNIKNRP-----QLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQ 481
            TL   S+ ++I N P      L S  + D+ +KN++      + D   T+++   Y+ +
Sbjct: 344 ITLSLGSRLRSIHNFPVQNKMGLNSKALLDLRLKNMS-----TREDSYLTRIK---YL-E 394

Query: 482 DNYKEITNDLESYKTEIQESKRIIE---RLSSQNSLLLKDKKASNEVNELQRIKLQNMKD 538
           D   ++   ++  K ++  +K + E   +L  Q  L  K ++     +E + +  Q    
Sbjct: 395 DEVSKLGGTIQQNKNQVSTNKSLTEKNMKLMDQLELYRKSQQTQKSGSEEENLTSQQNGR 454

Query: 539 VMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKE--YGQREKQISERMQMILGQE 596
           + + +SE L++  +K + ++ +   L   L     + ++  Y + + Q  E M + L   
Sbjct: 455 IQNEMSEVLDNLMEKCERVIQLQMRLDEELRQKSQMSQQLNYKESKAQALEAMNVKL--- 511

Query: 597 FLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKM 654
                      +E + TN        E E   +    ++LR+E+ + + +A+ R+EK+
Sbjct: 512 -----------LEQLNTN--------ENEMRNVLNTNSILRKEMEKWMHVAKTRSEKI 550

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 55/112 (49%), Gaps = 20/112 (17%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGD----FLKGYNCTVLVYGMTSTGKTYTMTGDEKL 124
           +  +KV+     QQ    E+ E + GD     L G+N +++ +G   +GKTYTM G++  
Sbjct: 68  FRFNKVYDVGVRQQ----EVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGNDH- 122

Query: 125 YNDELSDSAGIIPRILFKLFETLDLRDED----YVVKCSFVELYNEELKDLL 172
                    GI+ R+   +F+ LD   ED      +  +F EL+ E + DLL
Sbjct: 123 -------EEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLL 167

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 86/372 (23%), Positives = 163/372 (43%), Gaps = 68/372 (18%)

Query: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTIT---LYREHQG 332
           G+Y Q   + +I S ++  ++++    N++ +  KM+   S SH +   +   L R H  
Sbjct: 205 GLYYQEANNEYINSIKEFDRVMKLIQDNKEASEKKMDSKRSTSHVVIRCSVEQLDRVHG- 263

Query: 333 EMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL----------- 381
                S +   DL GS    +   Q    +    +N S+  L  V+NS+           
Sbjct: 264 -TITSSNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLESVVNSVLQNQQKNHLYI 322

Query: 382 ---------ADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYA 432
                    +     VP+++S+LT L+Q++LGGN++T ++      K + EET +TL++ 
Sbjct: 323 ENKLVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETIATLRFG 382

Query: 433 SKAKNIKNRPQ-----LRSFIMKDILVKN--------------ITAELAK----VKSDLL 469
            + +NI N  +     L S    D+L+ N              + +EL K    VK   +
Sbjct: 383 VQLQNILNFVRADVTGLNSKKTLDLLIDNMKVIENNYDQKITLLESELNKLADTVKKAKV 442

Query: 470 STKLREGVYMSQDNYKEITNDLESY--------KTEIQESKRIIERL------SSQNSLL 515
           + +L   +    D  K++   LE+           E +++K+II+ L       +Q  L 
Sbjct: 443 TEELETEIVEKNDEIKKLREQLETMTQLFNNIDPKESEDTKKIIQTLMEKCESVAQLQLE 502

Query: 516 LKDKKASNEV----NELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
           L+ +   N +     E++  K++ ++ + S L E+L++Q    Q+++     LK  L   
Sbjct: 503 LEGQLHENSILKGDGEIKDAKIRTLETMNSRLVEQLQNQESSTQDILKSNGILKKELEAL 562

Query: 572 QSVIKEYGQREK 583
            ++ K   Q+EK
Sbjct: 563 SNISK--SQQEK 572

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 8/84 (9%)

Query: 53  NTTDDVGITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTST 112
           NT     IT   +   +  +KV+        I K ++E +  D   GY+ +++ YG   +
Sbjct: 71  NTIIHYPITNFADESIFNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGS 130

Query: 113 GKTYTMTGDEKLYNDELSDSAGII 136
           GK++T+ G+E        DS GII
Sbjct: 131 GKSFTLFGNE--------DSDGII 146

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 72/289 (24%), Positives = 132/289 (45%), Gaps = 26/289 (8%)

Query: 278 YIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDF--SSRSHTIFTITLYREHQGE-M 334
           Y ++L    +TS  + +  +     NR   +    ++   S+SH I  I + + +  E +
Sbjct: 179 YFKDLHVAFVTSRDELINYIMDAESNRFSGSCLHTNYVQRSKSHLITKINVEQRNLNEDV 238

Query: 335 FKVSKMNLVDLAGSENISRSG--AQHQRAKEAGSINQSLLTLGRVINSLADKS----AHV 388
            K   ++  DLA  + I +    +    + E   +N    TL   I S+++ S    A +
Sbjct: 239 VKRGSISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLESTTLKNSIISMSELSENPNAVI 298

Query: 389 PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIK-----NRPQ 443
           P++ S LT+LL     GN KT +I T S  K N  ET  TL+   K ++I      N+  
Sbjct: 299 PYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLETLKMGLKLESISSNVHMNKHA 358

Query: 444 LRSFIMKDILVKNITAELAKV--KSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQES 501
           L S    D++V+++ ++ A    +  LL T+L +     + +Y E  ++  S+K E+ + 
Sbjct: 359 LNSKKKLDLIVEDMKSKEANYMNRIRLLETELND----LRASYGEAISETSSFKEEMNKE 414

Query: 502 K----RIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEK 546
           +    ++ E L     LL   KK   +    + + L + +++M  L EK
Sbjct: 415 RAKNVKLKEELEVFKKLL--QKKGEAQSTHSKEMPLTDDEEIMQQLIEK 461

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 11/106 (10%)

Query: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128
           Y  D V   S     ++  I   L  +  +GY+  V+ YG   TGK+    G +  Y   
Sbjct: 63  YQFDSVHEKSTE---LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTY--- 116

Query: 129 LSDSAGIIPRILFKLFETLDL--RDEDYVVKCSFVELYNEELKDLL 172
                G++   +  L++ +D    D  + V  S +E++ E++ DLL
Sbjct: 117 ---EGGVVLMFVQDLYDKIDSIGNDTHFTVSLSTIEIHLEKMYDLL 159

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 58/125 (46%), Gaps = 6/125 (4%)

Query: 52  INTTDDVGITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTS 111
           + T +D  +  ++  ++++  KV    A +   F E+A  +  D L G NC V  YG   
Sbjct: 75  VQTVNDTVV--KLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINCCVTTYGSGL 132

Query: 112 TGKTYTMTGDEKLYNDELSDS---AGIIPRILFKLFETLDL-RDEDYVVKCSFVELYNEE 167
              +  M G +   + E  DS   +G++ +    +F  +D     +Y V  S  E+Y ++
Sbjct: 133 AADSLVMFGPQSGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSLSLCEVYVDK 192

Query: 168 LKDLL 172
           + DLL
Sbjct: 193 VFDLL 197

>KAFR0B00590 Chr2 complement(117951..121736) [3786 bp, 1261 aa] {ON}
           Anc_7.488 YBL047C
          Length = 1261

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 92/191 (48%), Gaps = 29/191 (15%)

Query: 480 SQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLK---DKKA-------SNEVN--- 526
           S++   E+T    +   E QE K  I + + QN+LLL    +K+A         +VN   
Sbjct: 629 SENKMNEVTLQFNNATRENQELKAKISQFNEQNNLLLSQLNEKQALLQKEMSIADVNRKQ 688

Query: 527 -ELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQI 585
            EL  I + N+ + +SGL EKL+    K  EL D    L+S  +  +    +  +RE Q+
Sbjct: 689 VELNDITVANLTNEISGLDEKLQIFISKTNELNDYQKTLESKHAQLEDKYNDLNERESQL 748

Query: 586 SERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHE---GEQNGIQQNLNVLRQEVVE 642
           +ER + I  QE     Q+   NI++++       I+ +   G++   ++  N L+Q+ +E
Sbjct: 749 NERTKQIEEQE-----QLYNENIKNLQ-------IMFDELAGKKQQFEKAENELKQQHLE 796

Query: 643 LLGLAQKRAEK 653
                Q+ +E+
Sbjct: 797 YAAHVQELSER 807

>NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401
          Length = 874

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 60/127 (47%), Gaps = 15/127 (11%)

Query: 292 DGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKV---------SKMNL 342
           D ++LL    +N  V +  +N     S T   + L +  Q   F+          S+  +
Sbjct: 372 DAIELLGSTFKNLSVRSYAVNRLKKASDTELELYLLQLVQAVCFENISTFSDKTNSEFTI 431

Query: 343 VDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL-ADKSAHV--PFRESKLTRLL 399
           VD+ G++++ +S     +  E   +N SLLTLG+ IN+L  D+   V  P  E  + R L
Sbjct: 432 VDMNGTQHLGKSQNVMPKTTE---LNSSLLTLGKSINNLNLDEMPIVISPLAEFLIRRAL 488

Query: 400 QDSLGGN 406
           ++S  GN
Sbjct: 489 KNSRLGN 495

>Smik_2.67 Chr2 complement(121714..125847) [4134 bp, 1377 aa] {ON}
           YBL047C (REAL)
          Length = 1377

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 72/154 (46%), Gaps = 28/154 (18%)

Query: 473 LREGVYMSQDNY-------KEITNDLESYKTEIQESKRIIERLSSQNSLL---------- 515
           L + + +S+ NY        E+TNDL+  + +  E K  I  L+S  + L          
Sbjct: 675 LTQQLAVSEANYHAAESKLNELTNDLQESQAKNAELKEQITNLNSMTASLQSQLNEKQQH 734

Query: 516 LKDKKASNEVN----ELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
           +K +++  +VN    EL +I + N++  + GL EK+     K++EL D    ++   +  
Sbjct: 735 VKQERSMVDVNSKQLELSQITVVNLQKEIEGLGEKITVYLTKQKELNDYQKTVEEQHAQL 794

Query: 572 QSVIKEYGQ-------REKQISERMQMILGQEFL 598
           Q+  +E          REKQ+ ER + I  QE L
Sbjct: 795 QAKYQELSNKDTDLSDREKQLEERNKQIEEQEDL 828

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 56/127 (44%), Gaps = 19/127 (14%)

Query: 315 SSRSHTIFTITLYREHQGE-MFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLT 373
           +S  HT   I+L   +  E  F+   +  VDL   E++                 Q + +
Sbjct: 191 NSTFHTFVKISLQLVNCHEDSFRKCCIEFVDLCAQEDVL----------------QLVCS 234

Query: 374 LGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAS 433
           L  V+++  DK   +   +S+  +LL +S+GGN KT  I   S  + N + +  TL++  
Sbjct: 235 LVAVLSNDNDKK--IGKEKSQFCKLLSNSIGGNRKTTFILACSTLEQNEKISLETLEFGL 292

Query: 434 KAKNIKN 440
           K   + N
Sbjct: 293 KVSQVVN 299

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 14/59 (23%)

Query: 90  EPLFGD----FLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDSAGIIPRILFKLF 144
           EPL  D      +G +C+++ YG ++TGKT+ +               GIIP  + +L+
Sbjct: 66  EPLVIDNINELTRGVDCSMVTYGQSATGKTHVL----------FDQVRGIIPLFIEQLY 114

>Ecym_6476 Chr6 (921068..923620) [2553 bp, 850 aa] {ON} similar to
           Ashbya gossypii ABL193C
          Length = 850

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 81/163 (49%), Gaps = 28/163 (17%)

Query: 453 LVKNITAELAKVKSDLLSTKLREGV----------YMSQD-----NYKEITNDLESYKTE 497
           L+ NI +EL  +K+  L+ KL+E +          Y++++     N KE+  D++ +   
Sbjct: 533 LLNNIKSELEPLKA--LNLKLKEELESKLKDTKDHYVTKESNMKENIKELQEDVKVHLAN 590

Query: 498 IQESKRIIERLSSQNSLLLKDKKA--------SNEVNELQRIKLQNMKDVMSGLSEKLES 549
           I++S+ +IE L    + L+K+K+         S  ++ELQ  +LQ  +     L EK + 
Sbjct: 591 IKKSQDVIESLHKDIAALIKEKEELLNKNAELSKRISELQESQLQRDRSTFLDLCEKNQD 650

Query: 550 QHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMI 592
             +   EL+  + +L++ L    S    Y + E +ISE+  ++
Sbjct: 651 LLQSNHELITKSRDLEAELVAANS---NYQELESKISEKDSLL 690

>Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON}
           YBL047C (REAL)
          Length = 1380

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 72/154 (46%), Gaps = 28/154 (18%)

Query: 473 LREGVYMSQDNY-------KEITNDLESYKTEIQESKRIIERLSSQNSLL---------- 515
           L + + +S+ NY        E+T DL+  +T+  E K  I  L+S  + L          
Sbjct: 677 LTQQLAVSEANYHAAESKLNELTTDLQESQTKNAELKEQITNLNSMTASLQSQLNEKQQH 736

Query: 516 LKDKKASNEVN----ELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
           +K +++  +VN    EL +I + N++  + GL EK+     K++EL D    ++   +  
Sbjct: 737 VKQERSMIDVNSKQLELNQITVVNLQKEIDGLGEKIGVYLTKQKELNDYQKTVEEQHAQL 796

Query: 572 QSVIK-------EYGQREKQISERMQMILGQEFL 598
           QS  +       +   REKQ+ ER + I  QE L
Sbjct: 797 QSKYQDLSNKDNDLADREKQLEERNKQIEEQENL 830

>YBL047C Chr2 complement(127895..132040) [4146 bp, 1381 aa] {ON}
           EDE1Endocytic protein; involved in a network of
           interactions with other endocytic proteins, binds
           membranes in a ubiquitin-dependent manner, may also bind
           ubiquitinated membrane-associated proteins; interacts
           with Cmk2 and functions upstream of CMK2 in regulating
           non-apoptotic cell death
          Length = 1381

 Score = 33.1 bits (74), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 72/154 (46%), Gaps = 28/154 (18%)

Query: 473 LREGVYMSQDNY-------KEITNDLESYKTEIQESKRIIERLSSQNSLL---------- 515
           L + + +S+ NY        E+T DL+  +T+  E K  I  L+S  + L          
Sbjct: 679 LAQQLAVSEANYHAAESKLNELTTDLQESQTKNAELKEQITNLNSMTASLQSQLNEKQQQ 738

Query: 516 LKDKKASNEVN----ELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
           +K +++  +VN    EL ++ + N++  + GL EK+     K++EL D    ++   +  
Sbjct: 739 VKQERSMVDVNSKQLELNQVTVANLQKEIDGLGEKISVYLTKQKELNDYQKTVEEQHAQL 798

Query: 572 QSVIKEYGQ-------REKQISERMQMILGQEFL 598
           Q+  ++          REKQ+ ER + I  QE L
Sbjct: 799 QAKYQDLSNKDTDLTDREKQLEERNRQIEEQENL 832

>SAKL0F14894g Chr6 complement(1202168..1206061) [3894 bp, 1297 aa]
           {ON} similar to uniprot|P34216 Saccharomyces cerevisiae
           YBL047C EDE1 Key endocytic protein involved in a network
           of interactions with other endocytic proteins binds
           membranes in a ubiquitin-dependent manner may also bind
           ubiquitinated membrane-associated proteins
          Length = 1297

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 86/181 (47%), Gaps = 40/181 (22%)

Query: 463 KVKSDLLSTK-----LREGVYMSQDNYKEITNDLESYKTEIQESK----RIIERLSSQNS 513
           KV+S LL ++     L++ + +++ NY  +   L   + E+Q+S+    ++ E++ + N+
Sbjct: 632 KVESLLLQSRKDTETLQQELSVAEANYHAVEGKLTELQKELQDSEQSNSQLKEQIGNLNA 691

Query: 514 LL-------------LKDKKASNEVN----ELQRIKLQNMKDVMSGLSEKLESQHKKEQE 556
           +              +K +++  +VN    EL +I + N+K  + GL E+L     K +E
Sbjct: 692 MAASLQTELNEKQQKVKQERSMVDVNSKQLELNQITVDNLKAEIQGLGEQLAVFFDKRKE 751

Query: 557 LVDMTCNLKSTLSLTQSVIKEY--------------GQREKQISERMQMILGQEFLQFRQ 602
           L D + N++   +  Q+   E+               QRE+ + +R + I  QE +  +Q
Sbjct: 752 LDDYSANIEKQHTELQNRHGEFVSKSHDLEAKKLELDQREQDVQQRTKQIEEQEQIYHQQ 811

Query: 603 M 603
           +
Sbjct: 812 I 812

>Skud_2.55 Chr2 complement(111625..115797) [4173 bp, 1390 aa] {ON}
           YBL047C (REAL)
          Length = 1390

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 76/162 (46%), Gaps = 29/162 (17%)

Query: 473 LREGVYMSQDNYKEITNDLESYKTEIQESK----RIIERLSSQNSLL------------- 515
           L + + +S+ NY    + L    T++QES+     + E++ + NS+              
Sbjct: 678 LSQQLAVSEANYHATESKLNELTTDLQESQAKNAELKEQIINLNSMTASLQSQLNEKQQN 737

Query: 516 LKDKKASNEVN----ELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571
           +K +++  +VN    EL +I + N++  + GL EK+     K++EL D    ++   +  
Sbjct: 738 VKQERSMVDVNSKQLELNQITVTNLQKEIDGLGEKISVYLTKQKELNDYQKTVEEQHAQL 797

Query: 572 QSVIK-------EYGQREKQISERMQMILGQEFLQFRQMLVN 606
           QS  +       +   REKQ+ ER + I  QE L + Q + N
Sbjct: 798 QSKYQDLSNKDTDLADREKQLEERNKQIEEQESL-YHQHVSN 838

>KLTH0C02486g Chr3 complement(217025..224428) [7404 bp, 2467 aa]
           {ON} highly similar to uniprot|P32600 Saccharomyces
           cerevisiae YKL203C TOR2 putative
           protein/phosphatidylinositol kinase involved in
           signaling activation of translation initiation
           distribution of the actin cytoskeleton and meiosis
           phosphatidylinositol kinase homolg
          Length = 2467

 Score = 33.1 bits (74), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 28/139 (20%), Positives = 59/139 (42%), Gaps = 13/139 (9%)

Query: 638 QEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSD 697
           Q + + + + Q+R  K+ K W +++ E      Q   N  + +  T+  Y Q L+   S 
Sbjct: 275 QTLYKCMAIIQERDSKLTKKWFQRLFEGCAYGLQLNGN--EAIHATLLVYRQLLSLQGSH 332

Query: 698 ISEGYNNLKQY---FNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKD 754
           + E ++ + +    + DH +    +E+        Y  L   A    Q F     DH+  
Sbjct: 333 LQEQFDEMYEMTMRYKDHKYNVIRKEI--------YAILPLLASADPQLFTDKYLDHVMI 384

Query: 755 NKTLMMKSLQSATTEAIDK 773
           +   ++K++ ++ T   D+
Sbjct: 385 HYLTLLKNMHASPTNNSDR 403

>KAFR0C03650 Chr3 complement(744293..744931) [639 bp, 212 aa] {ON}
           Anc_8.8 YFL046W
          Length = 212

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 459 AELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQE 500
            + AK+K  LLS+  +E  Y  Q+ Y+ + NDLE  KT+++E
Sbjct: 93  VDFAKLKDQLLSSDRKE-FYNLQNEYERVHNDLEKMKTKLKE 133

>KNAG0E02200 Chr5 complement(442946..447022) [4077 bp, 1358 aa] {ON}
           Anc_2.406 YMR129W
          Length = 1358

 Score = 32.3 bits (72), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 38/80 (47%), Gaps = 7/80 (8%)

Query: 407 TKTALIATISPAKINSEETCSTLQYASKAKNI--KNRPQLRSFIMKDILVKNITAELAKV 464
           TK +LI  I+    N  E    L Y +K   +  K RPQ    I  D LV ++ AEL   
Sbjct: 551 TKKSLIIKIN----NGAEEQEDLPYTAKISFVDSKGRPQESKMIELDSLVHHVNAELPGT 606

Query: 465 KS-DLLSTKLREGVYMSQDN 483
            + D +S+K   GV + + N
Sbjct: 607 YNLDFVSSKFCPGVVIGKSN 626

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 94,328,667
Number of extensions: 4133973
Number of successful extensions: 19191
Number of sequences better than 10.0: 874
Number of HSP's gapped: 19569
Number of HSP's successfully gapped: 1336
Length of query: 974
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 855
Effective length of database: 39,836,145
Effective search space: 34059903975
Effective search space used: 34059903975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)