Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07876g6.17ON68168133880.0
TDEL0G045206.17ON67968419660.0
SAKL0E01100g6.17ON71071916680.0
Kpol_1045.726.17ON69569815820.0
Ecym_30216.17ON67469715260.0
TBLA0G010106.17ON71073115090.0
ACR009W6.17ON68068914350.0
KLLA0D01067g6.17ON66069514250.0
CAGL0L13288g6.17ON64667613491e-178
NDAI0D008606.17ON66671113441e-177
KNAG0M011406.17ON59467413011e-172
KAFR0L003806.17ON54066812081e-158
Suva_5.56.17ON61937812061e-157
YEL062W (NPR2)6.17ON61535312041e-157
Skud_5.276.17ON61536412001e-156
Smik_5.256.17ON61536111961e-156
Kwal_56.224116.17ON68935211711e-151
KLTH0C11308g6.17ON69035311561e-149
TPHA0J003106.17ON67537311141e-142
NCAS0H008706.17ON61234610901e-140
NDAI0C054008.520ON1838114771.4
NCAS0A090501.347ON403102715.4
Kpol_538.73.402ON83957716.1
TDEL0C065701.45ON81059717.3
TPHA0O016102.73ON536230699.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C07876g
         (681 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...  1309   0.0  
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   761   0.0  
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   647   0.0  
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   613   0.0  
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   592   0.0  
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   585   0.0  
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   557   0.0  
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   553   0.0  
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   524   e-178
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   522   e-177
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   505   e-172
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   469   e-158
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)    469   e-157
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   468   e-157
Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)   466   e-156
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   465   e-156
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   455   e-151
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   449   e-149
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   433   e-142
NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...   424   e-140
NDAI0C05400 Chr3 (1249878..1255394) [5517 bp, 1838 aa] {ON} Anc_...    34   1.4  
NCAS0A09050 Chr1 complement(1791486..1792697) [1212 bp, 403 aa] ...    32   5.4  
Kpol_538.7 s538 (10425..12944) [2520 bp, 839 aa] {ON} (10425..12...    32   6.1  
TDEL0C06570 Chr3 (1206296..1208728) [2433 bp, 810 aa] {ON} Anc_1...    32   7.3  
TPHA0O01610 Chr15 (319614..321224) [1611 bp, 536 aa] {ON} Anc_2....    31   9.7  

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 681

 Score = 1309 bits (3388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/681 (93%), Positives = 637/681 (93%)

Query: 1   MSLRYIQACANTGRMTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAI 60
           MSLRYIQACANTGRMTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAI
Sbjct: 1   MSLRYIQACANTGRMTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAI 60

Query: 61  KNYIIPKPQLCHKLLTLKYKGYRIVCYPVTVNSPYYARXXXXXXXXXXXPYDCETSSYEP 120
           KNYIIPKPQLCHKLLTLKYKGYRIVCYPVTVNSPYYAR           PYDCETSSYEP
Sbjct: 61  KNYIIPKPQLCHKLLTLKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEP 120

Query: 121 AIARLGKMFRVLEEQNQILSKAENDPIYFDFKLADNTTEQDGKLNAEKSFKGLTKSQGMA 180
           AIARLGKMFRVLEEQNQILSKAENDPIYFDFKLADNTTEQDGKLNAEKSFKGLTKSQGMA
Sbjct: 121 AIARLGKMFRVLEEQNQILSKAENDPIYFDFKLADNTTEQDGKLNAEKSFKGLTKSQGMA 180

Query: 181 LAKYNEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNS 240
           LAKYNEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNS
Sbjct: 181 LAKYNEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNS 240

Query: 241 CISIEDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHL 300
           CISIEDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHL
Sbjct: 241 CISIEDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHL 300

Query: 301 VYYNCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFERLRKF 360
           VYYNCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFERLRKF
Sbjct: 301 VYYNCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFERLRKF 360

Query: 361 DLDDMDQSKNQEXXXXXXXXXXXXXXXXXXPFFYSAPRNPYXXXXXXXXXXXXXXXNVTH 420
           DLDDMDQSKNQE                  PFFYSAPRNPY               NVTH
Sbjct: 361 DLDDMDQSKNQESGSRTTSMSSKSDSKSKRPFFYSAPRNPYRFNQRSQSSFSSTNTNVTH 420

Query: 421 DLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCF 480
           DLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCF
Sbjct: 421 DLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCF 480

Query: 481 SFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMKLGEGSKMHQNF 540
           SFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMKLGEGSKMHQNF
Sbjct: 481 SFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMKLGEGSKMHQNF 540

Query: 541 SVDIADEVLRNVYKKLSNTNEPGSRDDYPLSRIYREESHVSLSALSGDNVSHPKKPERVS 600
           SVDIADEVLRNVYKKLSNTNEPGSRDDYPLSRIYREESHVSLSALSGDNVSHPKKPERVS
Sbjct: 541 SVDIADEVLRNVYKKLSNTNEPGSRDDYPLSRIYREESHVSLSALSGDNVSHPKKPERVS 600

Query: 601 KVAFDMNKDDPVPYSLSQQKGKNKEREAAKLDRAKNNQKIILLESIAAADCLDKICVKLE 660
           KVAFDMNKDDPVPYSLSQQKGKNKEREAAKLDRAKNNQKIILLESIAAADCLDKICVKLE
Sbjct: 601 KVAFDMNKDDPVPYSLSQQKGKNKEREAAKLDRAKNNQKIILLESIAAADCLDKICVKLE 660

Query: 661 KPRHEVEELLHELGDYKIINS 681
           KPRHEVEELLHELGDYKIINS
Sbjct: 661 KPRHEVEELLHELGDYKIINS 681

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
           YEL062W
          Length = 679

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/684 (57%), Positives = 479/684 (70%), Gaps = 22/684 (3%)

Query: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74
           M DQFEGF+PIHT+FYAVFHPT+GT+VRYE+PPGNLE +NINFDAIKNYIIPKPQLCHKL
Sbjct: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60

Query: 75  LTLKYKGYRIVCYPVTVNSPYYARXXXXXXXXXXXPYDCETSSYEPAIARLGKMFRVLEE 134
           LTLKYK YRI  YPVTVNSP YAR           PYDC+TS YEPAIARLGKMF+VLEE
Sbjct: 61  LTLKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEE 120

Query: 135 QNQILSKAENDPIYFDFKLADNTTEQDGKLNAEKSFKGLTKSQGMALAKYNEIMKDLESE 194
           QN ILSKAE DPI++ FK  +   +QD K   EK    L+KSQ  A  KY++IM D+ES 
Sbjct: 121 QNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLSKSQAYASEKYHKIMTDIESA 180

Query: 195 KSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSCISIEDVPISTVNL 254
            S FS++DLV+R++QDLNNYSECLIPIDEGNAVDIKIFP+ TPPNS ISIEDVP+STVNL
Sbjct: 181 DSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNISIEDVPVSTVNL 240

Query: 255 KTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYNCVILADIFQF 314
             +IDVNWDPTMLKIVPYI+GLNSISKIAKLS SD  LV+EC+KHL+YYNCV+LADIFQF
Sbjct: 241 NKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVLLADIFQF 300

Query: 315 SNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFERLRKFDLDDMDQSKNQEXX 374
           SNIYAPTS +R FLTD  L++ECQS+V     S+L  +PF+R+     + +D        
Sbjct: 301 SNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATESVDHELADSHR 360

Query: 375 XXXXXXXXXXXXXXXXPFFYS---------APRNPYXXXXXXXXXXXXXXXNVTHDLARH 425
                            FF S         +  + Y               N ++ LAR+
Sbjct: 361 SQRTSGSRTTSMSSNGKFFPSSNNEMPALISEESLYRTGKHSQSSFSSNNTNPSNMLARY 420

Query: 426 LPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCFSFPVM 485
           LPTK+CLFDLYR+LSQG ++REWY ++Y TI+ N IDVRRFITFGVI GLIYRC+S+P+M
Sbjct: 421 LPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVINGLIYRCYSYPIM 480

Query: 486 KKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMKLG-----EGSKMHQNF 540
           K + IFDLA +LH     N   K  K +     SK +FSTSD+K G     + +K H+  
Sbjct: 481 KNLEIFDLAKRLHREDISNHTVKHNKAKN---PSKNIFSTSDIKFGVEYERQRNKHHKAL 537

Query: 541 SVDIADEVLRNVYKKLSNTNEPGSRDDY--PLSRIYREESHVSLSALSGDNVSHPKKPER 598
           ++DIADEVLRNVYKKLS TN   +R +   P++R+YRE S  SL+  S +N+   +  +R
Sbjct: 538 NLDIADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGSLADGSTNNIYRLQNSDR 597

Query: 599 VSKVAFDMNKD-DPVPYSLSQQKGKNKEREAAKLDRAKNNQKIILLESIAAADCLDKICV 657
            SKV+FD  ++   +   +S    K K  E AKL+R +  + +ILLES+ AAD LD ICV
Sbjct: 598 PSKVSFDKQQEIGHISKGMSSSNDKVKMDEEAKLERRE--RDLILLESVEAADSLDTICV 655

Query: 658 KLEKPRHEVEELLHELGDYKIINS 681
           KLE  R++VE L+  LG+YKIINS
Sbjct: 656 KLEMSRYDVEALIQNLGEYKIINS 679

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 710

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/719 (48%), Positives = 455/719 (63%), Gaps = 61/719 (8%)

Query: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74
           M+  F+GFVPIHT+FY+VFHPT+GT+VRY++PP NLE N+INFD IKNY+IPKPQLC+KL
Sbjct: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60

Query: 75  LTLKYKGYRIVCYPVTVNSPYYARXXXXXXXXXXXPYDCETSSYEPAIARLGKMFRVLEE 134
           LT KY  YR+ CYPV VN+ YYAR           PY+C TS YEPA+ARLGKMFRVLEE
Sbjct: 61  LTFKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEE 120

Query: 135 QNQILSKAENDPIYFDFKLADNT------------------TEQDGKLNAEKSFK--GLT 174
           Q+QILSKAENDP+YF  K  +++                  TEQ   LN  +  K  G  
Sbjct: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180

Query: 175 KSQGMALAKYNEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPL 234
           + QG A+ KY+EIM DLE  K   S++DL+ +++QDLNNYSEC IPID GN+VDIK+FPL
Sbjct: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240

Query: 235 KTPPNSCISIEDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVL 294
             PPNSC+S EDVPISTVNL  +IDVNWDPTMLKIVP+I+G+NSI+KIAK S SD  LV+
Sbjct: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300

Query: 295 ECVKHLVYYNCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPF 354
           ECVKHL+YYNCV+LADIFQFSNIYA TSLI +FLTDPTLASECQ++VT +    L  +PF
Sbjct: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVT-SSDLELYRLPF 359

Query: 355 ERLRKFDLDDMDQSKNQEXXXXXXXXXXXXXXXXXXPFFY----SAPRNPYX-------X 403
           E   + +L  M  S+ Q                      Y    S  RN +         
Sbjct: 360 E--SRPNLLSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNFSSSSASSLM 417

Query: 404 XXXXXXXXXXXXXNVTHDLAR-HLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDID 462
                         V    +R  LPTK+CLFDLYR+L QG TV+EWY +N++ I+ N ID
Sbjct: 418 RVRDRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHID 477

Query: 463 VRRFITFGVIKGLIYRCFSFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYV 522
           VRRFITFG+++GLIYRC+++PVMK +   ++   L +A +   + +K K ++    +  V
Sbjct: 478 VRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFTNNV 537

Query: 523 FSTSDMKL----------GEGSKMHQNFSVDIADEVLRNVYKKLSNTNEPGSRDD----- 567
           FST+D+K+           E        +VD+A+EVL++ YKKLS      S DD     
Sbjct: 538 FSTADIKVDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKKLSIIE---SMDDNLYHV 594

Query: 568 -YPLSRIYREESHVSLS----ALSGDNVSHPKKPERVSKVAFDMNKDDPVPYSLSQQKGK 622
             P+SR+Y  +S  S +      S    S   + E  SKVAF+  +    P+ + + + K
Sbjct: 595 HNPMSRLYGHDSGESSTKGSRKGSRKGSSSTMESETRSKVAFEKGRS---PWQVEEDEKK 651

Query: 623 NKEREAAKLDRAKNNQKIILLESIAAADCLDKICVKLEKPRHEVEELLHELGDYKIINS 681
            +  E + L + K +++ +LL+S+ + D  DKIC++LEK R EVE+LL E+G Y IINS
Sbjct: 652 ERTEEVSNLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIINS 710

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
           (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/698 (47%), Positives = 441/698 (63%), Gaps = 41/698 (5%)

Query: 19  FEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKLLTLK 78
           F+GF PIHT+FY+VFHPT+G +V Y++PP NL+  +INFD+I++Y+IPKPQLC+KLLTLK
Sbjct: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63

Query: 79  YKGYRIVCYPVTVNSPYYARXXXXXXXXXXXPYDCETSSYEPAIARLGKMFRVLEEQNQI 138
           Y  YRI+ YP+T+N   YAR           PY+C+TS YE  I +LGKMFRVLEEQ+Q 
Sbjct: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123

Query: 139 LSKAENDPIYFDFK-LADNTTEQDGKLNAEKSFKGLT---------------------KS 176
           LSKAE D  YFDFK +  ++ +QD KL  EK   G                       K+
Sbjct: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKDSSGNNNGNSNNSNNDQSNSANATDSKKN 183

Query: 177 QGMALAKYNEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKT 236
                 KY EI + + +++SDFS+QD +MR++QDLNNYSECLIPID GNAVDIK+FPL  
Sbjct: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243

Query: 237 PPNSCISIEDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLEC 296
           PP + ISIEDVPIS VNLK IIDVNWDPTMLKIVP+IDG+NSI+KIAKLSDSD  LV+EC
Sbjct: 244 PPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIEC 303

Query: 297 VKHLVYYNCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFER 356
           +KH +YY CV+++DIFQFSNIYAPTSL+R FLTDP +A+ECQ++VT+   S+L ++P E 
Sbjct: 304 IKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQLPLES 363

Query: 357 LRKFDLD-------DMDQSKNQEXXXXXXXXXXXXXXXXXXPFFYSAPRNPYXXXXXXXX 409
           L K  LD       ++ +SKN                         +  + Y        
Sbjct: 364 LSKLKLDSDGSDSQNLRKSKNGIDSRAASFVSSRGASSHNENSSLYSRSDLYLNRHRSES 423

Query: 410 XXXXXXXNVTHDLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITF 469
                  N  +   + LPT++ LFDLYR+LSQGVT++EWY  N+  I+ N ID+R+FI F
Sbjct: 424 SISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNGIDIRKFIIF 483

Query: 470 GVIKGLIYRCFSFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMK 529
           G+I GL+YRC SFPV       +   K     N  + T+K K QK L++   +FSTSD+K
Sbjct: 484 GIINGLLYRCQSFPVTANFEEINKVKKFKDIQNRKE-TRKDKLQKQLSQD--IFSTSDIK 540

Query: 530 LGEG-----SKMHQNFSVDIADEVLRNVYKKLS-NTNEPGSRDDYPLSRIYREESHVSLS 583
           +GE      ++  Q   +DIAD VL+NVYKKL+  T E  S +    S+   ++S  SL 
Sbjct: 541 VGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQELEKKSVQSLF 600

Query: 584 ALSGDNVSHPKKPERVSKVAFDMNKDDPVPYSLSQQKGKNKEREAAKLDRAKNNQKIILL 643
             S      PK+P  +SKV+F  N +  + YS S       E +   L++ +   + ILL
Sbjct: 601 ESSNPYSKVPKRPGTLSKVSFQQNSN--MQYSASSGDVTENE-DINNLEKLRKQNEQILL 657

Query: 644 ESIAAADCLDKICVKLEKPRHEVEELLHELGDYKIINS 681
           E++ + + LDKICV LEKPR EVEE+L  L D+K+INS
Sbjct: 658 EALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVINS 695

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
           similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/697 (46%), Positives = 434/697 (62%), Gaps = 53/697 (7%)

Query: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74
           M++ F+GFVPIH++FY++FHPT+GT+VR+++PP +LE + I+FD IKNY+IPKPQLC+KL
Sbjct: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60

Query: 75  LTLKYKGYRIVCYPVTVNSPYYARXXXXXXXXXXXPYDCETSSYEPAIARLGKMFRVLEE 134
           LT KY  YR+VCYPV +N+ YYAR           PYD  TS YEPAI RLGKMFRVLEE
Sbjct: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120

Query: 135 QNQILSKAENDPIYFDFKLAD------NTTEQDGKLNAEKSFKGLTKSQG-MALAKYNEI 187
           Q+Q+LSK E DPIY+  K  D      N+ E + K N +     + +     A  KY+EI
Sbjct: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEKYHEI 180

Query: 188 MKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSCISIEDV 247
           MK +   +   S++DL+ ++++DLNNYSECLIP+D GNA+DIK+FPL  PPNSC S+EDV
Sbjct: 181 MKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFSVEDV 240

Query: 248 PISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYNCVI 307
           PI+ +NL   +DVNWDPTM+KIVPYI+G+NSI+KI+K SDSDV LV+ECVKHL+YY+CV+
Sbjct: 241 PIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCVV 300

Query: 308 LADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFERLRKFDLDDMDQ 367
           L D+FQFSNIYAPTS + +FLTDP++A ECQ +V  +  S L ++PFE        + + 
Sbjct: 301 LVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFE-----GRPNANH 355

Query: 368 SKNQEXXXXXXXXXXXXXXXXXXPFFYSAPRNPYXXXXXXXXXXXXXXXNVTHD------ 421
           S+N                    P  +S+  N                 ++TH       
Sbjct: 356 SRNPTASTITFGTLKRTIYTNPRPESFSS--NTEFAQKPNANTSLPSEPSITHSSKNSEF 413

Query: 422 --------LARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIK 473
                   L R LPT++CLFDLYR+LSQG T+++WY +N++ I+KN IDVRRFITFGV +
Sbjct: 414 NHENNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFR 473

Query: 474 GLIYRCFSFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDM--KLG 531
            LIYRC+S+PV K +   D+  +   A   N          N      VFST+D+    G
Sbjct: 474 KLIYRCYSYPVAKSIGTLDMLKRFDYASLPNNFMSPKNNNSN-----NVFSTADICVDFG 528

Query: 532 EGSKMHQNFSV---DIADEVLRNVYKKLSNTNEPGSRDDYPLSRIYREESHVSLSALSGD 588
           E S+  +   V   D ADEVLR+ YKKLS  NE   R   PL +I R +  +SL   +  
Sbjct: 529 EPSQFRKKPLVPNTDAADEVLRDAYKKLS-LNE---RLPNPLDQITRSKK-LSLENDASA 583

Query: 589 NVSHPKKPERVS---KVAFDMNKDDPVPYSLSQQKGKNKEREAAKLD-RAKNNQKIILLE 644
           NV + K     S   KV FDM KD      LS +  + +++ AA  + + K  Q+ +LL+
Sbjct: 584 NVDNRKLSSSTSGTAKVLFDM-KD-----RLSNKDFEYRDQNAASTELKRKRQQQFLLLK 637

Query: 645 SIAAADCLDKICVKLEKPRHEVEELLHELGDYKIINS 681
           SI   D  DKI +KLE  + EVEELL   G+Y IINS
Sbjct: 638 SIKNVDSFDKIAIKLEINKQEVEELLKATGEYNIINS 674

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/731 (45%), Positives = 440/731 (60%), Gaps = 87/731 (11%)

Query: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74
           M D FEGFVPIHT+FY++FHPT+GT+VRYE+PPGNL+  NINFD IKNYIIPKPQLCHKL
Sbjct: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60

Query: 75  LTLKYKGYRIVCYPVTVNSPYYARXXXXXXXXXXXPYDCETSSYEPAIARLGKMFRVLEE 134
           LTLKY  YR+V YPVT+NS  YAR           P +CETS YEP IARLGKMFRVLEE
Sbjct: 61  LTLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEE 120

Query: 135 QNQILSKAENDPIYFDFKLADNTTEQDGKLNAEK--SFKGLTKSQ--------GMALAKY 184
           QNQ+LS+AEND +YFD   +  ++EQD  ++ +K  S  G ++ +         ++L++Y
Sbjct: 121 QNQLLSRAENDSVYFDNSHSLLSSEQDSIMHQDKNTSILGFSRKRFSFSKRPTDLSLSEY 180

Query: 185 NEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSCISI 244
                D ES  S+FSVQDL+MRIFQDLNNYSECLIPIDEGN+VDIKIFP   PP+  IS 
Sbjct: 181 ----PDNES-GSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPSISISY 235

Query: 245 EDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYN 304
           EDVP++ V+L  ++DVNWDPTMLKIVP+ID +NSIS+IA LS+SDV  V+EC++HLVYY 
Sbjct: 236 EDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYYQ 295

Query: 305 CVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFERLRKFDLDD 364
            VIL+DIFQF+NIYAPTS +R FLTD  LA++CQ++V L  +S+  ++P E+    DLD+
Sbjct: 296 LVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSINTDLDE 355

Query: 365 MDQSKNQEXXXXXXXXXXXXXXXXXXPFFYSAPRNPYXXXXXXXXXXXXXXXNVTHDLAR 424
                N                    P +Y  PRN                 N       
Sbjct: 356 Y---SNSGSAIYPNNEILENDDRLRWPMYY-KPRNSQSSLSSGISSGNERTSN------- 404

Query: 425 HLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCFSFPV 484
           +LPTK+CLFDLYR+LSQG  + +WYN +Y  I  N ID+RRFITFG+++GL+YRC++ P+
Sbjct: 405 YLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRGLLYRCYAIPI 464

Query: 485 MKKMSIFDLAHKLHTAGNLNQVTKKG---KGQKNLAESKYVFSTSDMKL----------- 530
           MK   IFD+   L T+ + N     G    G  + A  +++ S +D  +           
Sbjct: 465 MKNAGIFDILSSLTTSQSSNPYHSNGDDKNGTASTANIRFLNSITDSDIHDLKDDEINNS 524

Query: 531 ---------------------GEGSKMHQNFSVD------------------IADEVLRN 551
                                 E + +  N S D                  IAD+VL +
Sbjct: 525 GSCGIKPSFDVNKLFINGDDHSETTTVKHNSSRDASEHLFSPPPKRQILNSGIADKVLSD 584

Query: 552 VYKKLSNTNEPGSRDDYPLSRIYREESHVSLSALSGDNVSHPKKPERVSKVAFDMNKD-D 610
           +++KL+        DD P S I + +        +G N+         +KV+F++++D D
Sbjct: 585 IHRKLAKF------DDTPRSPIVKRKEDTFRDFSNGSNIVGYGSSNTGNKVSFNLSRDSD 638

Query: 611 PVPYSLSQQKG-KNKEREAAKLDRAKNNQKIILLESIAAADCLDKICVKLEKPRHEVEEL 669
               +L       +  ++     + KN+ + +LLES+  AD +DKIC+KL+KPR EVEEL
Sbjct: 639 TTQNNLDHMNPILDSSKDIIAQQQEKNHIRRLLLESLREADNMDKICIKLQKPRKEVEEL 698

Query: 670 LHELGDYKIIN 680
           L E+GDY IIN
Sbjct: 699 LSEIGDYVIIN 709

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/689 (42%), Positives = 410/689 (59%), Gaps = 36/689 (5%)

Query: 14  RMTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHK 73
           +M ++F+GFVPIH +FYA+FHPT+GT+VR+++P  +LE + I FD IKNY+IPK QLC+K
Sbjct: 7   KMPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNK 66

Query: 74  LLTLKYKGYRIVCYPVTVNSPYYARXXXXXXXXXXXPYDCETSSYEPAIARLGKMFRVLE 133
           L+T K+  YR+VCYPV + +PYYAR           PYD  TS YEPAIARL KM RVLE
Sbjct: 67  LVTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLE 126

Query: 134 EQNQILSKAENDPIYFDFKL-----ADNTTEQDGKLNAEKSFKGLTKSQGMALAKYNEIM 188
           EQ+Q+LSK E DP+Y+  K      A+  TE+        +    +++Q  A  KY+EIM
Sbjct: 127 EQSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATTKYHEIM 186

Query: 189 KDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSCISIEDVP 248
           K + S++ +  ++DL+ ++++DLNNYSECLIP+D GNA+DIK+FPL TPPNSC+S EDVP
Sbjct: 187 KHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCLSFEDVP 246

Query: 249 ISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYNCVIL 308
           I+ VNL  ++DVNWDPTMLKIVP+I+G+NSI+KI+K SDS V LV+EC+KHLVYY+CV L
Sbjct: 247 IAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCVAL 306

Query: 309 ADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFERLRKFDLDDMDQS 368
            D+FQFSNIYAPT+L+R FL D  L  ECQ +V  +    +  +PFE        +   S
Sbjct: 307 VDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFE-----SRPNGGHS 361

Query: 369 KNQEXXXXXXXXXXXXXXXXXXPFFYSAPRNPYXXXXXXXXXXXXXXX----------NV 418
           +NQ                     F S                               N+
Sbjct: 362 RNQTASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYNRSRNL 421

Query: 419 THDLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYR 478
             +  R LPT+  LFDLYR+L+QG T++EWY  NY  I++N IDVRR I FGV   LIYR
Sbjct: 422 ESNCKRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHRLIYR 481

Query: 479 CFSFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMKLG-EGSKMH 537
           C+S+PV K +   +L  +       +     G    N      VFSTSD+++  +GS   
Sbjct: 482 CYSYPVAKSIGTLELLKRFDYVSTTDNFIPTGTSAGN-----NVFSTSDIRVDFDGSSRS 536

Query: 538 QNF-----SVDIADEVLRNVYKKLSNTNEPGSRDDYPLSRIYREESHVSLSALSGDNVSH 592
           +N      S D+A+EVLR  Y+KLS  +      D P+++ Y+  S  + +A+ G +   
Sbjct: 537 RNIPPFLNSSDVAEEVLRETYQKLSIKDILNDSID-PIAKGYQAPSD-NEAAMKGTSRKQ 594

Query: 593 PKKPERVSKVAFDMNKDDPVPYSLSQQKGKNKEREAAKLDRAKNNQKIILLESIAAADCL 652
                  +++ FD+        S   +  + +  +   L + K  Q+ +LL+S+ + D  
Sbjct: 595 SMSTLNTTRITFDIRNRH---VSKDNEHREQQNEDIPLLLKKKRLQEFLLLQSVKSVDSF 651

Query: 653 DKICVKLEKPRHEVEELLHELGDYKIINS 681
           DKI V+LE  +HEVE LL   G+Y I+NS
Sbjct: 652 DKIAVRLEMNKHEVERLLKGTGEYNIVNS 680

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 660

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/695 (45%), Positives = 428/695 (61%), Gaps = 63/695 (9%)

Query: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74
           MT  F+GFVPIHT+FY +FHPT+G++VR+++PP +LE   I+FD IKNYIIPKPQLC+KL
Sbjct: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60

Query: 75  LTLKYKGYRIVCYPVTVNSPYYARXXXXXXXXXXXPYDCETSSYEPAIARLGKMFRVLEE 134
           LT KY  YRIVCYPV VN+ YYAR           PYDC TS YEPAIARLGKMF+VLEE
Sbjct: 61  LTFKYGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEE 120

Query: 135 QNQILSKAENDPIYFDFK-----LADNTTEQDGKLNAEKSFKGLTKSQGMALAKYNEIMK 189
           Q+QILSK+E +P+YF  K      AD +TE      +E +     KS G    KY EI+K
Sbjct: 121 QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHTD---IKSTGDDGEKYLEIIK 177

Query: 190 DLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSCISIEDVPI 249
           +L   +    ++DL+M++F DLNNYSECLIPIDEGN++DIK+FP++TPP+S IS+EDVPI
Sbjct: 178 ELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNISVEDVPI 237

Query: 250 STVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYNCVILA 309
           + VNL  IIDVNWDPTM+KIVPYI+G+NS+++IA  + SDV LV EC+KHL+YYNCVIL+
Sbjct: 238 AVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCVILS 297

Query: 310 DIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHS-SLSEMPFERL--------RKF 360
           DIFQFSNIYAPTS I  FLT+P +A  CQ  V   G S   S +PFE          RK 
Sbjct: 298 DIFQFSNIYAPTSEIHNFLTNPAVAKACQLFV--QGDSLKQSLLPFEGRPNNIYPTGRKQ 355

Query: 361 DLDDMDQSKNQEXXXXXXXXXXXXXXXXXXPFFYSAPRNPYXXXXXXXXXXXXXXXNVTH 420
                  S+ ++                   +  S+  + Y               N   
Sbjct: 356 ASTSTVHSRRRDSNDTATTGSTSSVRDTHRNYLSSSSTSSYFRAHASENTSLATGEN--- 412

Query: 421 DLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCF 480
            + R LPT++CLFDLY++LSQG TV++WY  N++ I+ N IDVR+ I FG+ + LIYR  
Sbjct: 413 QMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIYRVN 472

Query: 481 SFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMKLGEG-SKMHQN 539
           S+P++K +  +D+   L        V+K+ K       SK +FS +D+K+ +   + +Q+
Sbjct: 473 SYPIVKNVGTWDILKSL--------VSKEPKTHYGSGSSKNIFSAADIKVVDTKEEGNQS 524

Query: 540 FSVDIADEVLRNVYKKLS------NTNEPGSR--DDYPLSRIYREESHVSLSALSGDNVS 591
             +D ADE+L+++Y+KLS      NT    +R  DD P +  + E +    S+ S     
Sbjct: 525 DKLDAADELLKSLYQKLSLKQDVPNTMSKFARYYDDSPSNNAFTESTSRKSSSGSH---- 580

Query: 592 HPKKPERVSKVAFDMNKDDPVPYSLSQQKGKNK-----EREAAKLDRAKNNQKIILLESI 646
                    KV+FD         +  QQK   +     + E  ++ + K  +++ILLES+
Sbjct: 581 --------QKVSFDFG-------TAGQQKTVTEVPDLGDGEKVEVWKKKKEEELILLESL 625

Query: 647 AAADCLDKICVKLEKPRHEVEELLHELGDYKIINS 681
           + A+  DK+C KL+K RHEVE LL +LG Y I+NS
Sbjct: 626 SNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVNS 660

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
           {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062w nitrogen permease regulator
          Length = 646

 Score =  524 bits (1349), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 293/676 (43%), Positives = 402/676 (59%), Gaps = 41/676 (6%)

Query: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74
           M  QFEGFV IH++FY+ FHPT+G++V++++PP +LE + INFD+IKNY+IPK  LCH+L
Sbjct: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60

Query: 75  LTLKYKGYRIVCYPVTVNSPYYARXXXXXXXXXXXPYDCETSSYEPAIARLGKMFRVLEE 134
           +T KY  YRI CYPVTVNS  YAR           P++CETS YEPAI RLGKMFRVLE 
Sbjct: 61  ITFKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEI 120

Query: 135 QNQILSKAENDPIYFDFKLADNTTEQDGK----LNAEKSFKGLTKSQGMALAKYNEIMKD 190
           QNQILSK+END I F+ K AD     D      +  +     +T  Q     + N I+ +
Sbjct: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISSIMTTQQKDKYERLNNIISN 180

Query: 191 LESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSCISIEDVPIS 250
           ++ + S+F++ DL+MR++QDLN YSECLIPID+GNAVDIK+FPL TPP   ISIE VPIS
Sbjct: 181 IKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYISIEHVPIS 240

Query: 251 TVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYNCVILAD 310
            VNL  I+DVNWDP ML I+PYI+G+N+I +I++LS ++ SLV+EC++HLVYY C++L D
Sbjct: 241 LVNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSHNEESLVIECIRHLVYYRCIVLTD 300

Query: 311 IFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEM---PFERLRKFDLDDMDQ 367
           IF+FSN+YAPTS +R FL DP +A+ECQS+V L  +S ++++   P          D+  
Sbjct: 301 IFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSAFNGDIGS 360

Query: 368 SKNQEXXXXXXXXXXXXXXXXXXPFFYSAPRNPYXXXXXXXXXXXXXXXNVTHDLARHLP 427
             N                         +  N Y               N   ++ +HLP
Sbjct: 361 RNNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNFYKNKKQSESSISTGNSNNGQNIHKHLP 420

Query: 428 TKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCFSFPVMKK 487
           T++ LFDLYR+LSQG+T++EWY  N++ I+ N IDVRRFITFGV++ +IYRC ++ V+  
Sbjct: 421 TRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRIIYRCETYSVINS 480

Query: 488 MSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMKLGEGSKMHQNFSVDIADE 547
                   KL+   N   +    K Q N  +S                         ADE
Sbjct: 481 TDHLQNLWKLNELENPISMENISKLQSNHIDSL-----------------------AADE 517

Query: 548 VLRNVYKKLS-NTNEPGSRDDYPLSRIYREESHVSLSALSGD-NVSHPKKPERVSKVAFD 605
            L N YKKLS      G+   +  S      S  SL+  + +   S  K+ +R+SKV+F+
Sbjct: 518 ALMNAYKKLSLKVPSKGALKSHNTS-----HSSFSLTPTAPEMENSQAKRNKRLSKVSFE 572

Query: 606 MNKDDPVPYSL-SQQKGKNKEREAAKLDRAKNNQKIILLESIAAADCLDKICVKLEKPRH 664
              +D   +   S  K   +E    KL +    Q+ I+L+++A A+ LDKICV LE PR 
Sbjct: 573 ALPEDRNGFRWGSNIKTPIQETTWKKLSKM---QRRIMLKALADAETLDKICVLLEMPRQ 629

Query: 665 EVEELLHELGDYKIIN 680
            V  +LHELG+ K+IN
Sbjct: 630 NVVNILHELGELKLIN 645

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score =  522 bits (1344), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 306/711 (43%), Positives = 408/711 (57%), Gaps = 103/711 (14%)

Query: 17  DQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKLLT 76
           + FEGF+PIHT+FY++FHPT+GT+VRYE+PP NL  ++I+FDAIKNYIIPK QLC+KLLT
Sbjct: 11  NHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLT 70

Query: 77  LKYKGYRIVCYPVTVNSPYYARXXXXXXXXXXXPYDCETSSYEPAIARLGKMFRVLEEQN 136
            KY  YRIV YP+T+NS +YAR           PYDCETS YEPAIARLGKMF+VLEEQN
Sbjct: 71  FKYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLGKMFKVLEEQN 130

Query: 137 QILSKAENDPIYF--DFK------LADNTTEQDGKLNAEKSFKGLTK-SQGMALAKYNEI 187
           QILSKAENDPIYF  D+       +     + DGK N +   K  T  S     +  N I
Sbjct: 131 QILSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRNKKLMKKENTIFSTRQQRSNSNRI 190

Query: 188 MKDLE--------------------------SEKSDFSVQDLVMRIFQDLNNYSECLIPI 221
           +++                            +  S  SVQDL+MRI+QDLNNYSECLIPI
Sbjct: 191 LEENSNSNSNSNSNSNGNENDNNYNTIEQYLNNNSRISVQDLIMRIYQDLNNYSECLIPI 250

Query: 222 DEGNAVDIKIFP-LKTPPNSCISIEDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSIS 280
           D+GN VDIKIFP LK PP + +SIEDVP+S V+L  I DVNWDPTMLK++P+I+G+N IS
Sbjct: 251 DDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFINGINDIS 310

Query: 281 KIAKLSDSDVSLVLECVKHLVYYNCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSH 340
           KI+KLS+S   LV+EC+KHL+YYNCVI+ DIFQFSN Y+ TSLI  FLTDP +A+ CQ++
Sbjct: 311 KISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNMATLCQNY 370

Query: 341 VTLAGHSSLSEMPFERLRKFDLDDMDQSKNQEXXXXXXXXXXXXXXXXXXPFFYSAPRNP 400
           V L   S L+ +PF    +  +      ++                       +SA    
Sbjct: 371 VVLPLGSKLTRLPFHIETETSVQSSSAYRHHHNRHEKTPSFGSSITSNNGRSSFSADDRK 430

Query: 401 YXXXXXXXXXXXXXXXNVTHDLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKND 460
                            ++     HLPTK  LF+LYR+L+Q   ++ WY LNY TI +N+
Sbjct: 431 QSETSLNSSNDPSNSNLIS---TAHLPTKMSLFELYRSLNQRTDLKNWYKLNYTTIIENN 487

Query: 461 IDVRRFITFGVIKGLIYRCFSFPVM-----------KKMSIFDLAHKLHTAGNLNQVTKK 509
           ID+R+FI FG+IKGLIYRC S+P++           K  S F  +  + ++ +  Q T+K
Sbjct: 488 IDIRKFIKFGIIKGLIYRCHSYPIVITPVVSAPESAKSTSPFVSSSGISSSVDSKQHTQK 547

Query: 510 GKGQKNLAESKYVFSTSDMKLGEGSKMHQNFSVDIADEVLRNVYKKLSNTNEPGSRDDYP 569
           G   +        F       G GS +  +   D  D+++++ Y+KL    E G      
Sbjct: 548 GPISR--------FP------GLGSHVPSSGVRDTRDKLMKSFYEKL----EKG------ 583

Query: 570 LSRIYREESHVSLSALSGDNVSHPKKPERVSKVAFDMNKDDPVPYSLSQQKGKNKEREAA 629
                +  S VS S                 K+AF  +++D   +S +     +K +   
Sbjct: 584 -----KNHSKVSFS----------------DKIAFQNDEND---HSATSSDNDDKSKSQL 619

Query: 630 KLDRAKNNQKIILLESIAAADCLDKICVKLEKPRHEVEELLHELGDYKIIN 680
            L      Q+ ILL+SI+  D +DKICVKL +PR ++EE L E GDYK+IN
Sbjct: 620 TL-----KQRNILLDSISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVIN 665

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score =  505 bits (1301), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 288/674 (42%), Positives = 382/674 (56%), Gaps = 89/674 (13%)

Query: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74
           M  +FEGFVPIHTLFY +FHPT+G++V Y++PPGNL++ +INFDAIKNYIIPKPQLCH+L
Sbjct: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60

Query: 75  LTLKYKGYRIVCYPVTVNSPYYARXXXXXXXXXXXPYDCETSSYEPAIARLGKMFRVLEE 134
           LT+KY  YRIV YPV V S  YAR           PY+C TS YEPAI RLGKMFRVLEE
Sbjct: 61  LTMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEE 120

Query: 135 QNQILSKAENDPIYF--DFKLADNTTEQDGKLNAEKSFKGLTKSQGMALAKYNEIMKDLE 192
           Q+Q+LS+AE D   F  D    DN + ++    A  +   ++K++  +        K  E
Sbjct: 121 QSQVLSRAERDDSLFKGDKLPFDNNSAKN---QAPLTHALISKTKSFSPD------KKTE 171

Query: 193 SEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSC-ISIEDVPIST 251
            +    SVQDL+MRI+QDLNNYSECLIPIDEGNA+DIKIFPL  PP S  +SIEDVP+  
Sbjct: 172 GDIHLISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIEDVPMLV 231

Query: 252 VNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYNCVILADI 311
           V LK IID+NWDPTM+ I+P+I+G+NSI  IA+LSDSD  LV+EC+KHL+YY CVI+ DI
Sbjct: 232 VKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKCVIITDI 291

Query: 312 FQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFERLRKFDLDDMDQSKNQ 371
           FQFSNIYAP+SLI +FLTDPT+A +CQ +VTL   S L  MP +       ++  +  N 
Sbjct: 292 FQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTSVPGSRNNKHKKSNS 351

Query: 372 EXXXXXXXXXXXXXXXXXXPFFYSAPRNPYXXXXXXXXXXXXXXXNVTHDLARHLPTKAC 431
                                FYS                     +  H +  + PT+  
Sbjct: 352 LSSTGVLSWQSNSQYSNNSSEFYSMSNKKRSESSLSSEGTPGAGRSDDHTI--YYPTRMV 409

Query: 432 LFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCFSFPVMKKMSIF 491
           LFDLYR+LSQG+T+ +WY  N+ TI+ N IDVR+FI FG IK +IYR  S+PV++K    
Sbjct: 410 LFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYPVLEKRR-- 467

Query: 492 DLAHKLHTAGNLNQVTKKGKGQKNLAE-----SKYVFSTSDMKLGEGSKMHQNFSVDIAD 546
                       N +  K  G+  +AE         FSTSD+K  +G            D
Sbjct: 468 ------------NSIIAKQMGKSKMAEKAPHSKNAFFSTSDIKFDDG------------D 503

Query: 547 EVLRNVYKKLSNTNEPGSRDDYPLSRIYREESHVSLSALSGDNVSHPKKPERVSKVAFDM 606
            +  ++Y + S  +    R++       RE    S  A+ G N                 
Sbjct: 504 RLFNSLYARFSKVSFEKRREN------ARERK--SFDAVGGTN----------------- 538

Query: 607 NKDDPVPYSLSQQKGKNKEREAAKLDRAKNNQKIILLESIAAADCLDKICVKLEKPRHEV 666
                         G +KE            +K+ LL ++   +  DKICV+L + R E+
Sbjct: 539 --------------GADKETMI-----LTKEEKLQLLGALDNLESFDKICVQLGRSRVEI 579

Query: 667 EELLHELGDYKIIN 680
             L+ ++G+Y++IN
Sbjct: 580 ANLIADIGEYRVIN 593

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
           Anc_6.17 YEL062W
          Length = 540

 Score =  469 bits (1208), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 270/668 (40%), Positives = 366/668 (54%), Gaps = 129/668 (19%)

Query: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74
           M  QFEGF PIHT+F+++FHPT+G++V Y++PP NL+  NINFD+IKN++IPKPQLCH+L
Sbjct: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60

Query: 75  LTLKYKGYRIVCYPVTVNSPYYARXXXXXXXXXXXPYDCETSSYEPAIARLGKMFRVLEE 134
           LTL+YK YR+V YPV V+S  YAR            YDC+T  YEPAI RLGKMF+ LEE
Sbjct: 61  LTLEYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEE 120

Query: 135 QNQILSKAENDPIYFDFKLADNTTEQDGKLNAEKSFKGLTKSQGMALAKYNEIMKDLESE 194
           Q+QILSK++    +F          +DG                          +D++  
Sbjct: 121 QSQILSKSQRTSAFF----------KDG--------------------------EDVDFV 144

Query: 195 KSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSC-ISIEDVPISTVN 253
            + FS+QDL+MR++QDLNNYSECLIPIDEGN ++IKIFP+  PP S  ISIEDVP+S VN
Sbjct: 145 DTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVPLSIVN 204

Query: 254 LKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYNCVILADIFQ 313
           L  I+D+NWDPTML I+P+IDG+NSI+ I+ LSDSD +LV+EC+KHL+YYNCVI+ DIFQ
Sbjct: 205 LDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVIITDIFQ 264

Query: 314 FSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFERLRKFDLDDMDQSKNQEX 373
           FSNIYAP+SLI  FL DP +A  CQS+V L   S ++++P    +    D+++ S   + 
Sbjct: 265 FSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQD---DEINNSDMTQK 321

Query: 374 XXXXXXXXXXXXXXXXXPFFYSAPRNPYXXXXXXXXXXXXXXXNVTHDLARHLPTKACLF 433
                             +   +    +               N      + LP+K  LF
Sbjct: 322 ALSSSRSSFSSYFSHKSAYARVSETAHHHQSTSTLSSSEGQQDNPRQ--GQVLPSKCTLF 379

Query: 434 DLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCFSFPVMKKMSIFDL 493
           DLYR+L+ G TV  WY  N+ TIK+N IDVR+FI FGVI  +IYR   +P+M+       
Sbjct: 380 DLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYPIME------- 432

Query: 494 AHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMKLGEGSKMHQNFSVDIADEVLRNVY 553
            HK          T K     +    K V STSD+K             D+ D +L ++Y
Sbjct: 433 -HK----------TFKSPLLSDRQNDKIVLSTSDIKF------------DVGDRILNSIY 469

Query: 554 KKLSNTNEPGSRDDYPLSRIYREESHVSLSALSGDNVSHPKKPERVSKVAFDMNKDDPVP 613
            KL                                           SKV FD +K     
Sbjct: 470 NKL-------------------------------------------SKVTFDRDK----- 481

Query: 614 YSLSQQKGKNKEREAAKLDRAKNNQKIILLESIAAADCLDKICVKLEKPRHEVEELLHEL 673
                 K ++K   +  L  ++ N   IL  ++   +  D+IC KL K ++EVE ++ E+
Sbjct: 482 ------KLESKIGNSRNLGESEKN---ILFNALERHESFDRICSKLGKSKNEVESIISEI 532

Query: 674 GDYKIINS 681
           G+Y  INS
Sbjct: 533 GEYMTINS 540

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score =  469 bits (1206), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 225/378 (59%), Positives = 276/378 (73%), Gaps = 38/378 (10%)

Query: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74
           M   F+GFVPIHT+FY+VFHPT+G++++YE+PP NL+ + INF+ IKNYIIPKP LCHKL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60

Query: 75  LTLKYKGYRIVCYPVTVNSPYYARXXXXXXXXXXXPYDCETSSYEPAIARLGKMFRVLEE 134
           +T KY  YRIVCYPVT+NSP YAR           PYDCETS YEPAI RLGKMF+VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 135 QNQILSKAENDPIYFDFKLADN-------------------------TTEQDGKLNAEKS 169
           QNQ+LSK+E DP++FD K  +N                         T+++D K      
Sbjct: 121 QNQLLSKSERDPVFFDLKAIENSLLTPSTAGPPATSNPSSNTTPTHPTSDKDAKDLRSNR 180

Query: 170 FKGLTKSQGMALAKYNEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDI 229
           F G          KYN+I+KDL   +S FS+QDL+MRIFQDLNNYSECLIPID+GNAVDI
Sbjct: 181 FNG---------EKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDI 231

Query: 230 KIFPLKTPPNSCISIEDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSD 289
           KIFPL  PP +C+S+EDVP+S+VNLK IIDVNWDPTM+ IVPYIDGLNSI+KI+K S SD
Sbjct: 232 KIFPLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSD 291

Query: 290 VSLVLECVKHLVYYNCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSL 349
            SLV+EC++HL+YY CV L+DIFQFSNIYAP+SLIR FLTDP +A++CQS+VT    S L
Sbjct: 292 PSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKL 351

Query: 350 SEMPFERLRKFDLDDMDQ 367
           S +P  +    + D +DQ
Sbjct: 352 SNLPLNK----NFDSVDQ 365

 Score =  100 bits (249), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 41/70 (58%), Positives = 58/70 (82%), Gaps = 3/70 (4%)

Query: 419 THDLARH---LPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGL 475
           TH +++    LPT++CLFDLYR+LSQG T++ WY L + T+K+N+ID+RRFITFG+ + +
Sbjct: 427 THAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITFGLERSI 486

Query: 476 IYRCFSFPVM 485
           IYRC+SFPVM
Sbjct: 487 IYRCYSFPVM 496

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 67/124 (54%), Gaps = 17/124 (13%)

Query: 559 TNEPGSRDDYPLSRIYREESHVSLS-ALSGDNVSHPKKPERVSKVAFDMNKDDPVPYSLS 617
           T EP + D+    R Y     V+ S + +  NV    K ER SKV+F+M + +      S
Sbjct: 512 TKEPSNEDNSLKKRDYNHSLSVTGSKSTTQTNV----KSERPSKVSFEMQRAN------S 561

Query: 618 QQKGKNKEREAAKLDRAKNNQKIILLESIAAADCLDKICVKLEKPRHEVEELLHELGDYK 677
              GKNK      + +  + +K IL +SI +A+  DKICV L K + EVE  L ELG++K
Sbjct: 562 LATGKNK------IPKLSDEEKKILEKSIRSAENFDKICVLLGKSKQEVENYLSELGEFK 615

Query: 678 IINS 681
           +INS
Sbjct: 616 VINS 619

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
           SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
           Npr2/3 complex mediates downregulation of TORC1 activity
           upon amino acid limitation; SEA complex is a
           coatomer-related complex that associates dynamically
           with the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
           required for non-nitrogen-starvation (NNS)-induced
           autophagy; Iml1p interacts primarily with phosphorylated
           Npr2p; homolog of human NPRL2; target of Grr1p; required
           for growth on urea and proline
          Length = 615

 Score =  468 bits (1204), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 216/353 (61%), Positives = 272/353 (77%), Gaps = 11/353 (3%)

Query: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74
           M   F+GFVPIHT+FY+VFHPT+G++++YE+PP NL+ + INF+  KNYIIPKP LCHKL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60

Query: 75  LTLKYKGYRIVCYPVTVNSPYYARXXXXXXXXXXXPYDCETSSYEPAIARLGKMFRVLEE 134
           +T KY  YRIVCYPVT+NSP YAR           PYDCETS YEPAI RLGKMF+VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 135 QNQILSKAENDPIYFDFKLADNTTEQDGKLNAEKSFKGLTKS-----------QGMALAK 183
           QNQ+LSK+E DP++FD K+ +N+T          +    + +           + M  ++
Sbjct: 121 QNQLLSKSERDPVFFDLKVLENSTTTPSTAGPSSTPNPSSNTTPTHPTSEKDTKDMRSSR 180

Query: 184 YNEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSCIS 243
           Y++++KDL   +S FS+QDL+MRIFQDLNNYSECLIPIDEGNAVDIKIFPL  PP +C+S
Sbjct: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 244 IEDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYY 303
           +EDVP+S+VNLK IIDVNWDPTM+ IVPYIDGLNSI+KI+KLS+SD  LV+EC++HL+YY
Sbjct: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300

Query: 304 NCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFER 356
            CV L+DIFQFSNIYAP+SLIR FLTDP +AS+CQS+VT    S +S +P  +
Sbjct: 301 KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNK 353

 Score =  124 bits (312), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 93/265 (35%), Positives = 135/265 (50%), Gaps = 72/265 (27%)

Query: 417 NVTHDLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLI 476
           +V ++  R LPT++CLFDLYR+LSQG T++ WY   Y  +K+N+ID+RRFITFG+ K +I
Sbjct: 423 HVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKRII 482

Query: 477 YRCFSFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMKLGEGSKM 536
           YRC+SFPVM                 +N  +++ K    +     V   ++ KL E    
Sbjct: 483 YRCYSFPVM-----------------INAGSREPKEMTPIITKDLV---NNDKLLEK--- 519

Query: 537 HQNFSVDIADEVLRNVYKKLSNTNEPGSRDDYPLSRIYREESHVSLSALSGDNVSHPKKP 596
                        RN    LS T   GSR+                +A SG+    P++P
Sbjct: 520 -------------RNHNHLLSAT---GSRN----------------TAQSGN--LKPERP 545

Query: 597 ERVSKVAFDMNKDDPVPYSLSQQKGKNKEREAAKLDRAKNNQKIILLESIAAADCLDKIC 656
              SKV+F+M +        S   GK      + + +  + ++ IL ESI  A+  DKIC
Sbjct: 546 ---SKVSFEMQRVS------SLATGK------STMPKLSDEEEGILEESIRNAETFDKIC 590

Query: 657 VKLEKPRHEVEELLHELGDYKIINS 681
           V L KP+ EVE  L+ELG++K+INS
Sbjct: 591 VLLSKPKLEVESYLNELGEFKVINS 615

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score =  466 bits (1200), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 220/364 (60%), Positives = 276/364 (75%), Gaps = 15/364 (4%)

Query: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74
           M   F+GFVPIHT+FY+VFHPT+G++++YE+PP NL+ + INF+ IKNYIIPKP LCHKL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60

Query: 75  LTLKYKGYRIVCYPVTVNSPYYARXXXXXXXXXXXPYDCETSSYEPAIARLGKMFRVLEE 134
           +T KY  YRIVCYPVT+NSP YAR           PYDCETS YEPAI RLGKMF+VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 135 QNQILSKAENDPIYFDFKLADNTT----------EQDGKLNAEKSFKGLTK-SQGMALAK 183
           QNQ+LSK+E D ++FD K  +N+T            +   N   ++    K ++ +  ++
Sbjct: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAPTTSNPSSNTTPTYPTSDKDAKDLRSSR 180

Query: 184 YNEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSCIS 243
           YN++ KDL   +S FS+QDL+MRIFQDLNNYSECLIPIDEGNAVDIKIFPL  PP +C+S
Sbjct: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 244 IEDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYY 303
           +EDVP+S+VNLK IIDVNWDPTM+ IVPYIDGLNSI+KI+KLS SD SLV+EC++HL+YY
Sbjct: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 300

Query: 304 NCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFERLRKFDLD 363
            CV L+DIFQFSNIYAP+SLIR FLTD  +AS+CQS+V     S +S +P  +    +LD
Sbjct: 301 KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSK----NLD 356

Query: 364 DMDQ 367
             D+
Sbjct: 357 SADR 360

 Score = 96.3 bits (238), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 39/62 (62%), Positives = 52/62 (83%)

Query: 424 RHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCFSFP 483
           R LPT++CLFDLYR+LSQG T++ WY   +  +K+N+IDVRRFITFG+ + +IYRC+SFP
Sbjct: 430 RFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLERRIIYRCYSFP 489

Query: 484 VM 485
           VM
Sbjct: 490 VM 491

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 55/109 (50%), Gaps = 14/109 (12%)

Query: 575 REESHVSLSALSGDNVSHPK--KPERVSKVAFDMNKDDPVPYSLSQQKGKNKEREAAKLD 632
           ++    S S +   N   P   K ER SKV+F+M            Q+  +     A + 
Sbjct: 519 KKNQDASFSVVGSKNSGQPNNVKSERPSKVSFEM------------QRAGSLATGEATIP 566

Query: 633 RAKNNQKIILLESIAAADCLDKICVKLEKPRHEVEELLHELGDYKIINS 681
           +  + ++ IL  SI +A+  D ICV L K + EVE  L+ELG++K+INS
Sbjct: 567 KLSDEEERILENSIRSAESFDNICVLLSKSKLEVENYLNELGEFKVINS 615

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score =  465 bits (1196), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 220/361 (60%), Positives = 277/361 (76%), Gaps = 12/361 (3%)

Query: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74
           M   F+GFVPIHT+FY+VFHPT+G++++YE+PP NL+ + INF+ IKNYIIPKP LCHKL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60

Query: 75  LTLKYKGYRIVCYPVTVNSPYYARXXXXXXXXXXXPYDCETSSYEPAIARLGKMFRVLEE 134
           +T KY  YRIVCYPVT+NSP YAR           PYDCETS YEPAI RLGKMF+VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 135 QNQILSKAENDPIYFDFKLADNTT----------EQDGKLNAEKSFKGLTK-SQGMALAK 183
           QNQ+LSK+E DP++FD K  +N+T            +   N   +     K ++ +  ++
Sbjct: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACPPATSNTSSNTTPTHPTSDKDAKDLRNSR 180

Query: 184 YNEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSCIS 243
           YN+++KD E  +S FS+QDL+MRIFQDLNNYSECLIPIDEGNAVDIKIFPL  PP +C+S
Sbjct: 181 YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 244 IEDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYY 303
           +EDVP+S+VNL+ IIDVNWDPTM+ IVPYIDGLNSI+KI+KLS+SD SLV+EC++HL+YY
Sbjct: 241 LEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYY 300

Query: 304 NCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFER-LRKFDL 362
            CV L+DIFQFSNIYAP+S IR FLTDP +A++CQ +VT    S +S +P  + L   DL
Sbjct: 301 KCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNLTSGDL 360

Query: 363 D 363
           D
Sbjct: 361 D 361

 Score =  119 bits (298), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/265 (31%), Positives = 126/265 (47%), Gaps = 72/265 (27%)

Query: 417 NVTHDLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLI 476
           +++++  R LPT++CLFDLYR+LSQG T++ WY   Y  IK N+ID+RRFITFG+ K +I
Sbjct: 423 HISNNRNRFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKRII 482

Query: 477 YRCFSFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMKLGEGSKM 536
           YR +S+PVM  +          T      + K    + N +E KY               
Sbjct: 483 YRSYSYPVMLSVG------PRETKETAPIIAKDSPNESNSSEKKY--------------H 522

Query: 537 HQNFSVDIADEVLRNVYKKLSNTNEPGSRDDYPLSRIYREESHVSLSALSGDNVSHPKKP 596
             +FS      ++R+    L N  + G                               +P
Sbjct: 523 EHSFS------IIRSKNAVLFNNIKSG-------------------------------RP 545

Query: 597 ERVSKVAFDMNKDDPVPYSLSQQKGKNKEREAAKLDRAKNNQKIILLESIAAADCLDKIC 656
            +VS   FDM            QK  +     + + +  ++++ IL ES+ +A+  DKIC
Sbjct: 546 SKVS---FDM------------QKASSLITGESTIPKLSDDEERILEESVRSAENFDKIC 590

Query: 657 VKLEKPRHEVEELLHELGDYKIINS 681
           V L KP+ EVE  L+ELG++KIINS
Sbjct: 591 VLLGKPKLEVENYLNELGEFKIINS 615

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
           YEL062W (NPR2) - Non-membrane-embedded, PEST
           sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  455 bits (1171), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 213/352 (60%), Positives = 267/352 (75%), Gaps = 12/352 (3%)

Query: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74
           M+  F+GFVP+H + Y +FHPT+GT+VR+++PPG LE ++I FD IKNY+IPKPQLC+KL
Sbjct: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60

Query: 75  LTLKYKGYRIVCYPVTVNSPYYARXXXXXXXXXXXPYDCETSSYEPAIARLGKMFRVLEE 134
           LT KY  +R+VCYPV V +PYYAR           PYDC TS YE AIARLGKMF VLEE
Sbjct: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120

Query: 135 QNQILSKAENDPIYFDFKLAD----------NTTEQDGKLNAEKSFKGLTKSQGMALAKY 184
           Q+QILSKAEN  +YF  K  D          N  E  G L   ++ +  ++S G A  KY
Sbjct: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQ--SESHGYAFEKY 178

Query: 185 NEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSCISI 244
           +EI+KDL       SV+DL+ +I++DLNNYSECLIPID GNAVDIK+FPL +PP+SC+S 
Sbjct: 179 HEILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKLFPLLSPPSSCLSF 238

Query: 245 EDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYN 304
           EDVP+ TVNL  +IDVNWDPTMLKIVPYI+G NSI+K+AKLSDSD +LV+EC++HL+YYN
Sbjct: 239 EDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYN 298

Query: 305 CVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFER 356
           CVILADIFQF NIYAPTS + +FLT+P LA+ECQ +VTL   + +S++PFER
Sbjct: 299 CVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFER 350

 Score =  152 bits (385), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 91/265 (34%), Positives = 153/265 (57%), Gaps = 19/265 (7%)

Query: 428 TKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCFSFPVMKK 487
           +K+CLFD+YR+LSQG TV+EWY  +++ I+   IDVRRFITFGVI GL+YRC+SFP+MK 
Sbjct: 431 SKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIHGLLYRCYSFPIMKN 490

Query: 488 MSIFDLAHKLHTAGNLNQVTKKGKGQKNLAE-SKYVFSTSDMKLG---EGSKMHQ----N 539
           +   ++   L  +      + +GK     +E +  V S +++++G     SK+ +    +
Sbjct: 491 VGYLEVVKALGLSD--GDSSTEGKWLSGNSEPTNNVLSAAEIRIGLESSSSKLRERRFNH 548

Query: 540 FS-VDIADEVLRNVYKKLS---NTNEPGSRDDYPLSRIYREESHVSLSALSGDNVSHPKK 595
           FS  D A+++L +VY+KL+   N  E  S+   P+ R++   S  S    S  +V     
Sbjct: 549 FSNADTAEDILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCSDDSSGETSVKDVVSTAG 608

Query: 596 PERVSKVAFDMNKDDPVPYSLSQQKGKNKEREAAKLDRAKNNQKIILLESIAAADCLDKI 655
            +  + VAFD+ +      +  ++KG     E  +L+  K   +++LL+S+   +  DKI
Sbjct: 609 SDTRNTVAFDVRRLVNSATAEDRKKG-----EVMRLEEDKRKDELLLLKSVRDVENFDKI 663

Query: 656 CVKLEKPRHEVEELLHELGDYKIIN 680
           C +L + R EVE++L +LG Y +++
Sbjct: 664 CTRLGRDREEVEKMLEDLGPYNVVH 688

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score =  449 bits (1156), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 215/353 (60%), Positives = 268/353 (75%), Gaps = 14/353 (3%)

Query: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74
           M+  F+GFVP+H +FY+VFHPT+GT+VR+++P G LE ++I FD IKNY+IPKPQLC+KL
Sbjct: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60

Query: 75  LTLKYKGYRIVCYPVTVNSPYYARXXXXXXXXXXXPYDCETSSYEPAIARLGKMFRVLEE 134
           LT KY  +R+VCYPV V +PYYAR           PYDC TS YEPAI RLGKMF VLEE
Sbjct: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120

Query: 135 QNQILSKAENDPIYFDFKLADNT-----------TEQDGKLNAEKSFKGLTKSQGMALAK 183
           Q+QILSKAEN  +YF  K A NT           TEQ   L+  +  +   ++QG A AK
Sbjct: 121 QSQILSKAENSSVYFQLK-ARNTQKHGNTETAKGTEQPSSLDIGEIAQ--PENQGYASAK 177

Query: 184 YNEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSCIS 243
           Y EI+KDLE      ++ DL+ +I++DLN+YSECLIPID GNAVDIK+FPL +PP+SC S
Sbjct: 178 YYEILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPPSSCFS 237

Query: 244 IEDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYY 303
           IEDVPISTVNL  +IDVNWDPTMLKIVP+I+G+NSI+K+AK SDSDV+LV+EC+KHL+YY
Sbjct: 238 IEDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYY 297

Query: 304 NCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFER 356
           NCVIL DIFQFSNIYA T+ + +FLT+PTLA+ECQ +V     + L  +PFER
Sbjct: 298 NCVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFER 350

 Score =  149 bits (375), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 91/266 (34%), Positives = 151/266 (56%), Gaps = 20/266 (7%)

Query: 428 TKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCFSFPVMKK 487
           +K+CLFDLYR+L+QG T+REWY  +++ I+   IDVRRFITFGV+ GLIYR +S+PV++ 
Sbjct: 433 SKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVLHGLIYRSYSYPVLRN 492

Query: 488 MSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMKLG--------EGSKMHQN 539
           +   +    L  A N ++  K     K       V S +D+++G           K+ Q+
Sbjct: 493 IGFAESVEAL-GATNHSRYAKYKHLLKTNQPLNNVLSAADIRIGLENAGFKARSEKLKQH 551

Query: 540 FSVDIADEVLRNVYKKLSNTNEPG---SRDDYPLSRIYREESHVSLSALSGDNVSHPKKP 596
            + D A+EVL +VY+KL+ +++     ++ + P+S+++   S  S + +S    ++    
Sbjct: 552 STADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSEDS-TDISTRESANSMGS 610

Query: 597 ERVSKVAFDMNKDDPVPYSLSQQKGKNKER-EAAKLDRAKNNQKIILLESIAAADCLDKI 655
           +  +KVAFD+ K      +L+      + R E  +    K N+++ILL+S+ +    DKI
Sbjct: 611 DIKNKVAFDVRK------TLATSSADERRRSEILRSIEEKRNEELILLKSVRSVHNFDKI 664

Query: 656 CVKLEKPRHEVEELLHELGDYKIINS 681
           C  L K R  VE +L ELG Y +++S
Sbjct: 665 CTLLGKDRERVESMLSELGPYNVLHS 690

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
           Anc_6.17 YEL062W
          Length = 675

 Score =  433 bits (1114), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 218/373 (58%), Positives = 258/373 (69%), Gaps = 29/373 (7%)

Query: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74
           M + F+GFVPIH +FY+VFHPT+GT+V YE+PP NL  + INFDAIKNY+IPKPQLCHKL
Sbjct: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60

Query: 75  LTLKYKGYRIVCYPVTVNSPYYARXXXXXXXXXXXPYDCETSSYEPAIARLGKMFRVLEE 134
           LTLKY  YRIV YP+ +NS  YAR           PY+CETS YEP + RLGKMF  LE 
Sbjct: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120

Query: 135 QNQILSKAENDPIYFDFKLADNTTEQDGKLNAEKSFKGLTKSQGMAL------------- 181
           Q Q LSK E D  YFDFKL  N  +QD K N E     L+K+  M L             
Sbjct: 121 QCQFLSKCEKDMAYFDFKLISNLIDQD-KSNTEPDNNILSKTNSMILPTISNIDTTVGST 179

Query: 182 ---------------AKYNEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNA 226
                          +KYN I   ++++K   S+ D++MR+FQDLN+YSEC IPID+GNA
Sbjct: 180 NTQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNA 239

Query: 227 VDIKIFPLKTPPNSCISIEDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLS 286
           +DIK+FP   PP   IS+EDVPI TVNL  IIDVNWDPTMLKIVPYIDGLNSI KIA LS
Sbjct: 240 IDIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLS 299

Query: 287 DSDVSLVLECVKHLVYYNCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGH 346
           +SD  LV+EC++H VYY CVIL+DIFQFSNIYAPTS I  FLTDPTLA+ECQ +VT    
Sbjct: 300 NSDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPED 359

Query: 347 SSLSEMPFERLRK 359
           S LS +PF++ RK
Sbjct: 360 SLLSALPFKKGRK 372

 Score =  135 bits (341), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 106/268 (39%), Positives = 147/268 (54%), Gaps = 42/268 (15%)

Query: 420 HDLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRC 479
           H    +LPTK+ LFDLYR+LSQGV + EWY +N+ +I+ N ID+RRFI FG+IK +IYRC
Sbjct: 442 HQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQINFNSIRDNFIDIRRFIIFGIIKRIIYRC 501

Query: 480 FSFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMKLG-----EGS 534
            S+P+ K    F   + L    N  ++ K     K+ + +  +FSTSD+K G     +  
Sbjct: 502 HSYPLPKNYEAFSKLNDLKNLQNGPKIVK----NKSQSYTYNIFSTSDIKFGVDLYTDTK 557

Query: 535 KMHQNFSVDIADEVLRNVYKKLSNTNEPGSRDDYPLSRIYREESHVSLSALSGDNVSHPK 594
           K      VD+AD VL NVYKKLS    P                    ++++G    HP 
Sbjct: 558 KKLHTLDVDVADRVLNNVYKKLSTNGRPT-------------------TSINGQG-QHP- 596

Query: 595 KPERVSKVAF-DMNKDDPVPYSLSQQKGKNKEREAAKLDRAKN-NQKIILLESIAAADCL 652
                SKVAF + + D+ +P  ++     N   EA K  R  N N KI LL+++ +A+ L
Sbjct: 597 -----SKVAFKNQSYDNDLPGLMN-----NLGIEATKFSREININDKIYLLDALQSAENL 646

Query: 653 DKICVKLEKPRHEVEELLHELGDYKIIN 680
           D IC  LE  R EVE LL+EL +Y+IIN
Sbjct: 647 DNICSNLELSREEVETLLNELTEYRIIN 674

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
           YEL062W
          Length = 612

 Score =  424 bits (1090), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 209/346 (60%), Positives = 259/346 (74%), Gaps = 9/346 (2%)

Query: 17  DQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKLLT 76
           + FEGF+PIHT+FY++FHPT+GT+V YE+PP NL   +INFD IKNYIIPK QLC++LLT
Sbjct: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69

Query: 77  LKYKGYRIVCYPVTVNSPYYARXXXXXXXXXXXPYDCETSSYEPAIARLGKMFRVLEEQN 136
            KY+ YRIV YP+T+N+PYYAR           PY+CETS YEP+IARLGKMF++LEEQ+
Sbjct: 70  FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129

Query: 137 QILSKAENDPIYF--DFKLADNTTEQDGKLNAEKSFKGLTKSQGMALAKYNEIMKDLESE 194
           QILSKAENDPIYF  D+   + TT    +++     K              E   D   E
Sbjct: 130 QILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDGSRFE--TDFFGE 187

Query: 195 KSD----FSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFP-LKTPPNSCISIEDVPI 249
           + D    FSVQDL+MRI+QDLNNYSECLIPID+GN ++IK+FP LK PPN  IS+EDVP+
Sbjct: 188 EEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPM 247

Query: 250 STVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYNCVILA 309
           S +NL  +IDVNWDPTML IVPYI+G+N ISKIAKL+ +D  LV+EC+KHLVYYNCVI+ 
Sbjct: 248 SLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIIT 307

Query: 310 DIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFE 355
           DIFQFSN+YAPTSLI  FLTD  +A++CQ++V L   S LS +PFE
Sbjct: 308 DIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE 353

 Score =  134 bits (338), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 98/273 (35%), Positives = 134/273 (49%), Gaps = 77/273 (28%)

Query: 417 NVTHDLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLI 476
           N  H    HLPTKACLFDLYR+LS GVT+R WY  N   I +N++DVR+FI FG+I+GLI
Sbjct: 405 NNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLI 464

Query: 477 YRCFSFPVMKKMS---------IFDL-AHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTS 526
           YRC S+P+ ++ S         + D+ AH+L       Q+   G   ++ + S    S S
Sbjct: 465 YRCHSYPIPQRPSNEGIQRIERLNDIDAHRL-------QIRSSGSAARSNSGSGSGSSAS 517

Query: 527 DMKLGEGSKMHQNFSVDIADEVLRNVYKKLSNTNEPGSRDDYPLSRIYREESHVSLSALS 586
              +          +VD ADE+L+NVYKKL                              
Sbjct: 518 PSSI----------NVDGADELLKNVYKKL------------------------------ 537

Query: 587 GDNVSHPKKPERVSKVAFDMNKDDPVPYSLSQQKGKNKEREAAKLDRAKNNQKIILLESI 646
                     ER SKV+F M+K         ++    K  E  +       ++ +LL+SI
Sbjct: 538 ----------ERHSKVSF-MDK---------EKNESMKTDEKGRPSTMTKEERSVLLKSI 577

Query: 647 AAADCLDKICVKLEKPRHEVEELLHELGDYKII 679
            + + LDKICVKL K R +VE  L ELG+YKII
Sbjct: 578 ESLENLDKICVKLGKSRQQVERWLDELGNYKII 610

>NDAI0C05400 Chr3 (1249878..1255394) [5517 bp, 1838 aa] {ON} Anc_8.520
          Length = 1838

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/114 (21%), Positives = 55/114 (48%), Gaps = 15/114 (13%)

Query: 250  STVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDS-DVSLVLECVKHLVYYNCVIL 308
            + V   T++   +DPT+ K++  + G +    I+KL  + D + +  CV ++ Y   ++ 
Sbjct: 996  TWVTAGTVVSAEYDPTLAKLI--VHGKDRNDAISKLIQALDETKLYGCVTNIDYLKSIVS 1053

Query: 309  ADIFQFSNI---------YAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMP 353
            +D+F+ + +         YAP+++    +T P   +  Q +    G+ S+   P
Sbjct: 1054 SDMFKEARVSTNVLNFYDYAPSAI---EITSPGAHTSVQDYPGRTGYWSIGVPP 1104

>NCAS0A09050 Chr1 complement(1791486..1792697) [1212 bp, 403 aa]
           {ON} Anc_1.347 YJL046W
          Length = 403

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 50/102 (49%), Gaps = 10/102 (9%)

Query: 2   SLRYIQ-----ACANTGRMTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNIN 56
           +LRY++     A  N+ R  +  E F  ++ ++  +F P +GTQ + + P    E + +N
Sbjct: 17  ALRYLRRLHENAIPNSKRKENDGE-FQDLNEMYSDMFTPNQGTQHQNDGPSVKSEIDELN 75

Query: 57  --FDAIKNYIIPKPQLCHKLLTLKYKGYRIVCYPVTVNSPYY 96
               ++ N+   K   C KL  +  K  + +   +++N PYY
Sbjct: 76  AELSSMNNFNFEKLS-CEKLQQITLKDGKFILRSLSIN-PYY 115

>Kpol_538.7 s538 (10425..12944) [2520 bp, 839 aa] {ON}
           (10425..12944) [2520 nt, 840 aa]
          Length = 839

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 550 RNVYKKLSNTNEPGSRDDYPLSRIYREESHVSLSALSGDNVSHPKKPERVSKVAFDM 606
           R VYKKLS  ++PG  DD  + +I    S    + L  + V     PE  +K+AFD+
Sbjct: 309 RTVYKKLSKIHKPGFLDDLAVQKIDVGHS----APLITNPVLRELSPEGATKIAFDI 361

>TDEL0C06570 Chr3 (1206296..1208728) [2433 bp, 810 aa] {ON} Anc_1.45
           YCL030C
          Length = 810

 Score = 32.0 bits (71), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 7/59 (11%)

Query: 290 VSLVLECVKHLVYYNCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSS 348
           V +V +C+ H     C    + F  SN YAP  LI Q        +  Q +V L  H+ 
Sbjct: 667 VDIVRKCIAHSAIITCGSYEEAFDISNQYAPEHLILQI-------TNAQDYVKLVDHAG 718

>TPHA0O01610 Chr15 (319614..321224) [1611 bp, 536 aa] {ON} Anc_2.73
           YNL182C
          Length = 536

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 48/230 (20%), Positives = 91/230 (39%), Gaps = 38/230 (16%)

Query: 465 RFITFGVIKGLIYRCFSFPVMKKM---SIFDL----AHKLHTAGNLNQVTKKGKGQKNLA 517
           R +  G  KG    CF+ P+  ++    I +L    + KL + G +  +T+   GQ    
Sbjct: 259 RALYIGTSKG----CFNLPLFYQLPGNRIVNLTQSISEKLTSKGKVFSLTELLPGQDEHQ 314

Query: 518 ESKYVFSTSDMKLGEGSKMH---QNFSVD-----IAD-------------EVLRNVYKKL 556
           + + +F+   + + + S +       S+D     I D             ++LR +    
Sbjct: 315 KPQDLFAIGQILMNKISDLDVKCSQLSLDGSQLVIGDATGKISIIEIFSKQILRTISPAT 374

Query: 557 SNTNEPGSRDDYPLSRIYREESHVSLSALSGDNVSHPKKPERVSKVAFDMNKDDPVPYSL 616
           +  +  GS  +  +S  Y+E SH+ L   S  +    +K   + +  FD  K+  +    
Sbjct: 375 TQQDSVGSVTNLLISTQYKESSHIELFNGSKSDSGKTQKLPALQRAIFDNKKEGTLHDIW 434

Query: 617 SQQKGKNKEREA------AKLDRAKNNQKIILLESIAAADCLDKICVKLE 660
           +Q K    E  A        LD  KN + + L ES   ++ ++ +    E
Sbjct: 435 NQFKSPAFETVAPLEDFETYLDNMKNQESVFLTESNRDSNSINTVTANTE 484

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,984,912
Number of extensions: 3114504
Number of successful extensions: 10054
Number of sequences better than 10.0: 55
Number of HSP's gapped: 10380
Number of HSP's successfully gapped: 81
Length of query: 681
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 565
Effective length of database: 40,180,143
Effective search space: 22701780795
Effective search space used: 22701780795
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)