Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07854g6.18ON94494449390.0
TDEL0G045106.18ON96995028870.0
NCAS0D026506.18ON95094227310.0
NDAI0I022606.18ON96795926790.0
KAFR0A050506.18ON94894326070.0
Skud_15.1666.18ON94794325680.0
Suva_15.1806.18ON94895925620.0
YOR005C (DNL4)6.18ON94494925530.0
Kpol_1032.76.18ON96595225190.0
Smik_15.1746.18ON94595125110.0
CAGL0E02695g6.18ON94693424170.0
TPHA0M002606.18ON96695424140.0
KNAG0F028706.18ON95495924070.0
TBLA0G010406.18ON97291823730.0
Kwal_56.224146.18ON96394623290.0
KLTH0C11286g6.18ON95196822250.0
KLLA0D01089g6.18ON90789720250.0
ACR008W6.18ON98188920020.0
ACL155W7.343ON6973992942e-26
TBLA0E020507.343ON7203872898e-26
TPHA0D045707.343ON7363962791e-24
KLLA0D12496g7.343ON7003942782e-24
Kwal_56.246167.343ON7153822745e-24
SAKL0F10912g7.343ON6932752729e-24
NDAI0A019407.343ON7654092683e-23
CAGL0I03410g7.343ON7244322657e-23
Suva_4.827.343ON7554352622e-22
ZYRO0F11572g7.343ON7313892622e-22
Kpol_2001.717.343ON7263822612e-22
KLTH0H01408g7.343ON7232372542e-21
Smik_4.747.343ON8454342452e-20
YDL164C (CDC9)7.343ON7554342433e-20
TDEL0C020407.343ON7053982433e-20
Skud_4.937.343ON7554352416e-20
KNAG0C037407.343ON7274162406e-20
NCAS0A141107.343ON7534012399e-20
KAFR0B008307.343ON7103982263e-18
Ecym_21886.228ON461105930.020
NCAS0D041006.228ON449221880.079
CAGL0D06050g1.495ON52476880.089
KNAG0F019006.228ON457105860.13
TPHA0E027706.228ON450131850.16
Suva_7.1336.228ON459215840.21
KAFR0K023606.228ON457105830.32
Kpol_228.36.228ON468105820.40
ZYRO0E07150g6.228ON449105820.42
KLLA0B02200g6.228ON466105810.59
SAKL0A04114g6.228ON465105790.94
Smik_7.1416.228ON459215781.1
KNAG0E004107.46ON817112791.2
CAGL0G07843g3.447ON598101781.3
TBLA0A020706.228ON453105771.4
KAFR0C051907.46ON89686781.6
CAGL0I09570g6.228ON449105771.8
YGL130W (CEG1)6.228ON459215761.9
Skud_7.1426.228ON459105762.0
Ecym_63411.276ON76787762.7
TBLA0E005703.447ON596107752.8
AFR095C1.276ON67092752.9
NDAI0I008306.228ON452106753.1
Kwal_27.120168.536ON22682723.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C07854g
         (944 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...  1907   0.0  
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...  1116   0.0  
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...  1056   0.0  
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...  1036   0.0  
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...  1008   0.0  
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...   993   0.0  
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...   991   0.0  
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...   988   0.0  
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...   974   0.0  
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   971   0.0  
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...   935   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   934   0.0  
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...   931   0.0  
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   918   0.0  
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...   901   0.0  
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...   861   0.0  
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...   784   0.0  
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   775   0.0  
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   117   2e-26
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   115   8e-26
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   112   1e-24
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   111   2e-24
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   110   5e-24
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   109   9e-24
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   107   3e-23
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   106   7e-23
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   105   2e-22
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...   105   2e-22
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   105   2e-22
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   102   2e-21
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...    99   2e-20
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...    98   3e-20
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...    98   3e-20
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...    97   6e-20
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...    97   6e-20
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...    97   9e-20
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...    92   3e-18
Ecym_2188 Chr2 (371869..373254) [1386 bp, 461 aa] {ON} similar t...    40   0.020
NCAS0D04100 Chr4 (774815..776164) [1350 bp, 449 aa] {ON} Anc_6.2...    39   0.079
CAGL0D06050g Chr4 (573888..575462) [1575 bp, 524 aa] {ON} simila...    39   0.089
KNAG0F01900 Chr6 (367193..368566) [1374 bp, 457 aa] {ON} Anc_6.2...    38   0.13 
TPHA0E02770 Chr5 (580118..581470) [1353 bp, 450 aa] {ON} Anc_6.2...    37   0.16 
Suva_7.133 Chr7 (262417..263796) [1380 bp, 459 aa] {ON} YGL130W ...    37   0.21 
KAFR0K02360 Chr11 complement(481829..483202) [1374 bp, 457 aa] {...    37   0.32 
Kpol_228.3 s228 (5737..7143) [1407 bp, 468 aa] {ON} (5737..7143)...    36   0.40 
ZYRO0E07150g Chr5 complement(540507..541856) [1350 bp, 449 aa] {...    36   0.42 
KLLA0B02200g Chr2 (196341..197741) [1401 bp, 466 aa] {ON} highly...    36   0.59 
SAKL0A04114g Chr1 (386331..387728) [1398 bp, 465 aa] {ON} highly...    35   0.94 
Smik_7.141 Chr7 (260116..261495) [1380 bp, 459 aa] {ON} YGL130W ...    35   1.1  
KNAG0E00410 Chr5 complement(65732..68185) [2454 bp, 817 aa] {ON}...    35   1.2  
CAGL0G07843g Chr7 (744599..746395) [1797 bp, 598 aa] {ON} highly...    35   1.3  
TBLA0A02070 Chr1 complement(499281..500642) [1362 bp, 453 aa] {O...    34   1.4  
KAFR0C05190 Chr3 (1031636..1034326) [2691 bp, 896 aa] {ON} Anc_7...    35   1.6  
CAGL0I09570g Chr9 complement(914062..915411) [1350 bp, 449 aa] {...    34   1.8  
YGL130W Chr7 (266145..267524) [1380 bp, 459 aa] {ON}  CEG1Alpha ...    34   1.9  
Skud_7.142 Chr7 (270563..271942) [1380 bp, 459 aa] {ON} YGL130W ...    34   2.0  
Ecym_6341 Chr6 (656835..659138) [2304 bp, 767 aa] {ON} similar t...    34   2.7  
TBLA0E00570 Chr5 complement(110459..112249) [1791 bp, 596 aa] {O...    33   2.8  
AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON} S...    33   2.9  
NDAI0I00830 Chr9 complement(187083..188441) [1359 bp, 452 aa] {O...    33   3.1  
Kwal_27.12016 s27 (1046016..1046696) [681 bp, 226 aa] {ON} YPL06...    32   3.9  

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score = 1907 bits (4939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 931/944 (98%), Positives = 931/944 (98%)

Query: 1   MSTKTDDQNKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVK 60
           MSTKTDDQNKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVK
Sbjct: 1   MSTKTDDQNKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVK 60

Query: 61  LWRKTVGDNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRA 120
           LWRKTVGDNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRA
Sbjct: 61  LWRKTVGDNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRA 120

Query: 121 GRGIKLSDFCVEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFK 180
           GRGIKLSDFCVEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFK
Sbjct: 121 GRGIKLSDFCVEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFK 180

Query: 181 YCLENMSFTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPS 240
           YCLENMSFTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPS
Sbjct: 181 YCLENMSFTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPS 240

Query: 241 HRLKNDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRK 300
           HRLKNDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRK
Sbjct: 241 HRLKNDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRK 300

Query: 301 LKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVK 360
           LKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVK
Sbjct: 301 LKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVK 360

Query: 361 SSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEII 420
           SSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEII
Sbjct: 361 SSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEII 420

Query: 421 QSMHCYDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLD 480
           QSMHCYDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLD
Sbjct: 421 QSMHCYDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLD 480

Query: 481 LLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIA 540
           LLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIA
Sbjct: 481 LLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIA 540

Query: 541 NGISQEEFKQIERKTAGKWKNTEDHKPPKILEFGSKLPEEWIYPEDSVVLEVKARSLDNT 600
           NGISQEEFKQIERKTAGKWKNTEDHKPPKILEFGSKLPEEWIYPEDSVVLEVKARSLDNT
Sbjct: 541 NGISQEEFKQIERKTAGKWKNTEDHKPPKILEFGSKLPEEWIYPEDSVVLEVKARSLDNT 600

Query: 601 ESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNNQKPMKSKK 660
           ESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNNQKPMKSKK
Sbjct: 601 ESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNNQKPMKSKK 660

Query: 661 IRRPRIVSRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNGG 720
           IRRPRIVSRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNGG
Sbjct: 661 IRRPRIVSRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNGG 720

Query: 721 KLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIEPRHC 780
           KLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIEPRHC
Sbjct: 721 KLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIEPRHC 780

Query: 781 FSVSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVISDVEDIPL 840
           FSVSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVISDVEDIPL
Sbjct: 781 FSVSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVISDVEDIPL 840

Query: 841 FLFSRRIVFIPEGFSYLDTQLLKHKVRLYGGQLTDNVNQCNLIIVPDGKINLRGRIISDL 900
           FLFSRRIVFIPEGFSYLDTQLLKHKVRLYGGQLTDNVNQCNLIIVPDGKINLRGRIISDL
Sbjct: 841 FLFSRRIVFIPEGFSYLDTQLLKHKVRLYGGQLTDNVNQCNLIIVPDGKINLRGRIISDL 900

Query: 901 RRLLSTFAAMTELXXXXXXXXXXXXXDRSIEENIQVPEEDFLAV 944
           RRLLSTFAAMTEL             DRSIEENIQVPEEDFLAV
Sbjct: 901 RRLLSTFAAMTELPPAIPWIVIPAWIDRSIEENIQVPEEDFLAV 944

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score = 1116 bits (2887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/950 (57%), Positives = 706/950 (74%), Gaps = 19/950 (2%)

Query: 8   QNKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVKLWRKTVG 67
           +  P NFAPSPDF WLC+ELFVK+++VQ+Q R+H   K L+V+Y+E+IS F++LWRKTVG
Sbjct: 24  EKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRLWRKTVG 83

Query: 68  DNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGIKLS 127
           +NI+PAL+L LPYRDRRI+NIKDYTL+KAICS+L LP  S TEKRLL+WKRRA RG++LS
Sbjct: 84  NNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATRGVRLS 143

Query: 128 DFCVEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFKYCLENMS 187
           +FCVEEIR+R+SEP  G RITIDKLNECLD L EERN KG GFK L+DS  F +CL+NMS
Sbjct: 144 NFCVEEIRKRKSEPSPGRRITIDKLNECLDHLVEERNAKG-GFKGLSDSPTFNFCLQNMS 202

Query: 188 FTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRLKNDD 247
           F E++++FDI+LK+RVIGGQEHK LNCWHPDA DYLSVVSDL+TVA +LWDP HRL+ DD
Sbjct: 203 FIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEHRLRRDD 262

Query: 248 LGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRR 307
           L +NLG  F P LAK++ ISY+K+  +L +DF IEEKMDGERIQ+HYMDYG K+++ SRR
Sbjct: 263 LSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRR 322

Query: 308 GNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSL 367
           G DYT LYGE++ +GTVA YL  D  VR+CVLDGEMI+FDT+ N VLPFG+VKSSAR +L
Sbjct: 323 GVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQAL 382

Query: 368 TAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYD 427
           + EGI +QG+RP+ MV+D +YLNGVSLI +PL  RK++L+ +L PCPHAVEI+  + C +
Sbjct: 383 STEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSE 442

Query: 428 DTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRD 487
            T+I+ SLEK+I MGSEGI+LK +K++YEIGAR D WIK+KPEYLEQFGENLDL++IGR 
Sbjct: 443 HTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRT 502

Query: 488 PGKKDSLMCGLAVLEGDE---EPGAQSDKQVVNLDSEEEE----EPRKAVKKFISFCTIA 540
           PGKKDSLMCGLAV EG+E   E  A+ +  +VNLDSE +E    + +K +K FISFC IA
Sbjct: 503 PGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIA 562

Query: 541 NGISQEEFKQIERKTAGKWKNTEDHKPPK-ILEFGSKLPEEWIYPEDSVVLEVKARSLDN 599
           NGISQ+EFK+I+RKT G W  ++   P   +L FGSK+PEEWI P++S++LEVKARSLDN
Sbjct: 563 NGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDN 622

Query: 600 TESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNNQKPMKSK 659
           TESS +KF  GCTLHGGYCRRIR+DK+WT CY+  ELWQER  K      S N++  K  
Sbjct: 623 TESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKSSTGVGSFNKQYSKKM 682

Query: 660 KIRRPRIVSRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNG 719
           K ++ +I     Q     D   +++IF GL FYV+SDY+    + RI+K +  DLI  N 
Sbjct: 683 KSKKRKIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSEFDDLILQNS 742

Query: 720 GKLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIEPRH 779
           GKL  N+IS H  +   RIISGKYT EC+ALIERGYDILSPQW++DC+    +V +EPRH
Sbjct: 743 GKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRMVVKLEPRH 802

Query: 780 CFSVSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVI----SDV 835
           CF+VS ++  I   RVD +GDS+   ITE +L +++     D++      +++    S++
Sbjct: 803 CFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLI-----DTNMKQTEPNLMREANSEL 857

Query: 836 EDIPLFLFSRRIVFI-PEGFSYLDTQLLKHKVRLYGGQLTDNVNQCNLIIVPDGKINLRG 894
           + +PLFLFS R V+I P+ F+ +D   L  K +L+GG +  ++  CNLII+P+    L  
Sbjct: 858 DVVPLFLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDIPSCNLIIMPNENQRLGT 917

Query: 895 RIISDLRRLLSTFAAMTELXXXXXXXXXXXXXDRSIEENIQVPEEDFLAV 944
           + + ++R+ +       +              ++SIEEN QVPEEDF  V
Sbjct: 918 QSLVEMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDFTPV 967

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score = 1056 bits (2731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/942 (55%), Positives = 686/942 (72%), Gaps = 16/942 (1%)

Query: 11  PHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVKLWRKTVGDNI 70
           P NF+PSP F+WLCDELFVK++++Q +       K +TV+Y+E+I+ F+ LWRKTVG++I
Sbjct: 17  PCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIALWRKTVGNDI 76

Query: 71  YPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGIKLSDFC 130
           +PALILILPYRDRR+FNI+DYTLIKAIC++L+LP NS TEKRLL WK RAG+G+KLS FC
Sbjct: 77  FPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLSQFC 136

Query: 131 VEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFKYCLENMSFTE 190
           V EI++R+SEP +   ITID+LNECLD+LAEERN+KGRGFK LADS  FK+CLENMSF E
Sbjct: 137 VNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLADSPTFKFCLENMSFIE 196

Query: 191 MKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRLKNDDLGV 250
           ++++FDI+LK+RVIGGQEHKFLN WHPDA+DYLSVVSDL+TV  +LWDP  RL+N+DL +
Sbjct: 197 LQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNNDLVI 256

Query: 251 NLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRRGND 310
           N G  FAP LAK+L ISY+K+ ++LK+DF IEEKMDGERIQLHY DYG KLK+FSRRG D
Sbjct: 257 NPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGTD 316

Query: 311 YTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAE 370
           YTYLYGE I  G + K+L+L+  V++C+LDGEMI++D  +N +LPFGLVKSSAR  LT +
Sbjct: 317 YTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTKD 376

Query: 371 GILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTS 430
           GI+ +GY+PL+MV D +++NG SL N+PLN RK+YL+ I  P PH +E++ S H +++ S
Sbjct: 377 GIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNEDS 436

Query: 431 IKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDPGK 490
           I+ SLE AI MGSEGI+LK + S+Y + +R D+WIK+KPEYLEQFGEN+DL+VIGRDPGK
Sbjct: 437 IRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGRDPGK 496

Query: 491 KDSLMCGLAVLEGDEEP--GAQSDKQVVNLDSEEEE--EPRKAVKKFISFCTIANGISQE 546
           KDSLMCGLAV+E DE+      +D  V+ LD +E+   E  + + KF+SFC IANG+SQE
Sbjct: 497 KDSLMCGLAVVEEDEKADLNENNDDNVIILDDDEDAPVEQERTIHKFVSFCVIANGLSQE 556

Query: 547 EFKQIERKTAGKWKNTEDHKPP-KILEFGSKLPEEWIYPEDSVVLEVKARSLDNTESSGR 605
           EFKQI+RKT G W  +++  PP  +L+FG++LP EWI P+ SVV+EVKARS+D  ES+GR
Sbjct: 557 EFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKARSIDAAESNGR 616

Query: 606 KFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNNQKPMKSKKIRRPR 665
           KF  GCTL+GGYCR IREDK+W  CYTL E    R K V    + ++Q     K+ ++ R
Sbjct: 617 KFATGCTLYGGYCRGIREDKDWQTCYTLSEFL--RTKNVKSRRNGSDQVIHGVKRQKKNR 674

Query: 666 IVSRLNQTLSCDDE-AKTSSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNGGKLTF 724
               L+Q+L  +    K ++ F  L FYVISD        RI KE++   I   GG L  
Sbjct: 675 RKYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEGGGTLIH 734

Query: 725 NVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIEPRHCFSVS 784
           N+IS       LRIISGK T EC ALIERGYD+++PQW++DCV +  L+ +EP++CF+VS
Sbjct: 735 NIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLEPKYCFNVS 794

Query: 785 EDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVISDVE--DIPLFL 842
            +++K+   RVD FGDSY+V ITE++L  +L + E +     G +   +D E   IPLFL
Sbjct: 795 TELKKLTEKRVDTFGDSYEVPITEEQLSTLLET-ELNLVRVQGLVTPYADEELIKIPLFL 853

Query: 843 FSRRIVFIPEGFSYLDTQLLKHKVRLYGGQLTDNVNQCNLIIVPDGKINLRGRIISDLRR 902
           F  RI+  P   S      L+ K++LYGG+LT ++ +CNLII+P+G   L  R     R 
Sbjct: 854 FQDRIMLFPNTESK-TISFLQEKIKLYGGKLTTDIGKCNLIILPNGNQQLLQRT----RD 908

Query: 903 LLSTFAAMTELXXXXXXXXXXXXXDRSIEENIQVPEEDFLAV 944
           LL+     +               +RSIEEN QVPEED+  +
Sbjct: 909 LLTKNIMNSGEVPTIPYIVNPLWIERSIEENSQVPEEDYPVI 950

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score = 1036 bits (2679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/959 (54%), Positives = 687/959 (71%), Gaps = 35/959 (3%)

Query: 11  PHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGA---FKSLTVKYFEIISFFVKLWRKTVG 67
           PHNFAPSP F+WLCDELFVK++ +Q+ +    +    K + V+Y+E+I  F+ LWRKTVG
Sbjct: 19  PHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFINLWRKTVG 78

Query: 68  DNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGIKLS 127
           ++IYPALILILPYRDRRI+N++DYTLIKAICS+L+LP NS TEKRLL WK+RAGR ++LS
Sbjct: 79  NDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRLS 138

Query: 128 DFCVEEIRRRRSEPLNGER--ITIDKLNECLDQLAEERNTKGR-GFKSLADSSVFKYCLE 184
            F V EI++R+SEP  G R  ITIDKLN+CLD L+EERN+KG  G++ L+DS  F +CLE
Sbjct: 139 SFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVFCLE 198

Query: 185 NMSFTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRLK 244
           NM+F E++++FDIILKSRVIGG EHKFLN WHPDA+DYLSVVSDLKTVA+KLWDP+  LK
Sbjct: 199 NMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLK 258

Query: 245 NDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWF 304
           NDDL +N+G PFAP  AK+L ISY+K+  +LK DF+IEEKMDGERIQLHY DYG KL + 
Sbjct: 259 NDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFL 318

Query: 305 SRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSAR 364
           SRRG DYTYLYGE I  GTV+KYL LD  V+ CVLDGEM++FD E N++LPFGLVKSSAR
Sbjct: 319 SRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSAR 378

Query: 365 DSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMH 424
             +T EG+  +GYRPL MV D +YLNGVSL+N+PL  RK YL  I  P  H VE+++S  
Sbjct: 379 SIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKR 438

Query: 425 CYDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLVI 484
           C D+ SIK++LE AI +GSEG++LKH+ S+Y + +R D+WIK+KPEYLEQFGEN+DL+VI
Sbjct: 439 CSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 498

Query: 485 GRDPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEE-----------EEEPRKAVKKF 533
           G+DPGKKDSLMCGLAV+E DE    +   ++VNLDS++           E E  K +K+F
Sbjct: 499 GKDPGKKDSLMCGLAVVEEDEPEIDEDGNEIVNLDSQDSIGEGEDKEGNEIEREKTIKRF 558

Query: 534 ISFCTIANGISQEEFKQIERKTAGKWKNTEDHKPPK-ILEFGSKLPEEWIYPEDSVVLEV 592
           +SFC+IANGISQEEFK I R T G WK +++  PP  +LEFGS++P EWI P+DS+V+EV
Sbjct: 559 VSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSIVIEV 618

Query: 593 KARSLDNTESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNN 652
           KARSL+N E + +KFK G TL+GGYCR+IREDK+W  CYTL EL + +R K+  ++ +NN
Sbjct: 619 KARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSNKRANN 678

Query: 653 --QKPMKSKKIRRPRIV-----SRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSER 705
                + S K R+ R +         QT +  D+++   IFDGL FYVISD + +  S R
Sbjct: 679 DATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSR---IFDGLYFYVISDVVDATGS-R 734

Query: 706 ISKEQLCDLISGNGGKLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMD 765
           +S+E+L D I   GG +  NVI+ H  +   RI+ GKYT EC++LI+RGYDI+ PQW++D
Sbjct: 735 VSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVLD 794

Query: 766 CVNTGFLVTIEPRHCFSVSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFS 825
           C+    L+ +EP++CF+VSE++ KIA+ RVD FGDS++ +I+ED    ++         +
Sbjct: 795 CIKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIERNVRSLRNA 854

Query: 826 TGSLDVISDVEDIPLFLFSRRIVFIPEGFSYLDTQLLKHKVRLYGGQLTDNVNQCNLIIV 885
             S+     V+ +PLFLF  R + +      L T+ LK ++RLYGG+ T ++  CNL+++
Sbjct: 855 PPSIQY-DMVDTVPLFLFYGRTILLRIKDKALFTK-LKVQIRLYGGKTTGDLASCNLVVI 912

Query: 886 PDGKINLRGRIISDLRRLLSTFAAMTELXXXXXXXXXXXXXDRSIEENIQVPEEDFLAV 944
              +I     +  D+R  L    + T+              D SI E  QVPEED   V
Sbjct: 913 QQNEI----AVAKDVRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVPEEDHPVV 967

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score = 1008 bits (2607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/943 (53%), Positives = 682/943 (72%), Gaps = 14/943 (1%)

Query: 11  PHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVKLWRKTVGDNI 70
           P NFAPSP FKWLC+ELF K++ V  Q   H   K +T++Y+EII+ FV LWR TVGD+I
Sbjct: 11  PRNFAPSPQFKWLCEELFSKLEEVPNQR--HLTTKRITLRYYEIITNFVNLWRTTVGDDI 68

Query: 71  YPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGIKLSDFC 130
           YPALIL LPYRDRR++N+KDYTLIKAIC++L+LP NS TEKRLL WK+RA R +KLS  C
Sbjct: 69  YPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVKLSVSC 128

Query: 131 VEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFKYCLENMSFTE 190
           V E+R+R+SEP+    IT+D+LN  LD L+++RN KGRG+K+L++SS+F YC+E MSF E
Sbjct: 129 VNEMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIEKMSFME 188

Query: 191 MKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRLKNDDLGV 250
           ++Y+FDIILK+RVIG  EHK LN WHPDA DYLSVVSDLKTV  +LW+P+ RL++D+L +
Sbjct: 189 LRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDELSI 248

Query: 251 NLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRRGND 310
           N+G  FAP LAK+L ISYDK+  +LK+DF+IEEKMDGERIQ+HYMDYG  +K+ SRRG D
Sbjct: 249 NIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRRGVD 308

Query: 311 YTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAE 370
           YTYLYGE++ TGT+A YL+L+  V+ECVLDGEM+++D +++ +LPFG+VKS+A ++LT E
Sbjct: 309 YTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKE 368

Query: 371 GILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTS 430
            I  Q Y PL MV D ++LNG SL+  PL  RK YL+++L P    V+I+    C ++  
Sbjct: 369 EISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENI 428

Query: 431 IKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDPGK 490
           I+ SLE AI +GSEGI+LK++ S+Y IG+R D+WIKIKPEYLEQFGEN+DL+VIGRD  K
Sbjct: 429 IRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGRDSAK 488

Query: 491 KDSLMCGLAVLEGDEEPGAQS-DKQVVNLDSEEEE----EPRKAVKKFISFCTIANGISQ 545
           KDS  CGL VL+ +EE   +  DK VVNL S+E +    E  + +KK +SFC IANGISQ
Sbjct: 489 KDSFYCGLTVLDEEEEKLVEEIDKGVVNLVSDESDYENPENNRHIKKVVSFCMIANGISQ 548

Query: 546 EEFKQIERKTAGKWKNTED-HKPPKILEFGSKLPEEWIYPEDSVVLEVKARSLDNTESSG 604
            E+K+I RKT G WK TE+   PP+++EFG+++P EWI PE SVVLE+KARSLDNTESS 
Sbjct: 549 NEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLDNTESSC 608

Query: 605 RKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERR-KKVPLSEDSNNQKPMKSKKIRR 663
           ++FK GCTL+GGYCRRIR+D +W   ++L EL ++RR K  P + + +     K ++ + 
Sbjct: 609 KRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTLLKSKKRRKK- 667

Query: 664 PRIVSRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNGGKLT 723
            ++++ LNQ L+  D   TS IFDGL FY++SDY  + ++ RISK+ L  L+  NGGK++
Sbjct: 668 -QLLTPLNQNLNPRDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLENGGKIS 726

Query: 724 FNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIEPRHCFSV 783
            N++S    K  LRI+ GKYT EC  LI+RGYDILSPQW++DCV    +V IEP HCFSV
Sbjct: 727 HNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPSHCFSV 786

Query: 784 SEDMEKIARTRVDHFGDSYDVEITEDRLRDIL-TSKEFDSDFSTGSLDVISDVEDIPLFL 842
           S+D+  +A  RVD +GDSY+  ++  RL  IL +SK+   D  + + ++  D E +P FL
Sbjct: 787 SDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPA-NMSLDFEKVPYFL 845

Query: 843 FSRRIVFIPE-GFSYLDTQLLKHKVRLYGGQLTDNVNQCNLIIVPDGKINLRGRIISDLR 901
           F RR  F+ E  F     +    K++LYGG++  N+++CN++I P  +I +    +  +R
Sbjct: 846 FWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRESMKFIR 905

Query: 902 RLLSTFAAMTELXXXXXXXXXXXXXDRSIEENIQVPEEDFLAV 944
             L+   + +               D SIE+N+QVPEED++ +
Sbjct: 906 NTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDYVPM 948

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score =  993 bits (2568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/943 (53%), Positives = 662/943 (70%), Gaps = 16/943 (1%)

Query: 10  KPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVKLWRKTVGDN 69
           +P NFAPSPDFKWLC+ELFV+IDNV +     G  KS + KY+EIIS FV+ WRK VG+N
Sbjct: 10  EPQNFAPSPDFKWLCEELFVRIDNV-RINGTAGTGKSASFKYYEIISNFVESWRKGVGNN 68

Query: 70  IYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGIKLSDF 129
           IYPAL+L LPYRDRRI+NIKDY LI+ ICS+L+LP NSVTE+RL  WK+R  R   LS  
Sbjct: 69  IYPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLSSL 128

Query: 130 CVEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFKYCLENMSFT 189
            VEEI +RR EP NG+ ITID +N+ LD+L++ER+  GRGFK L +S  F  CLE+MSF 
Sbjct: 129 LVEEIAKRRPEP-NGKSITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSCLESMSFV 187

Query: 190 EMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRLKNDDLG 249
           E+KY+FDI+LK+RVIGGQEH+FLNCWHPDA+DYLSVVSDLK V  KL+DP  RLKNDDL 
Sbjct: 188 ELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKNDDLS 247

Query: 250 VNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRRGN 309
           + +G  FAP LAK++ + Y+K+   L +DF IEEKMDGERIQ+HYM+YG+ +K+FSRRG 
Sbjct: 248 IKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGI 307

Query: 310 DYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTA 369
           DYTYLYG  + +GT+++YL+L   V+ECVLDGEM++FD+    +LPFGLVK SA+  L+ 
Sbjct: 308 DYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSC 367

Query: 370 EGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDT 429
             I    +RPLYMV D LYLN +SL  +PL+ RK+YLS+IL P  + VEI+QS  CYD  
Sbjct: 368 SDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDVQ 427

Query: 430 SIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDPG 489
           S+K+SLE AI +GSEG++LK++ S Y I +R  NWIK+KPEYLE+FGENLDL++IGRD G
Sbjct: 428 SVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIGRDSG 487

Query: 490 KKDSLMCGLAVL---EGDEEPGAQSDKQVVNLDSEEEEE---PRKAVKKFISFCTIANGI 543
           KKDS M GL V+   E +E     S  +VVN DS+ E++    +K VKK +SFC++ANGI
Sbjct: 488 KKDSFMLGLLVIDEREMEERDQELSSSEVVN-DSKIEQDVINSKKKVKKVLSFCSVANGI 546

Query: 544 SQEEFKQIERKTAGKWKNTEDHKPPKILEFGSKLPEEWIYPEDSVVLEVKARSLDNTESS 603
           S EEFK+I R+T G WK T D  PP IL+FGS++P EWI P DS+VLE+K+RSLDNTE+S
Sbjct: 547 SHEEFKEINRRTRGHWKRTSDFSPPSILQFGSRIPAEWIEPSDSIVLEIKSRSLDNTETS 606

Query: 604 GRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERR-KKVPLSEDSNNQKPMKSKKIR 662
            R++   CTL+GGYCRRIR DK+WT+CYTL +L+++R  K  P  +D N Q  +  KK +
Sbjct: 607 IRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQLAHKKRK 666

Query: 663 RPRIVSRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNGGKL 722
           R  I    +Q     ++   SSIF GL FYV+SDY+      RI++  L D I  +GGKL
Sbjct: 667 RALISDPFHQI---REQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKHGGKL 723

Query: 723 TFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIEPRHCFS 782
             NVI      G +R+IS K T+EC+ LI+RGYDI+ P W+MDC+    L+ IEP +CFS
Sbjct: 724 IHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPSYCFS 783

Query: 783 VSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVISDVEDIPLFL 842
           VS  + ++A  RVD  GDS++  I+E +L  +  S++  S  S G + + S+ + IPLFL
Sbjct: 784 VSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLS--SIGEIGIDSEAQVIPLFL 841

Query: 843 FSRRIVFIPEGFSYL-DTQLLKHKVRLYGGQLTDNVNQCNLIIVPDGKINLRGRIISDLR 901
           FS RIV+IP   + L + +LL+ K+RL+GG++T   + CNLII+P    + R   I  + 
Sbjct: 842 FSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRKDCIEKVN 901

Query: 902 RLLSTFAAMTELXXXXXXXXXXXXXDRSIEENIQVPEEDFLAV 944
             +      +               D SI EN QVPEEDF  V
Sbjct: 902 EQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVV 944

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score =  991 bits (2562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/959 (51%), Positives = 667/959 (69%), Gaps = 34/959 (3%)

Query: 1   MSTKTDDQNKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVK 60
           M++      +PHNFAPSPDF+WLC+ELF K++ V       G  KS++ +Y+EIIS F +
Sbjct: 1   MASALQAIPEPHNFAPSPDFRWLCEELFAKVEEVLING-TAGTGKSVSFRYYEIISNFTE 59

Query: 61  LWRKTVGDNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRA 120
           LWRKTVG+NIYPALIL LPYRDRRI+NIKDY LI+ +CS+L+LP NS TE+RL  WK+R 
Sbjct: 60  LWRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRV 119

Query: 121 GRGIKLSDFCVEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFK 180
           G+G  LS   VEEI +RR+EP   + IT+D +N  LD+L++E N  GRGFK+L  S  F 
Sbjct: 120 GKGRSLSSLLVEEISKRRTEPTR-KSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFL 178

Query: 181 YCLENMSFTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPS 240
           +CLENM+F E+K++FDI+LK+RVIGGQEHK LNCWHPDA+DYLSVVSDL+ V  KL+DP 
Sbjct: 179 HCLENMTFVELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPD 238

Query: 241 HRLKNDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRK 300
            RLKNDDL + +G  FAP LAK++ +SY+K+   L++DF++EEKMDGERIQ+HYM+YG+ 
Sbjct: 239 IRLKNDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKS 298

Query: 301 LKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVK 360
           +K+FSRRG DYTYLYG ++ +GT+++YL+    V+ECVLDGEM++FD     +LPFGLVK
Sbjct: 299 IKFFSRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVK 358

Query: 361 SSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEII 420
            SA+++L+   I    + PLYMV D LYLNG SL  +PL  RK+YLS+IL P    VEI+
Sbjct: 359 GSAKEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIV 418

Query: 421 QSMHCYDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLD 480
           +   CYD  S+K SLE AI +GSEG++LKH+ S Y + +R +NWIK+KPEYLE+FGENLD
Sbjct: 419 RYSRCYDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLD 478

Query: 481 LLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDK----QVVNLDSEEEE--EPRKAVKKFI 534
           L++IGRD GKKDS M GL V+  DE+   ++D+    +++N  S E     P+K V+K +
Sbjct: 479 LIIIGRDSGKKDSFMLGLLVV--DEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVL 536

Query: 535 SFCTIANGISQEEFKQIERKTAGKWKNTED-HKPPKILEFGSKLPEEWIYPEDSVVLEVK 593
           SFC+IANGISQEEFK+I+RKT G WK T     PP ILEFGSKLP EWI P +S+VLE+K
Sbjct: 537 SFCSIANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIK 596

Query: 594 ARSLDNTESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKV-PLSEDSNN 652
           +RSLDNTE++ +K+   CTL+GGYCRRIR DK+WTECYTL EL++ RR K  P  +  N 
Sbjct: 597 SRSLDNTETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENL 656

Query: 653 QKPMKSKKIRRPRIVSRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSERISKEQLC 712
           Q  +  KK +R  +     Q+    ++   S +F GL FYV+SDY+ S    RI++ +L 
Sbjct: 657 QLQLVPKKRKRALVSDPFQQS---REQKPISGVFAGLFFYVLSDYINSVTGVRITRSELN 713

Query: 713 DLISGNGGKLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFL 772
           D+I  +GGKL  NVI      G +R+I  K T EC+ALI+RGYDIL P+W+MDC     L
Sbjct: 714 DVIVKHGGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKL 773

Query: 773 VTIEPRHCFSVSEDMEKIARTRVDHFGDSYDVEITEDRLR-------DILTSKEFDSDFS 825
           + IEP +CFSVS  +  +AR RVD FGDS++ +I+E +L        D+L++++ D  F 
Sbjct: 774 LPIEPSYCFSVSGKLRAVARRRVDCFGDSFENDISESKLSSLQKSQPDLLSTRQADKSF- 832

Query: 826 TGSLDVISDVEDIPLFLFSRRIVFIPEG-FSYLDTQLLKHKVRLYGGQLTDNVNQCNLII 884
                   +++ IPLFLFS RIV+IP       D  LL+ K+RL+GG++TD  +  NLII
Sbjct: 833 --------ELQIIPLFLFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLII 884

Query: 885 VPDGKINLRGRIISDLRRLLSTF--AAMTELXXXXXXXXXXXXXDRSIEENIQVPEEDF 941
           +P      RG  + ++   ++    A+ ++              D SI EN QVPEEDF
Sbjct: 885 IPYADPIWRGDCLEEVHSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDF 943

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score =  988 bits (2553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/949 (52%), Positives = 660/949 (69%), Gaps = 12/949 (1%)

Query: 1   MSTKTDDQNKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVK 60
           M +  D   +P NFAPSPDFKWLC+ELFVKI  VQ      G  KS + KY+EIIS FV+
Sbjct: 1   MISALDSIPEPQNFAPSPDFKWLCEELFVKIHEVQING-TAGTGKSRSFKYYEIISNFVE 59

Query: 61  LWRKTVGDNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRA 120
           +WRKTVG+NIYPAL+L LPYRDRRI+NIKDY LI+ ICS+L+LP NS TE+RL  WK+R 
Sbjct: 60  MWRKTVGNNIYPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRV 119

Query: 121 GRGIKLSDFCVEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFK 180
           G+G  LS   VEEI +RR+EP + + ITID +N  LD L+ +R   GRGFKSL  S  F 
Sbjct: 120 GKGGNLSSLLVEEIAKRRAEP-SSKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFL 178

Query: 181 YCLENMSFTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPS 240
           +C+ENMSF E+KY+FDI+LK+RVIGGQEHK LNCWHPDA+DYLSV+SDLK V  KL+DP 
Sbjct: 179 HCVENMSFVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPK 238

Query: 241 HRLKNDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRK 300
            RLK+DDL + +G  FAP LAK++ +SY+K+   L  DF +EEKMDGERIQ+HYM+YG  
Sbjct: 239 VRLKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGES 298

Query: 301 LKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVK 360
           +K+FSRRG DYTYLYG  + +GT++++L+    V+ECVLDGEM++FD +   +LPFGLVK
Sbjct: 299 IKFFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVK 358

Query: 361 SSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEII 420
            SA+++L+   I    + PLYMV D LYLNG SL  +PL+ RKQYL++IL+P  + VEI+
Sbjct: 359 GSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIV 418

Query: 421 QSMHCYDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLD 480
           +S  CY   SIK SLE AI +GSEG++LK++ S Y + +R +NWIK+KPEYLE+FGENLD
Sbjct: 419 RSSRCYGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLD 478

Query: 481 LLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSD-KQVVNLDSEEE--EEPRKAVKKFISFC 537
           L+VIGRD GKKDS M GL VL+ +E    Q D  ++V+  S+E+  +  R+ VKK +SFC
Sbjct: 479 LIVIGRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFC 538

Query: 538 TIANGISQEEFKQIERKTAGKWKNTEDHKPP-KILEFGSKLPEEWIYPEDSVVLEVKARS 596
           +IANGISQEEFK+I+RKT G WK T +  PP  ILEFGSK+P EWI P +S+VLE+K+RS
Sbjct: 539 SIANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRS 598

Query: 597 LDNTESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERR-KKVPLSEDSNNQKP 655
           LDNTE++ +K+   CTL+GGYC+RIR DK WT+CYTL +L++ R  K  P  +   +Q  
Sbjct: 599 LDNTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLG 658

Query: 656 MKSKKIRRPRIVSRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSERISKEQLCDLI 715
           +  KK +R  I    +Q      +   S+IF GL+FYV+SDY+      RI++ +L   I
Sbjct: 659 LIRKKRKRVLISDSFHQN---RKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTI 715

Query: 716 SGNGGKLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTI 775
             +GGKL +NVI      G +R+IS K T ECKALI+RGYDIL P W++DC+    L+ I
Sbjct: 716 VEHGGKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILI 775

Query: 776 EPRHCFSVSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVISDV 835
           EP +CF+VS+ M  +A  RVD  GDS++ +I+E +L  +  S+   S    G L++ S+V
Sbjct: 776 EPNYCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSSLYKSQL--SLPPMGELEIDSEV 833

Query: 836 EDIPLFLFSRRIVFIPEGFSYLDTQLLKHKVRLYGGQLTDNVNQCNLIIVPDGKINLRGR 895
              PLFLFS RI ++P      +  +++ K++L+GG++TD  + CNLII+P     LR  
Sbjct: 834 RRFPLFLFSNRIAYVPRRKISTEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKD 893

Query: 896 IISDLRRLLSTFAAMTELXXXXXXXXXXXXXDRSIEENIQVPEEDFLAV 944
            ++++   +      ++              D SI EN QVPEEDF  V
Sbjct: 894 CMNEVHEKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVV 942

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score =  974 bits (2519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/952 (51%), Positives = 641/952 (67%), Gaps = 23/952 (2%)

Query: 5   TDDQNKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVKLWRK 64
           T+D  +PHNF+PSPDFKWLCDELFVK+D +Q + ++    K   ++Y++II+ F+ +WR+
Sbjct: 25  TNDIEEPHNFSPSPDFKWLCDELFVKLDQIQFRPKELNGSKPKYIEYYDIINNFIDIWRR 84

Query: 65  TVGDNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGI 124
           TVG++IYPALIL +PYRDRR++NIK+  LI+ +C +L+LP NS TE+RL+RWK RA R +
Sbjct: 85  TVGNDIYPALILTIPYRDRRMYNIKESKLIRIVCDYLKLPKNSETERRLMRWKHRADRNV 144

Query: 125 KLSDFCVEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFKYCLE 184
           +LS FCVEEI++R+ EP    +ITIDKLNECLD L  ER  KG   + +++S  FK+C E
Sbjct: 145 RLSTFCVEEIKKRKGEPREKIKITIDKLNECLDNLVLERGYKGSKSQKISESETFKFCFE 204

Query: 185 NMSFTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRLK 244
           NM++ E+KY+FDI+LK +++GG EHKFLNCWHPDA+DYLSVVSDLK V+ KLW+P  RLK
Sbjct: 205 NMTYVELKYFFDILLKDKIVGGLEHKFLNCWHPDAQDYLSVVSDLKIVSSKLWNPEFRLK 264

Query: 245 NDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWF 304
            DDL +N+   F P  AKRL  SYD +A RLK+DF+IEEKMDGERIQLHYM+YG KLK+ 
Sbjct: 265 YDDLTINIDHAFTPETAKRLTYSYDTIARRLKNDFFIEEKMDGERIQLHYMNYGAKLKFL 324

Query: 305 SRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSAR 364
           SRRG DY+YLYG++   G + +YL     V+EC+LDGEM+++D+ +N +LPFGLVKSSA 
Sbjct: 325 SRRGLDYSYLYGDNRNNGAIGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAM 384

Query: 365 DSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMH 424
            SL+   I   GY PLYM  D +YLNG SL  +PL+ RK YL  +L PCP  VEI+ ++H
Sbjct: 385 QSLSVSDIEPDGYHPLYMAFDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALH 444

Query: 425 CYDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLVI 484
           C D + IKSSLEKAI +GSEGIILK F S+Y +  R+D+WIKIKPEYLEQFGEN+DL+VI
Sbjct: 445 CNDSSLIKSSLEKAIELGSEGIILKRFDSQYLVAKRSDDWIKIKPEYLEQFGENMDLIVI 504

Query: 485 GRDPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVK----KFISFCTIA 540
           GRDPGKKDSLMCGL +L GD EP     +++ +LDS   +     +K    K ISFC IA
Sbjct: 505 GRDPGKKDSLMCGL-ILTGDNEP-----EEITSLDSNPTDTAESFLKPDKRKIISFCNIA 558

Query: 541 NGISQEEFKQIERKTAGKWKNTEDHKPPK-ILEFGSKLPEEWIYPEDSVVLEVKARSLDN 599
           NGISQ+EF+ I+R T G W   +D  PP+ + EFG+K P EWIYPE SVVLE+KARSL+ 
Sbjct: 559 NGISQKEFRDIDRYTFGHWIKFDDELPPQDLFEFGTKHPIEWIYPEHSVVLEIKARSLET 618

Query: 600 TESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNNQKPMKSK 659
            ES+  K+  G TL GGYCR+IR DK+W  C+T  E  + R  K  L    +N+  +  K
Sbjct: 619 NESARIKYGTGSTLFGGYCRQIRYDKDWVSCFTYNEFMESRNLKNALVNYPDNKNLIGRK 678

Query: 660 KIRRPRIVSRLNQTLSCDDEAKTSS--IFDGLIFYVISDYMASQDSERISKEQLCDLISG 717
           K  + R+ + L +      +A   S  IF GL FYVISDY+   D  R+SK  LC+L+  
Sbjct: 679 KRPKKRMFNSLTEIFENTKDAPDESNVIFRGLHFYVISDYIDETDGSRLSKSDLCNLVLE 738

Query: 718 NGGKLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIEP 777
           + GKL  N IS   +   LRIIS KYT E  +LIERGYDI+ PQW++DC++   LV + P
Sbjct: 739 HNGKLVHNPISRIDILNRLRIISMKYTRETTSLIERGYDIIHPQWILDCISNRKLVRLLP 798

Query: 778 RHCFSVSEDMEKIARTRVDHFGDSYDVEITEDRL-----RDILTSKEFDSDFSTGSLDVI 832
            HCF+VS  + ++ +TRVD +GDSY+  +TE        R +L S+  D   + G   + 
Sbjct: 799 SHCFNVSSSLMEVTKTRVDRYGDSYETSLTEKDFEILINRQVLKSESADKRITEGENHL- 857

Query: 833 SDVEDIPLFLFSRRIVFIPEGFSYLDTQLLKHKVRLYGGQLTDNVNQCNLIIVPDGKINL 892
                IP+ LF  R  FIPE         LK KV LYGG+L + ++ CN+I+  +     
Sbjct: 858 ----KIPILLFCNRRFFIPETLPSTPIYELKSKVELYGGKLVNKISDCNVIVFTNTHTEN 913

Query: 893 RGRIISDLRRLLSTFAAMTELXXXXXXXXXXXXXDRSIEENIQVPEEDFLAV 944
           R  ++  +RR L      +               D  I E +QVPEED+ AV
Sbjct: 914 RKEVMKKIRRALVCLDPNSMQVPVLPRIVDANWIDACISECVQVPEEDYPAV 965

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score =  971 bits (2511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/951 (51%), Positives = 652/951 (68%), Gaps = 15/951 (1%)

Query: 1   MSTKTDDQNKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVK 60
           M +  D   +P NFAPSPDFKWLC+ELF KID VQ +    G  KS + KY+E++S FV+
Sbjct: 1   MVSTLDSVPEPQNFAPSPDFKWLCEELFSKIDEVQVKG-TIGTGKSRSFKYYEVLSNFVE 59

Query: 61  LWRKTVGDNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRA 120
           +WRKTVG+NIYPALIL LPYRDRRI+NIKDY LI+ ICS+L+LP NS TE RL  WK+R 
Sbjct: 60  MWRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRV 119

Query: 121 GRGIKLSDFCVEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFK 180
           G+G  LS   VEEI +RRSEP NG+ ITID +N  LD+L+++R+T GRGFK+L  SS F 
Sbjct: 120 GKGKNLSSLLVEEIAKRRSEP-NGKAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFL 178

Query: 181 YCLENMSFTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPS 240
           +CLE+MSF E+KY+FDI+LKSRVIGGQEHKFL+CWHPDA+DYLSVVSDLK VA KL+DP 
Sbjct: 179 HCLESMSFVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPR 238

Query: 241 HRLKNDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRK 300
            RLKNDDL + +G  FAP LAK++ + Y+K+   L +DF +EEKMDGERIQ+HYM+YG+ 
Sbjct: 239 VRLKNDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKS 298

Query: 301 LKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVK 360
           ++++SRRG DYTYLYG  + +GT++ +L     VRECVLDGEM++FD     +LPFGLVK
Sbjct: 299 VRFYSRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVK 358

Query: 361 SSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEII 420
            SA+D+L+   I    + PLY+V D LYLNG SL  +PL+ RK+YL +IL P  + VE++
Sbjct: 359 GSAKDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMV 418

Query: 421 QSMHCYDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLD 480
           ++  CY+  SIK SLE AI +GSEG++LK++ S Y + +R +NWIK+KPEYLE+FGENLD
Sbjct: 419 RTSRCYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLD 478

Query: 481 LLVIGRDPGKKDSLMCGLAVL---EGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFC 537
           L++IGRDPGKKDS M GL +L   E D+     S     N  +E     +K VKK +SFC
Sbjct: 479 LVIIGRDPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFC 538

Query: 538 TIANGISQEEFKQIERKTAGKWKNTEDHKPP-KILEFGSKLPEEWIYPEDSVVLEVKARS 596
           ++ANGISQEEFK+I+RKT G WK T +  PP  I EFGSK+P EWI P +S+VLE+K+RS
Sbjct: 539 SVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRS 598

Query: 597 LDNTESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNNQKPM 656
           LDNTE++ +K+   CTL+GGYC+RIR DK+WT+C+TL EL+  R  +   S  +      
Sbjct: 599 LDNTETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLK 658

Query: 657 KSKKIRRPRIVSRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSERISKEQLCDLIS 716
             +K RR  + S  N      ++  TS IF GL FYV+SDY+ +    RI++ +L + I 
Sbjct: 659 LVRKKRREVLTS--NTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIV 716

Query: 717 GNGGKLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIE 776
            +GG+L +N+I      G +R+IS K T EC+ALI RGYDIL P W++DCV    L+ IE
Sbjct: 717 RHGGRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIE 776

Query: 777 PRHCFSVSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVISDVE 836
           P +CF+VS+ M  +A  RVD  GDS++ +I+E +L  +  S+           D  ++V+
Sbjct: 777 PCYCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEEVERD--AEVQ 834

Query: 837 DIPLFLFSRRIVFIPE---GFSYLDTQLLKHKVRLYGGQLTDNVNQCNLIIVPDGKINLR 893
             PLFLFS RIV+IP    G  Y  T  L+ K+RL+GG++TD  + CNL+I+P G    R
Sbjct: 835 VFPLFLFSNRIVYIPPRKIGMKYEKT--LEMKIRLFGGKITDRQSLCNLVIIPYGDPTWR 892

Query: 894 GRIISDLRRLLSTFAAMTELXXXXXXXXXXXXXDRSIEENIQVPEEDFLAV 944
              I ++   +       +              D SI  N QVPEEDF  V
Sbjct: 893 KDCIKEVNEQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVV 943

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score =  935 bits (2417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/934 (50%), Positives = 642/934 (68%), Gaps = 19/934 (2%)

Query: 13  NFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVKLWRKTVGDNIYP 72
           NFAPSPDF WLC++LF KID+VQ +  ++   K +T +Y+E+IS F  LWR TVG+NIYP
Sbjct: 24  NFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTLWRTTVGNNIYP 83

Query: 73  ALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGIKLSDFCVE 132
           AL LILPYRDRR+FNIKDYTLIKAIC+FL+LP +S TEK+L+ WK+ AGR ++LS FCVE
Sbjct: 84  ALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSKFCVE 143

Query: 133 EIRRRRSEPL--NGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFKYCLENMSFTE 190
           EI++RRSEP     ERITID LN  LDQLA ER  +GR FK+LA+S +   CL +M+F E
Sbjct: 144 EIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFKNLANSDIMNKCLTSMTFLE 203

Query: 191 MKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRLKNDDLGV 250
           M+Y+FDI+LK+R +GG EHK LNCWHPDA+DYLSVVSDL+TVA +LWDPS RL N DL +
Sbjct: 204 MQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQDLKI 263

Query: 251 NLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRRGND 310
           N+GL FAP LA +L++SY K+  +L  DF+IEEKMDGERIQ+HY ++G  +K++SRR  D
Sbjct: 264 NIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATD 323

Query: 311 YTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAE 370
           YTYLYG ++ TGT+A ++ L+  V++CVLD E+++FD+    VLPFG+VKSSA++ L+ +
Sbjct: 324 YTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQD 383

Query: 371 GILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTS 430
           GI TQG+ PL MV D LYLNG +L+++P   R++YL  IL P  H +EII+S+   D+  
Sbjct: 384 GIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQM 443

Query: 431 IKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDPGK 490
           IK SLEKA+ +GSEGIILK + S+Y I +R+D+WIKIKPEYLEQFGEN+DL+++GRDP K
Sbjct: 444 IKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGRDPSK 503

Query: 491 KDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEFKQ 550
           KDSLM GL     D E   Q    +VN  S EE   R   + F+S C IANGIS EE+K+
Sbjct: 504 KDSLMLGLL----DYEEVIQDSPIMVNSQSSEENSQR--FRGFVSLCIIANGISNEEYKE 557

Query: 551 IERKTAGKWKNTEDHKPPKILEFGSKLPEEWIYPEDSVVLEVKARSLDNTESSGRKFKVG 610
           I+RKT G W ++E   P + ++FGSK+P +WI P+ S++LE+KARSLDNT SS RKF  G
Sbjct: 558 IDRKTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNTRSSERKFAAG 617

Query: 611 CTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNNQKPMK--SKKIRRPRIVS 668
           CTL GGYCR+IREDKNW  CYTL E   ER K         + KP K  SKK RR  I+S
Sbjct: 618 CTLFGGYCRQIREDKNWKTCYTLQEF--ERAKSGNNWRKRGSSKPQKVISKK-RRYNIIS 674

Query: 669 RLNQTLSCDDEAK-TSSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNGGKLTFNVI 727
            +N+ L    E +  S IFDG+ FYV+SDY      +RI K ++  +I  NGG+L  NVI
Sbjct: 675 SVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIVANGGQLVQNVI 734

Query: 728 SDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIEPRHCFSVSEDM 787
           + +     LRIIS + T+EC +LI RGYDI+SP+W+ DC+ +G ++ +EP HCF+ S+ +
Sbjct: 735 TRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLEPSHCFNFSKQL 794

Query: 788 EKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVISDVEDIPLFLFSRRI 847
              A  R+D +GD Y+ +I +     + + K   +      +   + + D+P FLF  RI
Sbjct: 795 MDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQFDNSLMDVPHFLFHGRI 854

Query: 848 VFIPEGFSYLDTQLLKHKVRLYGGQLTDNVNQCNLIIVPDGKINLRGRIISDLRRLLSTF 907
           VF+    +  + Q     V  YGG++T+ ++  NL+IV      +  R I+D+R+ +S+ 
Sbjct: 855 VFLLSDNN--NIQKESFMVDAYGGKVTNELSSANLVIVVGA---VTQRRINDIRKQISSE 909

Query: 908 AAMTELXXXXXXXXXXXXXDRSIEENIQVPEEDF 941
               +                 I++N QV E+++
Sbjct: 910 VIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  934 bits (2414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/954 (50%), Positives = 646/954 (67%), Gaps = 24/954 (2%)

Query: 8   QNKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVKLWRKTVG 67
           + +P NF+PSPDFKWLC+ELFVK+D V+ + +     +   ++Y  +I+ F+ LWR TVG
Sbjct: 13  EREPRNFSPSPDFKWLCNELFVKLDEVRLKPKSVDT-RPKNIQYDIVINNFIHLWRVTVG 71

Query: 68  DNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGIKLS 127
           ++IYPAL LILPYRDRR + I+++TLI+ +C +L+L  NSVTE+RL RWK++A R I LS
Sbjct: 72  NDIYPALRLILPYRDRRNYYIREHTLIRIVCDYLKLQKNSVTEQRLRRWKQKARRSINLS 131

Query: 128 DFCVEEIRRRRSEPLNGERITIDKLNECLDQLAEERN----TKGRGFKSLADSSVFKYCL 183
            FC++EI++R SEP++ E+ITIDKLN  LD L+ ER+    T G   K L+     KYC 
Sbjct: 132 SFCIQEIKKRLSEPVSKEKITIDKLNSILDSLSMERSSSKITNGSSGKKLSQLESIKYCF 191

Query: 184 ENMSFTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRL 243
           ENMSF E++Y+FDI++K+R+IGG EHKFLN WHPDA DYLSVVS+L  V +KLW+P+ RL
Sbjct: 192 ENMSFIELEYFFDILIKARLIGGLEHKFLNAWHPDANDYLSVVSELNIVTEKLWNPNFRL 251

Query: 244 KNDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKW 303
            + DL + L   F P LAK++ +SY+ ++ R+ + F IEEKMDGERIQ+HYMDYG ++K+
Sbjct: 252 NSKDLTIALHNAFEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKY 311

Query: 304 FSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSA 363
           FSRRGNDYTYLYG+D  T T++KYLQL+  V+EC+LDGEM+S+D   N +LPFG+VKS A
Sbjct: 312 FSRRGNDYTYLYGKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGA 371

Query: 364 RDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSM 423
            +SL  +G+      PL++V D L+LNG  L N+PL  RK+YLS IL P    +EI++  
Sbjct: 372 ANSLKIDGLENDLCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFS 431

Query: 424 HCYDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLV 483
             +D  SI+S+L+ AI +GSEGI+LK + S Y +G R ++WIK+KPEYLEQFGENLDL+V
Sbjct: 432 IAHDSESIRSALQAAISVGSEGIVLKKYDSLYSVGDRNNDWIKVKPEYLEQFGENLDLIV 491

Query: 484 IGRDPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEE--------EEEP--RKAVKKF 533
           IGRDPGKKDSLMCG+AVLE +E       ++V+ L S++        E++P   K + KF
Sbjct: 492 IGRDPGKKDSLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKRITKF 551

Query: 534 ISFCTIANGISQEEFKQIERKTAGKWKNTEDHKPPK-ILEFGSKLPEEWIYPEDSVVLEV 592
           ISFC IANGIS EEFK+I+RKT G WK   D  PP   LEFG++LP EWI P DSVVLEV
Sbjct: 552 ISFCVIANGISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVVLEV 611

Query: 593 KARSLDNTESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNN 652
           KARSL+N E+   KFK G TL+G YCRRIR DK++ +CYT  +L     KK   SE   N
Sbjct: 612 KARSLENNEALRDKFKTGYTLYGAYCRRIRTDKDFNDCYTFSDLVIATNKKRSSSELYGN 671

Query: 653 QKPMKSKKIRRPRIVSRLNQTLSC--DDEAKTSSIFDGLIFYVISDYMASQDSERISKEQ 710
              +K K+ R  + V+ LNQTLS   DD   TS IFDGL F+VISDY+ S  S R+  ++
Sbjct: 672 HSHIKKKRSRTSK-VNMLNQTLSIQDDDTGFTSKIFDGLSFFVISDYVDSNSSFRLRIDE 730

Query: 711 LCDLISGNGGKLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTG 770
           L ++I  NGG+L FN++S +  +  +RI+S K T EC  LI+RGYDI+ P+W++DC+   
Sbjct: 731 LINIIKVNGGQLIFNLVSQNLNEKYVRIMSCKKTFECNELIKRGYDIIHPKWILDCIAND 790

Query: 771 FLVTIEPRHCFSVSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLD 830
            L+  EP HCF+VS+ +  I++ RVD  GDSY   ITE+ L  +++SK       +  L 
Sbjct: 791 KLLDFEPSHCFNVSQSLSTISKQRVDLLGDSYQKYITEEELELLISSKTPKEQLYSNPLQ 850

Query: 831 VISDVEDIPLFLFSRRIVFIPEGFSYLDTQLLKHK---VRLYGGQLTDNVNQCNLIIVPD 887
               +E IP+FLFS +  + P+       +LLK     ++LYGG   +N+N CN+II+ D
Sbjct: 851 FDQQIEKIPIFLFSNKKAYTPK--QCFSEKLLKETNLYIKLYGGTSVNNINDCNVIIIGD 908

Query: 888 GKINLRGRIISDLRRLLSTFAAMTELXXXXXXXXXXXXXDRSIEENIQVPEEDF 941
                    IS +R+ LS  A  +               ++SI +  QV EEDF
Sbjct: 909 EHSKSSNEKISSIRKELSIHAVSSNNVIPIPRIVSYKWIEKSIAQGTQVVEEDF 962

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score =  931 bits (2407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/959 (50%), Positives = 650/959 (67%), Gaps = 27/959 (2%)

Query: 1   MSTKTDDQNKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVK 60
           MS K ++   P NFAPSPDF+WLCDELFVK D V  Q R     K +TV+Y+E++S FV+
Sbjct: 1   MSEKVEE--GPTNFAPSPDFQWLCDELFVKFDLVATQDR-RINLKPITVRYYEVVSNFVQ 57

Query: 61  LWRKTVGDNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRA 120
           LWRKTVG+N YP LIL LPYRDRR +NIKD TLIKAIC +L LP  S TEK+LL WK+RA
Sbjct: 58  LWRKTVGNNFYPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRA 117

Query: 121 GRGIKLSDFCVEEIRRRRSEPLNGER--ITIDKLNECLDQLAEERNTKGRGFKSLADSSV 178
            R  +LS FCV EIR+R+S P   +R  IT+DKLN  LD LA  ++++G+G ++LADSS 
Sbjct: 118 SRNERLSSFCVAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSH 177

Query: 179 FKYCLENMSFTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWD 238
           FK+CLENMSF E+KY+FDI+LK R+IGG EHK LN WHPDA DY SVVSDL +V  KL++
Sbjct: 178 FKFCLENMSFIELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYE 237

Query: 239 PSHRLKNDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYG 298
           PS RL+N+DL + +G  FAP LAKRL ISY+K+  +L SDF IEEKMDGERIQ+HYMDYG
Sbjct: 238 PSVRLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYG 297

Query: 299 RKLKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGL 358
            ++K+ SRRG DYTYLYG D  TGT+A YL+L+  V+EC+LDGEM+++D E+  +LPFGL
Sbjct: 298 NEIKFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGL 357

Query: 359 VKSSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVE 418
           VKSSA++ L+ E I    Y PL+M  D +YLNG SL+++PL  RK YLS IL  C   V+
Sbjct: 358 VKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVD 417

Query: 419 IIQSMHCYDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGEN 478
           I+    C +  SI  SL  AI +GSEGIILK   S+Y + +R D+WIKIKP+YL+QFGEN
Sbjct: 418 IVSFARCNNLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGEN 477

Query: 479 LDLLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLD----SEEEEEPRKA-VKKF 533
           +DL++IGRDPGKKD+ MC L V   D +P     ++ VNLD      E E P+ + + KF
Sbjct: 478 MDLIIIGRDPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKF 537

Query: 534 ISFCTIANGISQEEFKQIERKTAGKWKNTEDHKPP-KILEFGSKLPEEWIYPEDSVVLEV 592
           +SFCTIANGIS  EFK+I++KT G W+  +  KPP + L+FG+K P EWI P++S+VLEV
Sbjct: 538 VSFCTIANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEV 597

Query: 593 KARSLDNTESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNN 652
           K+RSLDNTES+ +K++ G TL GGYCR +R DK+WT CYT+ E  ++R+ K+P  + +  
Sbjct: 598 KSRSLDNTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLP--KVNAG 655

Query: 653 QKPMKSKKIRRPRIVSRLNQTLSC----DDEAKTSSIFDGLIFYVISDYMASQDSERISK 708
           +    S K R+ R  + +   +S       E + S IF  L F V+SDY+      RI +
Sbjct: 656 ESITTSNKGRKKRNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDR 715

Query: 709 EQLCDLISGNGGKLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVN 768
             L  LI   GGK+ +NV++    +G LRII   + +EC ALI+RGYDILSP W++DC+ 
Sbjct: 716 NTLTQLIIDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIE 775

Query: 769 TGFLVTIEPRHCFSVSEDMEKIARTRVDHFGDSYDVEITE---DRLRDILTSKEFDSDFS 825
           +  L+ +E  HCF+VS+++ +++ TRVD + DS++ EI+    DRL D+         FS
Sbjct: 776 SARLLKLERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFS 835

Query: 826 TGSLDVISDVEDIPLFLFSRRIVFIPEGFSYLDTQL---LKHKVRLYGGQLTDNVNQCNL 882
             +LD   ++  +P  LF  R VFI E  + L  ++   +  + +L+GGQ+T  +  CNL
Sbjct: 836 GENLDF--ELRGLPPLLFFDRSVFIAE--TKLSDRIYAKISSETKLFGGQVTHTIEDCNL 891

Query: 883 IIVPDGKINLRGRIISDLRRLLSTFAAMTELXXXXXXXXXXXXXDRSIEENIQVPEEDF 941
           II+P+     + +++  +R  L++                     +SI+ENIQVPEE++
Sbjct: 892 IIIPNTDDEDKIQVLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENY 950

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score =  918 bits (2373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/918 (49%), Positives = 627/918 (68%), Gaps = 20/918 (2%)

Query: 2   STKTDDQNKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAF----KSLTVKYFEIISF 57
           +TK      P NFAPSPDFKWLCDELFVKID +++Q ++  A     K ++ +YF+ I+ 
Sbjct: 14  TTKESPATTPKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITH 73

Query: 58  FVKLWRKTVGDNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWK 117
           F+KLWR T+GD+I+PAL LILPYRDRR++NIKD TLI+AICS+L+LP NSV E+RL+RWK
Sbjct: 74  FIKLWRTTIGDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWK 133

Query: 118 RRAGRGIKLSDFCVEEIRRRRSEP--LNGERITIDKLNECLDQLAEER-NTKGRGFKSLA 174
            +A R   L+ FC+ EI +R++EP     ERI+IDKLNE LD L   R N   +   +L 
Sbjct: 134 YKADRYETLATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRSNLL 193

Query: 175 DSSVFKYCLENMSFTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVAD 234
               FK+CLENM+F E+KY+FDII+K++++G  E+ FL  WHPD+++YLSVVSDL+T+++
Sbjct: 194 QVETFKFCLENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSN 253

Query: 235 KLWDPSHRLKNDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHY 294
           KLW+PS ++ N DL + +G  FAP LAKRL +SYD ++ RL +DF+IEEKMDGERIQLHY
Sbjct: 254 KLWNPSIKINNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHY 313

Query: 295 MDYGRKLKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVL 354
           M+YG  +K+FSR G DYTYLYG D   GT+AK+L+L   V+ECVLDGEM++FD+    VL
Sbjct: 314 MNYGETVKFFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVL 373

Query: 355 PFGLVKSSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCP 414
           PFGLVKSSA   L  + I    + PL+MV D LYLNG SLI++PL  RK++L+ +L P  
Sbjct: 374 PFGLVKSSASSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYK 433

Query: 415 HAVEIIQSMHCYDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQ 474
             VEI+ S+ C D   IK  L+ AI +GSEGI+LK + SKY   AR +NWIK+KPEYLE+
Sbjct: 434 DYVEILSSIRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEE 493

Query: 475 FGENLDLLVIGRDPGKKDSLMCGLAVLEGDEEPGA----QSDKQVV--NLDSEEEEEPRK 528
           FGEN+DL+VIGRD GKKD L+CG+ V E  +E       +S+ +++  + D + + +P +
Sbjct: 494 FGENMDLIVIGRDSGKKDCLICGILVTEEKQELSENMKRESEIEIISDSGDDDLDTKPSQ 553

Query: 529 AVKKFISFCTIANGISQEEFKQIERKTAGKWKNTEDHKPP-KILEFGSKLPEEWIYPEDS 587
            +KK ISFCTIANG+SQ E K+I R T G WKN  +  PP  +LEFG+K P EWIYP+DS
Sbjct: 554 GIKKVISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDS 613

Query: 588 VVLEVKARSLDNTESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLS 647
           VVLE+KARSLD T+ +  K+  GCTL+GGYCR+IR+DK+WT CYTL++L     K+    
Sbjct: 614 VVLEIKARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEIKRHE-K 672

Query: 648 EDSNNQKPMKSKKIRRPRIVSRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSERIS 707
           ++ N Q  ++S   ++ +I+S      +  D    S +F GL FY+ISDY+   D++RI 
Sbjct: 673 KNKNKQTLIRSYSRKKSKIISPAGMLPNGTDLRLISDLFHGLYFYIISDYIPDSDAQRID 732

Query: 708 KEQLCDLISGNGGKLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCV 767
           +E +C LI  NGG++ +NVI+       LRI+S K T+EC  L+ RGYD+++  WL DC+
Sbjct: 733 REDICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDCL 792

Query: 768 NTGFLVTIEPRHCFSVSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTG 827
             G ++ +EP HC  VS ++  IA  R+D FGDSY+  + + +L  +L S     + S  
Sbjct: 793 QAGVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATLIDSKLLKLLDSNINKVNRSNS 852

Query: 828 SLDVISD---VEDIPLFLFSRRIVF-IPEGFSYLDTQLLKHKVRLYGGQLTDNVNQCNLI 883
           +L +I+    V+ IP+FLF+ R  F I E     D   L  +++LYGG L   +  CN+I
Sbjct: 853 NLLLINKDEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGGSLVTKLEDCNII 912

Query: 884 IVPDGKINLRGRIISDLR 901
           +   G   L  + + DLR
Sbjct: 913 VGVCGS-QLVNKKLGDLR 929

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/946 (48%), Positives = 632/946 (66%), Gaps = 30/946 (3%)

Query: 8   QNKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVKLWRKTVG 67
           Q KP NFAPSPDF+WLCDELF K++ + +  +  G  K++TVK  E+I +F+KLWR TVG
Sbjct: 33  QKKPQNFAPSPDFRWLCDELFSKLEEITEDRQKLG--KAVTVKRVEVIMYFIKLWRTTVG 90

Query: 68  DNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGIKLS 127
           DNIYP L LILPYRD R +NIKDYTL+KA+C  L LP +S+TEKRLL WK+ A RG  LS
Sbjct: 91  DNIYPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLS 150

Query: 128 DFCVEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFKYCLENMS 187
            FCVEEI +RR EP   +R+TID LN+CLD+L++E + K  GF  L+ S  F+ CL+NMS
Sbjct: 151 KFCVEEIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKWGFNGLSKSPSFQNCLQNMS 210

Query: 188 FTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRLKNDD 247
           F+E +Y+FDIILK+RVIGG EHKFLNCWHPDA+DYL VVSDLK +++ LW+P+ RL  ++
Sbjct: 211 FSEQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLGKNE 270

Query: 248 LGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRR 307
           L +N+G  FAP LAKRL++SY++V  +LK DF IEEKMDGERIQLHY++ G K+++ SRR
Sbjct: 271 LSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRR 330

Query: 308 GNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSL 367
           G D+T+LYG+ +  G ++++L+    V++CVLDGEM+SFD E+N VLPFG+VKS+A + L
Sbjct: 331 GTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAMEEL 390

Query: 368 --TAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHC 425
             +   + T GYRPLYM+ D +YLNGVSL  +PL+ RK YL +IL+P  + VEI+  +  
Sbjct: 391 MNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDVRA 450

Query: 426 YDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIG 485
            +  +IK SLE+AI MGSEGIILK F S YEIGAR D+WIKIKPEY E+ GE +DL+VIG
Sbjct: 451 SEPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVVIG 510

Query: 486 RDPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEE-EPRKAVKKFISFCTIANGIS 544
           RDPGKKDSLMCGL + +       ++D   VNL S+++   P++   K ISFC IANG+S
Sbjct: 511 RDPGKKDSLMCGLILAD-------ETDGSSVNLASQDDPLRPKQRNPKVISFCNIANGVS 563

Query: 545 QEEFKQIERKTAGKWKNTEDHKPPK-ILEFGSKLPEEWIYPEDSVVLEVKARSLDNTESS 603
             EFK+IERKT G W  T    PP  +LEFG+KLP EWI P  S+VLEVKARS+D  E S
Sbjct: 564 DAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKARSVDTDELS 623

Query: 604 GRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNNQKPMKSKKIRR 663
            +K+K G TL G YCR +R +K+W+ C T+ +  Q +R      +       +  +K R+
Sbjct: 624 SKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAH-NYHKGKRKSHQISPRKQRK 682

Query: 664 PRIVSRLNQTLSCDDEAKT--SSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNGGK 721
              VS L   L+ D       S+IF GL FY++SDY+ SQ  +R  K+Q+  L+  N G 
Sbjct: 683 LANVSELYPLLADDSRESIFESNIFQGLQFYILSDYIDSQ-KKRYEKDQIGTLVRKNSGH 741

Query: 722 LTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIEPRHCF 781
           +  N          LRIISGK T+EC++L E+GYDI+ P W+ DC+N G LV +EPRHCF
Sbjct: 742 VLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKLEPRHCF 801

Query: 782 SVSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVISDVEDIPLF 841
             S  + + +R RVD FGDS+   ++     +++  +   S      L    +++ IPLF
Sbjct: 802 RTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVSP----HLSAPEELDGIPLF 857

Query: 842 LFSR-RIVFIPEGFSYLDTQLLKHKVRLYGGQLTDNVNQCNLIIVPDGKINLRG-----R 895
           LF   +I F   G      + L+  +RL+GG+ +  ++ CNL++V   +++ +      +
Sbjct: 858 LFQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVV---RVSFKEQKKLFK 914

Query: 896 IISDLRRLLSTFAAMTELXXXXXXXXXXXXXDRSIEENIQVPEEDF 941
           ++  LR+ +++ A  +E+             +  I E   VPEEDF
Sbjct: 915 LVEGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDF 960

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score =  861 bits (2225), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/968 (45%), Positives = 629/968 (64%), Gaps = 55/968 (5%)

Query: 3   TKTDDQNKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVKLW 62
           T    +N+PHNFAPSPDF+WLC+ELF ++D + +  ++ G  K++TVK  EII+ F+KLW
Sbjct: 13  TSKISENEPHNFAPSPDFRWLCEELFHRLDAINEHRQELG--KAVTVKRVEIITCFIKLW 70

Query: 63  RKTVGDNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGR 122
           R TVGD+ +PAL L+ PYRD R ++IKD+TLIKA+C  L L  +S+TE+RLL WK+ AGR
Sbjct: 71  RTTVGDDFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGR 130

Query: 123 GIKLSDFCVEEIRRRRSEPLNGERITIDKLNECLDQLAEERN-TKGRGFKSLADSSVFKY 181
           G  LS FCV+EI +RR EPL   ++TID LNE LD+LA+E +  K  G   L++S  F++
Sbjct: 131 GTSLSKFCVQEISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTTGLSESHSFQF 190

Query: 182 CLENMSFTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSH 241
           CL+N+SF E++Y+FDI+LK+RVIGG EHKFL CWHPDA+ YL VV+DLK ++ KLW+PS 
Sbjct: 191 CLKNLSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSV 250

Query: 242 RLKNDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKL 301
           RL   DL +N+G  FAP LAKRL++SY+++  +LK DF +EEKMDGERIQLHY++ G  L
Sbjct: 251 RLDKRDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVL 310

Query: 302 KWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKS 361
           K+ SRRG D+++LYG+++  G +++YL+L   VR+CVLDGEM+S+D +   +LPFG+VKS
Sbjct: 311 KFLSRRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKS 370

Query: 362 SARDSL--TAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEI 419
           +A D L  +  G    GYRPLYMV D +YLNGVSL  VPL+ RK+YL  IL+P P  VEI
Sbjct: 371 AAVDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEI 430

Query: 420 IQSMHCYDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENL 479
           ++ +   D  +IK+ +++AI MGSEG+I+K   S YE+GAR D+W+KIKPEY E  GE +
Sbjct: 431 LKGIRACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETM 490

Query: 480 DLLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTI 539
           DL+VIGRDPGKKDSLMCGL V        + S+  + N    E  +    + K +SFC +
Sbjct: 491 DLVVIGRDPGKKDSLMCGLLV--------SDSEHILENFGPIEHGKEGDPIIKCVSFCNV 542

Query: 540 ANGISQEEFKQIERKTAGKWKNTEDHKPP-KILEFGSKLPEEWIYPEDSVVLEVKARSLD 598
           ANG+S EEFK+I RKT G W + ++  PP  +LEFGSK+P EWI P++SVV+EVKARS++
Sbjct: 543 ANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVE 602

Query: 599 NTESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNNQKPMKS 658
           N+E S ++++ G TLH  YCRRIR DK+WT C ++ +  Q        ++ ++N    K 
Sbjct: 603 NSEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQ--------AKAAHNYHRYKR 654

Query: 659 K----KIRRPRIVSRLNQTLSCDDEAKT------SSIFDGLIFYVISDYMASQDSERISK 708
           K      RR R V  + +   C  EAK+      SSIF+GL FY++SDY+ SQ   R  +
Sbjct: 655 KVHQVSPRRKRNVHEIFEY--CAGEAKSELDTEGSSIFEGLHFYILSDYVTSQ-RRRYER 711

Query: 709 EQLCDLISGNGGKLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVN 768
             +   +  +GG +  N+         LRI+SGK T+EC+ L+ RGYDI+ P W+ DC++
Sbjct: 712 GMVAAKVVKHGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCIS 771

Query: 769 TGFLVTIEPRHCFSVSEDMEKIARTRVDHFGDSYDVEITEDRLRDIL-----TSKEFDSD 823
            GF + IEP+HCF  S  +   +R RVD +GDS+   +     + +      +  +F S 
Sbjct: 772 AGFQLGIEPKHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLFKFFCSSPSDFSSR 831

Query: 824 FSTGSLDVISDVEDIPLFLFSRRIVF------IPEGFSYLDTQLLKHKVRLYGGQLTDNV 877
            S+   D   D+++ PLFL  R  ++      IP+ FS     +L+ K+ LYGG +++ +
Sbjct: 832 ISSMLQD---DLDEAPLFLLQRFKIYVLAADLIPQQFS-----ILRRKIELYGGVVSETL 883

Query: 878 NQCNLIIVPDGKINLR-GRIISDLRRLLSTFAAMTELXXXXXXXXXXXXXDRSIEENIQV 936
              NL++VP      R    + +LR+ ++  A                  D    E   V
Sbjct: 884 EGANLVLVPSALSTARTAYYVQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLV 943

Query: 937 PEEDFLAV 944
           PEEDF ++
Sbjct: 944 PEEDFSSI 951

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/897 (46%), Positives = 575/897 (64%), Gaps = 70/897 (7%)

Query: 9   NKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVKLWRKTVGD 68
           N   NF+PSP+FKWLCDEL  KI   +  ++ H   K +TV+Y EII+ F+KLWR TVG+
Sbjct: 2   NDCENFSPSPEFKWLCDELLGKI--YETSSKKHLIGKPVTVRYLEIITNFIKLWRSTVGN 59

Query: 69  NIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGIKLSD 128
            IYPAL LI+P+RDRRI+N+K+ TLIKA+C +LRLP +S TE RLLRWK+RA RG+KLSD
Sbjct: 60  YIYPALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSD 119

Query: 129 FCVEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFKYCLENMSF 188
           FCVEEIR+R+ +     RITID+LN  LD++++E N K  G+ +L DS  F YCL +M+F
Sbjct: 120 FCVEEIRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTF 179

Query: 189 TEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRLKNDDL 248
            EMK++FDIILK+RV+ G E+ FL  WHPDA DYLSVVSDL  ++ +L++P+ RL+  DL
Sbjct: 180 MEMKFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDL 239

Query: 249 GVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRRG 308
            + +   F P LAKR ++SY++VA +L+ DF IEEKMDGER+Q+HY++YG ++K+ SRRG
Sbjct: 240 SITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRG 299

Query: 309 NDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLT 368
            D++YLYGE+  +G ++  L+L   V++C+LDGEMI++DTE++ VLPFGLVKSSA + + 
Sbjct: 300 VDFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQ 359

Query: 369 AE--GIL-TQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHC 425
           +E  GI  T+ Y+PL++  D +YLNG SL N+ L  RK YL+ IL P   +VEIIQ M  
Sbjct: 360 SELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKA 419

Query: 426 YDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIG 485
            +  +IK SLE+AI MGSEGI+LKH  SKY +G+R  +WIKIKPEYLEQFGEN+DLL+IG
Sbjct: 420 INAEAIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIG 479

Query: 486 RDPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIANGISQ 545
           R+ GKKDS  CGL++ + +E                  E+PR     FISFCTIANG+S 
Sbjct: 480 REQGKKDSFFCGLSISDPNEVA----------------EKPR-----FISFCTIANGLSN 518

Query: 546 EEFKQIERKTAGKWK-NTEDHKPPKILEFGSKLPEEWIYPEDSVVLEVKARSLDNTESSG 604
           EEFK IERKT GKW   +ED   P +L FG+K+P EWI+PEDSVVLEVKAR++D  ES  
Sbjct: 519 EEFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEK 578

Query: 605 RKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNNQKPMKSKKIRRP 664
           RK++ GCTLH GYC++IR DK+W    +  E    +  +   ++  ++Q     K+  + 
Sbjct: 579 RKYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKRKSHQVTDGKKRASKR 638

Query: 665 RIVSRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNGGKLTF 724
             +  +N +      A  S+ F    F VISDY  S    RIS+E LC +I  +GG++ +
Sbjct: 639 AKIGIVNSSEPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGEIVY 698

Query: 725 NVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIEPRHCFSVS 784
               ++  +  L II  K T ECK L+     I+ P W+  C+  G+             
Sbjct: 699 TSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGY------------- 745

Query: 785 EDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVISD---------- 834
               K   T  D F            L   +   +F +DF+T SL+ + +          
Sbjct: 746 ----KTPFTESDIF---------RGELESSMDCSQFYTDFNTASLNHLLETANRGIKNPD 792

Query: 835 ----VEDIPLFLFSRRIVFIPEGFSYLDTQLL--KHKVRLYGGQLTDNVNQCNLIIV 885
               + ++PLFLFS   + +    + LDT +L  +  ++ +GG+L  ++   ++IIV
Sbjct: 793 SDLLLPEVPLFLFSNLKLAVLNSENVLDTSILEVEFAIKCHGGELV-HIENASIIIV 848

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/889 (45%), Positives = 573/889 (64%), Gaps = 29/889 (3%)

Query: 11  PHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVKLWRKTVGDNI 70
           P NF+PSPDF WLCDELF+K++ V  + +D G  K   V+  EI S FV LWRKTVG++I
Sbjct: 51  PINFSPSPDFCWLCDELFIKLEEVALKKKDLG--KPRKVRNLEITSNFVSLWRKTVGNDI 108

Query: 71  YPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGIKLSDFC 130
           YPAL+L LPY DRR + +KD TL+KA+C  ++LP NS TE+RLL WK+ A RG+KLS FC
Sbjct: 109 YPALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFC 168

Query: 131 VEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFKYCLENMSFTE 190
           VEE+++RR EP+  +R++ID++N  LD+L  E N     + SLA+S  F YCLE+MS+ E
Sbjct: 169 VEELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYVE 228

Query: 191 MKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRLKNDDLGV 250
           ++++FDI+LK  ++ G E   L+CWHPDA  Y  VVSDL+ VA  L+DP+ RL+ +DL V
Sbjct: 229 LRFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLSV 288

Query: 251 NLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRRGND 310
            +G  FAP +A+R+ I Y+KV+ +L +DFY+EEKMDG+RIQ+HYMDYG  + +FSR G +
Sbjct: 289 RIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGIN 348

Query: 311 YTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAE 370
           YTYLYGE+   G+++ +L+    V+EC+LDGEM+S+D E   +LPFGL KS A   +  E
Sbjct: 349 YTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFE 408

Query: 371 --GILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDD 428
             G     YRPLY V D LYLNG  L N  +  RK+YL  IL P  + V ++    C D 
Sbjct: 409 TTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDA 468

Query: 429 TSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDP 488
            +I ++L  A+  GSEGI+LK  +SKY +G R D+WIKIKPEYLE FGEN+DL+VIGRD 
Sbjct: 469 EAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRDK 528

Query: 489 GKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEE---EPRKAVKKFISFCTIANGISQ 545
           G+KDS +C LAV +  E+    S +   + DS+ E    +P+  ++KFISFC+IANGIS 
Sbjct: 529 GRKDSFICALAVTDDSEKNNPSSYESGSDSDSDSEPIIVQPK--IEKFISFCSIANGISN 586

Query: 546 EEFKQIERKTAGKWKNTEDHKPPK-ILEFGSKLPEEWIYPEDSVVLEVKARSLDNTESSG 604
           EEFK+I+R T G W   ++ KPP   +EFG+K P EWI P++SVVLEVKARS+DN ES  
Sbjct: 587 EEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDNEESKS 646

Query: 605 RKFKVGCTLHGGYCRRIREDKNWTECYTL--YELWQERRKKVPLSEDSNNQKPMKSKKIR 662
             +K G TL+  YC+RIR DKNW+   T+  Y+  +E R    +S+++   K   S + R
Sbjct: 647 DLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAKFGKDRSSPRKR 706

Query: 663 RP-RIVSRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNGGK 721
           R   +V  ++ T     +   +    G  FYV S Y   Q  + I   ++ + +   GG 
Sbjct: 707 RTFHLVGDIDVT-----KPSKADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGGT 761

Query: 722 LTFNVISDHRVKGG---LRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIEPR 778
              N+    R++     L I+  K T E K LIERGYDI+ P+WLMDCV  G ++ IEP+
Sbjct: 762 YIHNL----RIRASLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPK 817

Query: 779 HCFSVSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVISDVEDI 838
           + +S SE++ K AR + D +G+SY + +TED L+ +   +  +   S    D +S+ E  
Sbjct: 818 YVYSASEELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGYASEMGTDAVSEYER- 876

Query: 839 PLFLFSRRIVFIPEGFSYLD--TQLLKHKVRLYGGQLTDNVNQCNLIIV 885
            L +F   + +I + ++Y    + ++K  +   GG++T+++    +++ 
Sbjct: 877 -LLIFKGWLFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATIVVA 924

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  117 bits (294), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 108/399 (27%), Positives = 183/399 (45%), Gaps = 47/399 (11%)

Query: 253 GLPFAPFLAKRLYISYDKVALRLKSD-FYIEEKMDGERIQLHYMDYGRKLKWFSRRGNDY 311
           G+P  P LAK    S  +V  R +   F  E K DGER Q+H M+ G  ++ +SR   + 
Sbjct: 330 GIPLKPMLAKPTK-SITEVLDRFQGQRFTCEYKYDGERAQVHLMEDG-TIRIYSRNSENM 387

Query: 312 TYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEG 371
           T  Y E        ++L      R  ++D E +++D E+  +LPF ++ +  R  +  + 
Sbjct: 388 TERYPEI----QFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKD 443

Query: 372 ILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSI 431
           +     R      D LYLNG SL+   L  R+++L ++L   P  ++    +   + + +
Sbjct: 444 VKV---RVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSEL 500

Query: 432 KSSLEKAIMMGSEGIILKHF---KSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDP 488
           ++ LE+++    EG+++K     +S+YE   R+ NW+K+K +YLE  G++LDL V+G   
Sbjct: 501 QTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGAYY 560

Query: 489 GKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEF 548
           G+          L G             N D EE          F + C I  G S+E  
Sbjct: 561 GRGKRTGTYGGFLLG-----------CYNPDLEE----------FETCCKIGTGFSEEVL 599

Query: 549 KQIERKTAGKWKNTEDHKPPKILEF-GSKLPEEWIYPEDSVVLEVKAR--SLDNTESSGR 605
           + +      + K+T    P   + +  S  P+ W  P  +++ EV     SL     +GR
Sbjct: 600 QSLH----AQLKDTVIAAPRGDVSYDDSSPPDVWFEP--AMLFEVLTADLSLSPVYKAGR 653

Query: 606 K-FKVGCTLHGGYCRRIREDKNWTECYT---LYELWQER 640
             +  G +L      RIREDK+ T+  +   + E +Q +
Sbjct: 654 DVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQ 692

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  115 bits (289), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 110/387 (28%), Positives = 164/387 (42%), Gaps = 54/387 (13%)

Query: 253 GLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRRGNDYT 312
           G+P  P LAK      + +       F  E K DGER Q+H +  G  ++ +SR G D T
Sbjct: 353 GIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQVHLLPDG-SMRIYSRNGEDMT 411

Query: 313 YLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEGI 372
             Y E      +  YL       + +LD E +++D E   +LPF ++ +  R S+  + I
Sbjct: 412 QRYPE----LNIQDYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLSTRKRKSVDLKDI 467

Query: 373 LTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSIK 432
                R      D L  N  SLIN  L  R+  L +I  PCP   +    +   +   ++
Sbjct: 468 ---KVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATELTTSNLDELQ 524

Query: 433 SSLEKAIMMGSEGIILKHFK---SKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGR--D 487
           + L+KAI    EG+++K      S YE   R+ NW+K+K +YL+  G++LDL V+G    
Sbjct: 525 TFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLCVLGAYYG 584

Query: 488 PGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIANGISQEE 547
            GK+     G  +                N D+EE          F + C I  G S E 
Sbjct: 585 RGKRTGTYGGFLL-------------ACYNQDTEE----------FETCCKIGTGFSDEM 621

Query: 548 FKQIERKTAGKWKNTEDHKPPKILEFGSKL-PEEWIYPEDSVVLEVKARSLDNTESSGRK 606
            + +        K T    P     F S   P+ W  P  ++V EV    L    S    
Sbjct: 622 LQTL----YNGLKETAIESPRANFVFDSSAEPDVWFNP--TMVFEVLTADL----SLSPI 671

Query: 607 FKVGCTLHGG-----YCR--RIREDKN 626
           +K G T++G      + R  RIR DK+
Sbjct: 672 YKAGSTVYGKGISLRFPRFIRIRTDKS 698

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  112 bits (279), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 105/396 (26%), Positives = 178/396 (44%), Gaps = 47/396 (11%)

Query: 253 GLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRRGNDYT 312
           G+P  P LAK      + +      +F  E K DGER Q+H ++ G +++ +SR G + T
Sbjct: 356 GIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNGENMT 414

Query: 313 YLYGE-DIGTG-TVAKYLQLDPK-------VRECVLDGEMISFDTEENSVLPFGLVKSSA 363
             Y E D+     V K +  D +       V++ +LD E++++D E+  +LPF ++ +  
Sbjct: 415 ERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRK 474

Query: 364 RDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSM 423
           R ++  + +     R      D LYLN   +IN  L  R++ L  +    P   +   S+
Sbjct: 475 RKNVDLKDV---KVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYATSL 531

Query: 424 HCYDDTSIKSSLEKAIMMGSEGIILKHF---KSKYEIGARTDNWIKIKPEYLEQFGENLD 480
              D   +++ L++A+    EG+++K     +S YE   R+ NW+K+K +YL+  G++LD
Sbjct: 532 ITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLD 591

Query: 481 LLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIA 540
           L+V+G   GK          L G             N D++E          F + C I 
Sbjct: 592 LVVMGAYFGKGKRTGSYGGFLLG-----------CYNEDTQE----------FETCCKIG 630

Query: 541 NGISQEEFKQIERKTAGKWKNTEDHKPPKILEFGSKL-PEEWIYPEDSVVLEVKARSLDN 599
            G S E    +        + TE   PP    + S   P+ W   +  V+ EV    L  
Sbjct: 631 TGFSDEMLGNLHT----LLQPTEIDNPPMTYIYDSSAEPDVWF--QAKVLFEVLTADLSL 684

Query: 600 T---ESSGRKFKVGCTLHGGYCRRIREDKNWTECYT 632
           +   ++   ++  G +L      RIREDK+ T+  T
Sbjct: 685 SPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTT 720

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 110/394 (27%), Positives = 172/394 (43%), Gaps = 44/394 (11%)

Query: 245 NDDLGVNLGLPFAPFLAKRLYISYDKVALRLK-SDFYIEEKMDGERIQLHYMDYGRKLKW 303
           N  + +  G+P  P LAK    S  +V  R + + F  E K DGER Q+H    G  +K 
Sbjct: 326 NQHIKLRPGIPLQPMLAKPTK-SISEVLDRFQGTKFTCEYKYDGERAQVHLCRDG-SMKI 383

Query: 304 FSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSA 363
           +SR G D T  Y E      V  Y++     +  ++D E +++D E+  +LPF ++ +  
Sbjct: 384 YSRNGEDMTERYPEI----DVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRK 439

Query: 364 RDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSM 423
           R  +  + +     R      D L LN   LIN   + R+Q L    N      +    +
Sbjct: 440 RKGVELKDV---KVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANEL 496

Query: 424 HCYDDTSIKSSLEKAIMMGSEGIILKHFK---SKYEIGARTDNWIKIKPEYLEQFGENLD 480
              +   ++  L++++    EG+++K  +   S YE   R+ NW+K+K +YLE  G++LD
Sbjct: 497 TTTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLD 556

Query: 481 LLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIA 540
           L+V+G   G+          L G             NLDSEE          F + C I 
Sbjct: 557 LVVLGAYYGRGKRTGTYGGFLLG-----------CYNLDSEE----------FETCCKIG 595

Query: 541 NGISQEEFKQIERKTAGKWKNTEDHKPPKILEFGSKLPEE-WIYPEDSVVLEVKAR--SL 597
            G S E  + +      K K+T    P   + + S  P + W  P  S++ EV     SL
Sbjct: 596 TGFSDEMLQDL----YTKLKDTTVEHPSTNVIYDSSAPADVWFEP--SMLFEVLTADLSL 649

Query: 598 DNTESSG-RKFKVGCTLHGGYCRRIREDKNWTEC 630
                +G   F  G +L      RIR+DKN T+ 
Sbjct: 650 SPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDA 683

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  110 bits (274), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 103/382 (26%), Positives = 171/382 (44%), Gaps = 44/382 (11%)

Query: 253 GLPFAPFLAKRLYISYDKVALRLKSD-FYIEEKMDGERIQLHYMDYGRKLKWFSRRGNDY 311
           G+P  P LAK    S  +V  R +   F  E K DGER Q+H +  G  ++ +SR G + 
Sbjct: 349 GIPLKPMLAKP-SKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENM 406

Query: 312 TYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEG 371
           T  Y E      ++ ++    +    +LD E +++D ++N +LPF ++ +  R  + AE 
Sbjct: 407 TERYPEI----NISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAED 462

Query: 372 ILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSI 431
           +     R      D L  N   LIN  L  R+ YL  IL P P  +++   +       +
Sbjct: 463 V---KVRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEM 519

Query: 432 KSSLEKAIMMGSEGIILKHF---KSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDP 488
           +  L++++    EG+++K     +S YE   R+ NW+K+K +YL+  G++LDL V+G   
Sbjct: 520 QLYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYY 579

Query: 489 GKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEF 548
           G+          L G             N D+ E          F + C I  G S E  
Sbjct: 580 GRGKRTGTYGGFLLG-----------CYNQDTGE----------FETCCKIGTGFSDEML 618

Query: 549 KQIERKTAGKWKNTEDHKPPKILEFG-SKLPEEWIYPEDSVVLEVKARSLDNT---ESSG 604
           + +  K +     TE  +P     +  S  P+ W+ P  S++ EV    L  +   ++ G
Sbjct: 619 QNLYEKLS----PTEIPEPKAFYVYSESAQPDVWLEP--SMLFEVLTADLSLSPVYKAGG 672

Query: 605 RKFKVGCTLHGGYCRRIREDKN 626
             +  G +L      RIR+DK+
Sbjct: 673 SSYGKGISLRFPRFIRIRDDKS 694

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  109 bits (272), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 80/275 (29%), Positives = 131/275 (47%), Gaps = 13/275 (4%)

Query: 220 RDYLSVVSDLKTVADKLWDPSHRLKNDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSD- 278
           RD    V + + V +   +      N    +  G+P  P LAK    S  +V  R   + 
Sbjct: 293 RDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKP-SKSITEVLDRFHGEK 351

Query: 279 FYIEEKMDGERIQLHYMDYGRKLKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECV 338
           F  E K DGER Q+H +  G  +  +SR G + T  Y E      +  YL         +
Sbjct: 352 FTCEYKYDGERAQVHLLPDG-SMNIYSRNGENMTERYPEL----HIRDYLADPETTHSLI 406

Query: 339 LDGEMISFDTEENSVLPFGLVKSSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVP 398
           LD E +++DTE+  +LPF ++ +  R  + A+ +     R      D L  NG SLIN  
Sbjct: 407 LDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVKV---RVCLFAFDMLCYNGQSLINNS 463

Query: 399 LNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSIKSSLEKAIMMGSEGIILKHFK---SKY 455
           L  R++YL  +L P     +    ++  +   ++  LE+++    EG+++K  +   S Y
Sbjct: 464 LLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHY 523

Query: 456 EIGARTDNWIKIKPEYLEQFGENLDLLVIGRDPGK 490
           E   R+ NW+K+K +YL+  G++LDL V+G   G+
Sbjct: 524 EPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGR 558

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 101/409 (24%), Positives = 180/409 (44%), Gaps = 51/409 (12%)

Query: 245 NDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEE-KMDGERIQLHYMDYGRKLKW 303
           N+   +  G+P  P LAK    + +++  R + + +  E K DGER Q+H ++ G  ++ 
Sbjct: 390 NEHCSLRPGIPLKPMLAKPTK-AINEILDRFQGETFTSEYKYDGERAQVHLLEDG-TMRI 447

Query: 304 FSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSA 363
           +SR G + T  Y E      +  +++   + +  +LD E +++D E+  +LPF ++ +  
Sbjct: 448 YSRNGENMTERYPEI----HIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRK 503

Query: 364 RDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSM 423
           R  + A+ +     R      D L  N   LIN  L  R++ L  +  P P   +    +
Sbjct: 504 RKDVLAKDV---KVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATEL 560

Query: 424 HCYDDTSIKSSLEKAIMMGSEGIILKHFK---SKYEIGARTDNWIKIKPEYLEQFGENLD 480
              +   ++  L++++    EG+++K  +   S YE   R+ NW+K+K +YLE  G++LD
Sbjct: 561 TTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLD 620

Query: 481 LLVIGR--DPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCT 538
           L V+G     GK+     G  +       G  +D                   +F + C 
Sbjct: 621 LCVLGAYYGRGKRTGTYGGFLL-------GCYNDN----------------TGEFETCCK 657

Query: 539 IANGISQEEFKQIERKTAGKWKNTEDHKPPKILEFGSKL-PEEWIYPEDSVVLEVKARSL 597
           I  G S E  +Q+      K K T    P     + S   P+ W  P  S++ EV    L
Sbjct: 658 IGTGFSDEMLQQLHE----KLKATVIDGPKATYIYDSSAEPDVWFEP--SLLFEVLTADL 711

Query: 598 DNT---ESSGRKFKVGCTLHGGYCRRIREDK---NWTECYTLYELWQER 640
             +   ++    +  G +L      RIREDK   + T    + EL++ +
Sbjct: 712 SLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYENQ 760

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 107/432 (24%), Positives = 184/432 (42%), Gaps = 47/432 (10%)

Query: 220 RDYLSVVSDLKTVADKLWDPSHRLKNDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDF 279
           RD    V + + V +   D      ++   +  G+P  P LAK    + ++V  R +   
Sbjct: 324 RDAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPMLAKPTK-AINEVLDRFQGQT 382

Query: 280 YIEE-KMDGERIQLHYMDYGRKLKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECV 338
           +  E K DGER Q+H +  G  ++ +SR G + T  Y E      +  +L         +
Sbjct: 383 FTSEYKYDGERAQVHLLKDG-TMRIYSRNGENMTERYPEI----QIKDFLADPASTTSLI 437

Query: 339 LDGEMISFDTEENSVLPFGLVKSSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVP 398
           LD E +++D E+N +LPF ++ +  R  +    +     R      D L  N + LIN P
Sbjct: 438 LDCEAVAWDKEQNKILPFQVLTTRKRKDVNINEV---KVRVCLFAFDILLHNDMRLINEP 494

Query: 399 LNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSIKSSLEKAIMMGSEGIILKHF---KSKY 455
           L+ R++ L  +  P     +    M   +   ++  L++++    EG+++K     +S Y
Sbjct: 495 LSKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMVKMMDGVESYY 554

Query: 456 EIGARTDNWIKIKPEYLEQFGENLDLLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDKQV 515
           E   R+ NW+K+K +YLE  G++LDL V+G   G+          L G            
Sbjct: 555 EPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFGRGKRTGTYGGFLLG-----------C 603

Query: 516 VNLDSEEEEEPRKAVKKFISFCTIANGISQEEFKQIERKTAGKWKNTEDHKPPKILEFGS 575
            N DSE+          F + C I  G S+E  + +  K +     T    P     F S
Sbjct: 604 YNADSED----------FETCCKIGTGFSEEMLQTLYEKLSP----TVIDGPKGTYVFDS 649

Query: 576 KL-PEEWIYPEDSVVLEVKARSLDNT---ESSGRKFKVGCTLHGGYCRRIREDK---NWT 628
              P+ W  P  +++ EV    L  +   ++    +  G +L      RIR+DK   + T
Sbjct: 650 SAEPDVWFEP--TMLFEVLTADLSLSPIYKAGSSVYDKGISLRFPRFLRIRDDKSVEDAT 707

Query: 629 ECYTLYELWQER 640
               + E++Q +
Sbjct: 708 SSEQIIEMYQNQ 719

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 113/435 (25%), Positives = 187/435 (42%), Gaps = 53/435 (12%)

Query: 220 RDYLSVVSDLKTVADKLWDPSHRLKNDDLGVNL--GLPFAPFLAKRLYISYDKVALRLKS 277
           RD    V + + V +   +  H + N D    L  G+P  P LAK    + ++V  R + 
Sbjct: 355 RDAFCQVPNYEIVINSCLE--HGIMNLDKFCTLKPGIPLKPMLAKPTK-AINEVLDRFQG 411

Query: 278 DFYIEE-KMDGERIQLHYMDYGRKLKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRE 336
           + +  E K DGER Q+H +D G  ++ +SR G + T  Y E      +  ++Q     + 
Sbjct: 412 ETFTSEYKYDGERAQVHLLDDG-TMRIYSRNGENMTERYPEI----KITDFIQDLDATKN 466

Query: 337 CVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLIN 396
            +LD E +++D E+  +LPF ++ +  R  +    +     R      D L  NG  LIN
Sbjct: 467 LILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDV---KVRVCLFAFDVLCHNGERLIN 523

Query: 397 VPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSIKSSLEKAIMMGSEGIILKHFK---S 453
             L  R++ L+ +    P   +    +   +   ++  L++++    EG+++K  +   S
Sbjct: 524 KSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEGPES 583

Query: 454 KYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDK 513
            YE   R+ NW+K+K +YLE  G++LDL V+G   G+          L G          
Sbjct: 584 HYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLG---------- 633

Query: 514 QVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEFKQI-ERKTAGKWKNTEDHKPPKILE 572
              N D+ E          F + C I  G S E  +Q+ ER T      T    P     
Sbjct: 634 -CYNQDTGE----------FETCCKIGTGFSDESLQQLHERLTP-----TIIDGPKATFV 677

Query: 573 FGSKL-PEEWIYPEDSVVLEVKARSLDNT---ESSGRKFKVGCTLHGGYCRRIREDK--- 625
           F S   P+ W  P  + + EV    L  +   ++    F  G +L      RIREDK   
Sbjct: 678 FDSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVE 735

Query: 626 NWTECYTLYELWQER 640
           + T    + EL++ +
Sbjct: 736 DATSSEQIVELYENQ 750

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 102/389 (26%), Positives = 169/389 (43%), Gaps = 47/389 (12%)

Query: 253 GLPFAPFLAKRLYISYDKVALRLKSDFYIEE-KMDGERIQLHYMDYGRKLKWFSRRGNDY 311
           G+P  P LAK    +  +V  R +   ++ E K DGER QLH +  G  ++ +SR G + 
Sbjct: 366 GIPLKPMLAKPTK-AITEVLDRFQGQLFVSEYKYDGERAQLHLLPDG-TMRIYSRNGENM 423

Query: 312 TYLYGE-DIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAE 370
           T  Y E DI      +    DP     +LD E +++D E+  +LPF ++ +  R  + A+
Sbjct: 424 TERYPEIDI------RDFLSDPSTESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAK 477

Query: 371 GILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTS 430
            +     R      D L  NG  LIN  L  R+  L  +  P          +   +   
Sbjct: 478 DV---KVRVCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEE 534

Query: 431 IKSSLEKAIMMGSEGIILKHF---KSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRD 487
           ++  L++++    EG+++K     +S YE   R+ NW+K+K +YL   G++LDL V+G  
Sbjct: 535 LQHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAY 594

Query: 488 PGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIANGISQEE 547
            G+          L G             N D+ E E          + C I  G S+E 
Sbjct: 595 YGRGKRTGTYGGFLLG-----------CYNQDTGEYE----------TCCKIGTGFSEEL 633

Query: 548 FKQIERKTAGKWKNTEDHKPPKILEFGS-KLPEEWIYPEDSVVLEVKARSLDNT---ESS 603
            +Q+      + K T    P     + S + P+ W  P  +++ EV A  L  +   ++ 
Sbjct: 634 LQQL----YDRLKPTAMEAPAAFYVYDSAQQPDVWFEP--TLLFEVLAADLSLSPVYKAG 687

Query: 604 GRKFKVGCTLHGGYCRRIREDKNWTECYT 632
             ++  G +L      RIR+DK+  E  +
Sbjct: 688 SAQYDKGISLRFPRFLRIRDDKSVEEATS 716

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 104/382 (27%), Positives = 165/382 (43%), Gaps = 40/382 (10%)

Query: 253 GLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRRGNDYT 312
           G+P  P LAK      + +      +F  E K DGER Q+H +  G +++ +SR G + T
Sbjct: 355 GIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNG-EMRIYSRNGENMT 413

Query: 313 YLYGE-DIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEG 371
             Y E  I    V      D +V   +LD E++++D E+N +LPF ++ +  R  +  + 
Sbjct: 414 ERYPELHIEDFLVKDESNTDKEV-SLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKD 472

Query: 372 ILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSI 431
           +     R      D LY NG  LI   L  R++ L  +    P   +   S+   +   I
Sbjct: 473 V---KVRVCLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEI 529

Query: 432 KSSLEKAIMMGSEGIILKHF---KSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDP 488
           +  L++AI    EG+++K     +S+YE   R+ NW+K+K +YL   G++LDL V+G   
Sbjct: 530 QKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMGAYY 589

Query: 489 GKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEF 548
           GK          L G             N DS E E          + C I  G S E  
Sbjct: 590 GKGKRTGTYGGFLLG-----------CYNQDSGEYE----------TCCKIGTGFSDEML 628

Query: 549 KQIERKTAGKWKNTEDHKPPKILEFGSKL-PEEWIYPEDSVVLEVKARSLDNT---ESSG 604
            ++       ++  E   P     F S   P+ W  P+  V+ EV    L  +   ++  
Sbjct: 629 TKLYE----LFREEEIEVPKSFYNFDSSAEPDIWFEPK--VLFEVLTADLSLSPIYKAGS 682

Query: 605 RKFKVGCTLHGGYCRRIREDKN 626
             +  G +L      RIR+DK+
Sbjct: 683 ATYDKGISLRFPRFLRIRDDKS 704

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 118/237 (49%), Gaps = 13/237 (5%)

Query: 253 GLPFAPFLAKRLYISYDKVALRLKSD-FYIEEKMDGERIQLHYMDYGRKLKWFSRRGNDY 311
           G+P  P LAK    S  +V  R +   F  E K DGER Q+H +  G  ++ +SR G + 
Sbjct: 357 GIPLKPMLAKP-SKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENM 414

Query: 312 TYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEG 371
           T  Y E      ++ ++    +    +LD E +++D E+N++LPF ++ +  R  +  E 
Sbjct: 415 TERYPEI----RISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVED 470

Query: 372 ILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSI 431
           +     R      D L  N   LI  PL  R+  L   L P P  +++   +       +
Sbjct: 471 V---KVRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDEL 527

Query: 432 KSSLEKAIMMGSEGIILKHFK---SKYEIGARTDNWIKIKPEYLEQFGENLDLLVIG 485
           +  L++A+    EG+++K  +   S YE   R+ NW+K+K +YL+  G++LDL V+G
Sbjct: 528 QHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLG 584

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 107/434 (24%), Positives = 185/434 (42%), Gaps = 51/434 (11%)

Query: 220 RDYLSVVSDLKTVADKLWDPSHRLKNDDLGVNL--GLPFAPFLAKRLYISYDKVALRLKS 277
           RD    V + + V +   +  H + N D    L  G+P  P LAK    + ++V  R + 
Sbjct: 445 RDAFCQVPNYEIVINSCLE--HGIMNLDKYCTLRPGIPLKPMLAKPTK-AINEVLDRFQG 501

Query: 278 DFYIEE-KMDGERIQLHYMDYGRKLKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRE 336
           + +  E K DGER Q+H ++ G  ++ +SR G + T  Y E      +  ++Q     + 
Sbjct: 502 ETFTSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERYPEI----KITDFIQDLDITKN 556

Query: 337 CVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLIN 396
            +LD E +++D ++  +LPF ++ +  R  +    +     R      D L  N   LIN
Sbjct: 557 LILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDV---KVRVCLFAFDILCHNDERLIN 613

Query: 397 VPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSIKSSLEKAIMMGSEGIILKHF---KS 453
           + L  R++YL+ +    P   +    +   +   ++  L++++    EG+++K     +S
Sbjct: 614 MSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLDESVNHSCEGLMVKMLDGSES 673

Query: 454 KYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDK 513
            YE   R+ NW+K+K +YLE  G++LDL V+G   G+          L G          
Sbjct: 674 HYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLG---------- 723

Query: 514 QVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEFKQIERKTAGKWKNTEDHKPPKILEF 573
              N D+ E          F + C I  G S E  + +      +   T    P     F
Sbjct: 724 -CYNQDTGE----------FETCCKIGTGFSDEMLQLLH----ARLTPTIIDGPKATYVF 768

Query: 574 GSKL-PEEWIYPEDSVVLEVKARSLDNT---ESSGRKFKVGCTLHGGYCRRIREDK---N 626
            S   P+ W  P  + + EV    L  +   ++    F  G +L      RIREDK   +
Sbjct: 769 DSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVED 826

Query: 627 WTECYTLYELWQER 640
            T    + EL++ +
Sbjct: 827 ATSSDQIVELYENQ 840

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 106/434 (24%), Positives = 184/434 (42%), Gaps = 51/434 (11%)

Query: 220 RDYLSVVSDLKTVADKLWDPSHRLKNDDLGVNL--GLPFAPFLAKRLYISYDKVALRLKS 277
           RD    V + + V +   +  H + N D    L  G+P  P LAK    + ++V  R + 
Sbjct: 355 RDAFCQVPNYEIVINSCLE--HGIMNLDKYCTLRPGIPLKPMLAKPTK-AINEVLDRFQG 411

Query: 278 DFYIEE-KMDGERIQLHYMDYGRKLKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRE 336
           + +  E K DGER Q+H ++ G  ++ +SR G + T  Y E      +  ++Q     + 
Sbjct: 412 ETFTSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERYPEI----NITDFIQDLDTTKN 466

Query: 337 CVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLIN 396
            +LD E +++D ++  +LPF ++ +  R  +    +     +      D L  N   LIN
Sbjct: 467 LILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDV---KVKVCLFAFDILCYNDERLIN 523

Query: 397 VPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSIKSSLEKAIMMGSEGIILKHFK---S 453
             L  R++YL+ +    P   +    +   +   ++  L++++    EG+++K  +   S
Sbjct: 524 KSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPES 583

Query: 454 KYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDK 513
            YE   R+ NW+K+K +YLE  G++LDL V+G   G+          L G          
Sbjct: 584 HYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLG---------- 633

Query: 514 QVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEFKQIERKTAGKWKNTEDHKPPKILEF 573
              N D+ E          F + C I  G S E  + +      +   T    P     F
Sbjct: 634 -CYNQDTGE----------FETCCKIGTGFSDEMLQLLH----DRLTPTIIDGPKATFVF 678

Query: 574 GSKL-PEEWIYPEDSVVLEVKARSLDNT---ESSGRKFKVGCTLHGGYCRRIREDK---N 626
            S   P+ W  P  + + EV    L  +   ++    F  G +L      RIREDK   +
Sbjct: 679 DSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVED 736

Query: 627 WTECYTLYELWQER 640
            T    + EL++ +
Sbjct: 737 ATSSDQIVELYENQ 750

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 97/398 (24%), Positives = 172/398 (43%), Gaps = 45/398 (11%)

Query: 253 GLPFAPFLAKRLYISYDKVALRLKSDFYIEE-KMDGERIQLHYMDYGRKLKWFSRRGNDY 311
           G+P  P LAK    S  +V  R +   +  E K DGER Q+H ++ G  ++ +SR G + 
Sbjct: 339 GIPLKPMLAKPTK-SITEVLDRFQGQTFTSEYKYDGERAQVHLLEDG-TMRIYSRNGENM 396

Query: 312 TYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEG 371
           T  Y E     ++  ++      +  +LD E +++D  +  +LPF ++ +  R  + A+ 
Sbjct: 397 TERYPEI----SIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKD 452

Query: 372 ILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSI 431
           +     R      D +  NG   IN  L  R++ L+ +  P     +    +       +
Sbjct: 453 V---KVRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEEL 509

Query: 432 KSSLEKAIMMGSEGIILKHF---KSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDP 488
           +  L++++    EG+++K     +S YE   R+ NW+K+K +YL+  G++LDL V+G   
Sbjct: 510 QKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYY 569

Query: 489 GKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEF 548
           G+          L G             N DS E          F + C I  G S E  
Sbjct: 570 GRGKRTGTYGGFLLG-----------CYNQDSGE----------FETCCKIGTGFSDEML 608

Query: 549 KQIERKTAGKWKNTEDHKPPKILEFGSKLPEEWIYPEDSVVLEVKARSLDNT---ESSGR 605
           +Q+  + +   K T D      +   S  P+ W  P  + + EV    L  +   ++   
Sbjct: 609 QQLYERFS---KTTLDGPKATYVFDSSAEPDVWFEP--TTLFEVLTADLSLSPVYKAGAS 663

Query: 606 KFKVGCTLHGGYCRRIREDK---NWTECYTLYELWQER 640
            +  G +L      R+R+DK   + T    + EL+Q++
Sbjct: 664 TYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQ 701

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 97.4 bits (241), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 109/435 (25%), Positives = 186/435 (42%), Gaps = 53/435 (12%)

Query: 220 RDYLSVVSDLKTVADKLWDPSHRLKNDDLGVNL--GLPFAPFLAKRLYISYDKVALRLKS 277
           RD    V + + V +   +  H + N D    L  G+P  P LAK    + ++V  R + 
Sbjct: 355 RDAFCQVPNYEIVINSCLN--HGIMNLDKYCTLRPGIPLKPMLAKPTK-AINEVLDRFQG 411

Query: 278 DFYIEE-KMDGERIQLHYMDYGRKLKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRE 336
           + +  E K DGER Q+H ++ G  ++ +SR G + T  Y E      +  ++Q     + 
Sbjct: 412 ETFTSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERYPEI----KITDFIQDLNSTKN 466

Query: 337 CVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLIN 396
            +LD E +++D E+  +LPF ++ +  R  +    +     +      D L  N   LIN
Sbjct: 467 LILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDV---KVKVCLFAFDILCYNDERLIN 523

Query: 397 VPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSIKSSLEKAIMMGSEGIILKHF---KS 453
             L  R+++L+ +    P   +    +   +   ++  L++++    EG+++K     +S
Sbjct: 524 KSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDGPES 583

Query: 454 KYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDK 513
            YE   R+ NW+K+K +YLE  G++LDL V+G   G+          L G          
Sbjct: 584 HYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLG---------- 633

Query: 514 QVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEFKQI-ERKTAGKWKNTEDHKPPKILE 572
              N D+ E          F + C I  G S E  + + ER T      T    P     
Sbjct: 634 -CYNQDTGE----------FETCCKIGTGFSDEMLQLLHERLTP-----TIIDGPKATFV 677

Query: 573 F-GSKLPEEWIYPEDSVVLEVKARSLDNT---ESSGRKFKVGCTLHGGYCRRIREDK--- 625
           F  S  P+ W  P  + + EV    L  +   ++    F  G +L      RIREDK   
Sbjct: 678 FDASAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVE 735

Query: 626 NWTECYTLYELWQER 640
           + T    + EL++ +
Sbjct: 736 DATSSDQIIELYENQ 750

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score = 97.1 bits (240), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 107/416 (25%), Positives = 174/416 (41%), Gaps = 48/416 (11%)

Query: 220 RDYLSVVSDLKTVADKLWDPSHRLKNDDLGVNL--GLPFAPFLAKRLYISYDKVALRLKS 277
           RD    V + + V D      H + N D   +L   +P  P LAK    S  ++  R + 
Sbjct: 327 RDAFCQVPNYEVVIDSCL--KHGIMNLDQHCSLRPAIPLKPMLAKPTK-SISEIFDRFQD 383

Query: 278 D-FYIEEKMDGERIQLHYMDYGRKLKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRE 336
             F  E K DGER Q+H ++ G  ++ +SR G + T  Y E      +  ++      + 
Sbjct: 384 QKFTCEYKYDGERAQVHLLEDG-TMRIYSRNGENMTERYPE----IHIRDFVTDLSHTKS 438

Query: 337 CVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLIN 396
            +LD E +++D E+N +LPF ++ +  R  +    I     R      D L  N   LIN
Sbjct: 439 LILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEI---KVRVCLFAFDILLHNDEKLIN 495

Query: 397 VPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSIKSSLEKAIMMGSEGIILKHFK---S 453
             L  R+  L +I        +    M   +   ++S L++++    EG+++K  +   S
Sbjct: 496 KSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEGEES 555

Query: 454 KYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDK 513
            YE   R+ NW+K+K +YL   G++LDL V+G   G+          L G          
Sbjct: 556 HYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLLG---------- 605

Query: 514 QVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEFKQIERKTAGKWKNTEDHKPPKILEF 573
              N D+ E          F + C I  G S E  +Q+      + K+T    P     F
Sbjct: 606 -CYNQDTGE----------FETACKIGTGFSDEVLQQLHE----RLKSTVIDLPKATYVF 650

Query: 574 G-SKLPEEWIYPEDSVVLEVKARSLDNT---ESSGRKFKVGCTLHGGYCRRIREDK 625
             S  P+ W  P  +++ EV    L  +   ++    +  G +L      R+REDK
Sbjct: 651 DPSAEPDVWFEP--TLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDK 704

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score = 96.7 bits (239), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 100/401 (24%), Positives = 171/401 (42%), Gaps = 51/401 (12%)

Query: 253 GLPFAPFLAKRLYISYDKVALRLKSDFYIEE-KMDGERIQLHYMDYGRKLKWFSRRGNDY 311
           G+P  P LAK    + +++  R + + +  E K DGER Q+H +  G  ++ +SR G + 
Sbjct: 387 GIPLKPMLAKPTK-AINEILDRFQGEIFTSEYKYDGERAQVHLLSDG-TMRIYSRNGENM 444

Query: 312 TYLYGEDIGTGTVAKYLQLDPKVREC-VLDGEMISFDTEENSVLPFGLVKSSARDSLTAE 370
           T  Y E      +A     DP V    +LD E +++D E+N +LPF ++ +  R  +  +
Sbjct: 445 TERYPEIHIRDFIA-----DPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRKDVDLK 499

Query: 371 GILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTS 430
            +     +      D L  N   LIN  L  R+Q L  +        +    M   +   
Sbjct: 500 DV---KVKVCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDE 556

Query: 431 IKSSLEKAIMMGSEGIILKHF---KSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGR- 486
           ++  L++++    EG+++K     +S YE   R+ NW+K+K +YLE  G++LDL VIG  
Sbjct: 557 LQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAY 616

Query: 487 -DPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIANGISQ 545
              GK+  +  G  +                N D+ E          F + C I  G S 
Sbjct: 617 YGRGKRTGMYGGFLL-------------GCYNQDTGE----------FETCCKIGTGFSD 653

Query: 546 EEFKQIERKTAGKWKNTEDHKPPKILEFGSKLPEEWIYPEDSVVLEVKARSLDNT---ES 602
           E  +Q+  +         D      +   S  P+ W  P  +++ EV    L  +   ++
Sbjct: 654 EMLQQLYTRLT---PTVLDGPKATFVYDSSAEPDVWFEP--TLLFEVLTADLSLSPIYKA 708

Query: 603 SGRKFKVGCTLHGGYCRRIREDK---NWTECYTLYELWQER 640
               +  G +L      R REDK   + T    + EL++ +
Sbjct: 709 GSSTYDKGISLRFPRFIRTREDKGVEDATSSEQIIELYENQ 749

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 99/398 (24%), Positives = 167/398 (41%), Gaps = 45/398 (11%)

Query: 253 GLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRRGNDYT 312
           G+P  P LAK      +         F  E K DGER Q+H M+ G  ++ +SR G + T
Sbjct: 343 GIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDG-SMRIYSRNGENMT 401

Query: 313 YLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEGI 372
             Y E I      K L L    +  ++D E +++D EE  +LPF ++ +  R  +  + I
Sbjct: 402 ERYPE-INVTDFIKDLNL---TKSLIIDCEAVAWDREEKKILPFQVLSTRKRKDVDIKDI 457

Query: 373 LTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSIK 432
                R      D L  N   LIN  L  R++ L ++           + +   +   ++
Sbjct: 458 ---KVRICLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELSTNNLDELQ 514

Query: 433 SSLEKAIMMGSEGIILKHFK---SKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDPG 489
             L++++    EG+++K      S YE   R+ NW+K+K +YL+  G++LDL V+G   G
Sbjct: 515 LFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAFYG 574

Query: 490 KKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEFK 549
           +          L G             N D+ E          F + C I  G S E  +
Sbjct: 575 RGKRTGTYGGFLLG-----------CYNQDTGE----------FETACKIGTGFSDEVLQ 613

Query: 550 QIERKTAGKWKNTEDHKPPKILEF-GSKLPEEWIYPEDSVVLEVKARSLDNT---ESSGR 605
            +      + K+T    P     +  S  P+ W  P  +++ EV    L  +   ++   
Sbjct: 614 SL----YDRLKSTTIDGPKATYIYDSSAQPDVWFEP--TLLFEVLTADLSMSPIYKAGAS 667

Query: 606 KFKVGCTLHGGYCRRIREDKNWTECYT---LYELWQER 640
            +  G +L      R+REDK+  E  +   + EL++ +
Sbjct: 668 TYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQ 705

>Ecym_2188 Chr2 (371869..373254) [1386 bp, 461 aa] {ON} similar to
           Ashbya gossypii AFL107W
          Length = 461

 Score = 40.4 bits (93), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 47/105 (44%), Gaps = 16/105 (15%)

Query: 381 YMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHC--------------- 425
           Y++ D L +NG SL+  P ++R  +L        + +  +   HC               
Sbjct: 144 YLMFDCLAINGRSLVQSPTSSRLAHLGKEFFKPYYDLRSVYPDHCSNFPFKLSMKHMNFS 203

Query: 426 YDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPE 470
           YD   I S+L+K   + S+G+I     + Y +G +  N +K KP+
Sbjct: 204 YDLVKIASTLDKLPHV-SDGLIFTPVNTSYNVGGKDSNLLKWKPQ 247

>NCAS0D04100 Chr4 (774815..776164) [1350 bp, 449 aa] {ON} Anc_6.228
           YGL130W
          Length = 449

 Score = 38.5 bits (88), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 86/221 (38%), Gaps = 55/221 (24%)

Query: 275 LKSDFYIEEKMDGERIQLHYMD---YGRKLKWFSRRGNDYTYLYGEDIGTGTVAKYLQLD 331
           +  D+Y+ EK DG R+ +  +     G +  +   R N+Y  + G         K+ +L 
Sbjct: 57  MSQDYYVCEKTDGLRVLMFILINPITGEQGSFMIDRENNYYLVNG--------FKFPKLP 108

Query: 332 PKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEGILTQGYRPL-------YMVI 384
            K +E +L+                     + +D    +G L     P+       Y++ 
Sbjct: 109 QKKKEELLE---------------------TLQDGTLLDGELVIQTNPMTKLKELRYLMF 147

Query: 385 DFLYLNGVSLINVPLNTRKQYL------------SAILNPC---PHAVEIIQSMHCYDDT 429
           D L +NG SL+  P ++R  +L            S   N C   P  + +      Y   
Sbjct: 148 DCLAINGRSLMQSPTSSRLAHLGKDFFKPYYDLRSIYPNHCNTFPFKISMKHMDFSYALV 207

Query: 430 SIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPE 470
            + +SL+K   + S+G+I    K  Y IG +    +K KPE
Sbjct: 208 KVANSLDKLPHL-SDGLIFTPVKMPYNIGGKDSYLLKWKPE 247

>CAGL0D06050g Chr4 (573888..575462) [1575 bp, 524 aa] {ON} similar
           to uniprot|P47114 Saccharomyces cerevisiae YJR054w
          Length = 524

 Score = 38.5 bits (88), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 317 EDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFG-LVKSSARDSLTAEGILTQ 375
           ED  T    + +  +P VR  V+DG  +  D++ N+   F    +++AR+   ++ ++ +
Sbjct: 333 EDGSTSEEYELMYEEPMVRNSVIDGNDLLLDSKFNAKRDFNQYYQNAARNQSNSQDVIKE 392

Query: 376 GYRPLYMVIDFLYLNG 391
            Y P + V+D+ Y NG
Sbjct: 393 EYEPNFDVMDYAYSNG 408

>KNAG0F01900 Chr6 (367193..368566) [1374 bp, 457 aa] {ON} Anc_6.228
           YGL130W
          Length = 457

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 46/105 (43%), Gaps = 16/105 (15%)

Query: 381 YMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHC--------------- 425
           Y++ D L +NG SLI  P ++R  +L        + +      HC               
Sbjct: 144 YLMFDCLAINGRSLIQSPTSSRLAHLGKEFFKPYYDLRSFYPDHCSTFPLKLSMKHMDFS 203

Query: 426 YDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPE 470
           Y+   +  SL+K   M S+G+I    ++ Y++G +    +K KPE
Sbjct: 204 YELVKVAQSLDKLPHM-SDGLIFTPVRAPYQVGGKDSLLLKWKPE 247

>TPHA0E02770 Chr5 (580118..581470) [1353 bp, 450 aa] {ON} Anc_6.228
           YGL130W
          Length = 450

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 58/131 (44%), Gaps = 23/131 (17%)

Query: 362 SARDSLTAEGILTQGYRPL-------YMVIDFLYLNGVSLINVPLNTRKQYL-------- 406
           +A+D    +G L     P+       Y++ D L +NG +L + P ++R  +L        
Sbjct: 117 TAQDGTLIDGELVIQTNPMTNLTELRYLMFDCLTMNGRNLTHSPTSSRLAHLGKEFYKPY 176

Query: 407 ----SAILNPC---PHAVEIIQSMHCYDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGA 459
               S   + C   P  + + Q    YD  ++  +L+K   + S+G+I     + Y +GA
Sbjct: 177 FDMRSIFPDRCINFPFKISMKQMNFSYDLVNVYKTLDKLPHL-SDGLIFTPVNTPYVVGA 235

Query: 460 RTDNWIKIKPE 470
           +    +K KPE
Sbjct: 236 KDSYLLKWKPE 246

>Suva_7.133 Chr7 (262417..263796) [1380 bp, 459 aa] {ON} YGL130W
           (REAL)
          Length = 459

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 85/215 (39%), Gaps = 43/215 (20%)

Query: 275 LKSDFYIEEKMDGERIQLHYM---DYGRKLKWFSRRGNDYTYLYGEDIGTGTVAKYLQLD 331
           L  D+Y+ EK DG R+ +  +     G +  +   R N+Y  + G         K  +L 
Sbjct: 61  LSHDYYVCEKTDGLRVLMFIVINPVTGEQGCFMIDRENNYYLVNGFRFPRLPQKKKEELL 120

Query: 332 PKVRE-CVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEGILTQGYRPLYMVIDFLYLN 390
             +++  +LDGE++    + N V     ++                    Y++ D L +N
Sbjct: 121 ETLQDGTLLDGELV---IQTNPVTKLQELR--------------------YLMFDCLAIN 157

Query: 391 GVSLINVPLNTRKQYL------------SAILNPC---PHAVEIIQSMHCYDDTSIKSSL 435
           G  L+  P ++R  +L            +A  N C   P  + +      Y    +  SL
Sbjct: 158 GRCLVQSPTSSRLAHLGKEFFKPYFDLRAAYPNRCTTFPFKISMKHMDFSYQLVKVAKSL 217

Query: 436 EKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPE 470
           EK   + S+G+I    K+ Y  G +    +K KPE
Sbjct: 218 EKLPHL-SDGLIFTPVKAPYTAGGKDSLLLKWKPE 251

>KAFR0K02360 Chr11 complement(481829..483202) [1374 bp, 457 aa] {ON}
           Anc_6.228 YGL130W
          Length = 457

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 47/105 (44%), Gaps = 16/105 (15%)

Query: 381 YMVIDFLYLNGVSLINVPLNTRKQYL------------SAILNPC---PHAVEIIQSMHC 425
           Y++ D L +NG  +I  P ++R  +L            S   + C   P  + +      
Sbjct: 144 YLMFDCLAINGRCIIQSPTSSRLAHLGKEFFKPYYDLRSVYRDHCSTFPFKISMKHMDFS 203

Query: 426 YDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPE 470
           YD   + +SL+K   M S+G+I    K+ Y +G +    +K KPE
Sbjct: 204 YDLVRVANSLDKLPHM-SDGLIFTPVKNPYYVGGKDSFLLKWKPE 247

>Kpol_228.3 s228 (5737..7143) [1407 bp, 468 aa] {ON} (5737..7143)
           [1407 nt, 469 aa]
          Length = 468

 Score = 36.2 bits (82), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 48/105 (45%), Gaps = 16/105 (15%)

Query: 381 YMVIDFLYLNGVSLINVPLNTRKQYL------------SAILNPC---PHAVEIIQSMHC 425
           Y++ D L +NG +++  P ++R  +L            S   + C   P  + + Q    
Sbjct: 143 YLMFDCLAINGRNIVASPTSSRLAHLGKEFYKPYFDLRSVYPDRCETFPFKISMKQMNFS 202

Query: 426 YDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPE 470
           YD   +  +L+K   + S+G+I    K+ Y +G +    +K KPE
Sbjct: 203 YDLVKVAKTLDKLPHL-SDGLIFTPVKTPYFVGGKDSYLLKWKPE 246

>ZYRO0E07150g Chr5 complement(540507..541856) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|Q01159 Saccharomyces
           cerevisiae YGL130W CEG1 mRNA guanylyltransferase (mRNA
           capping enzyme), alpha subunit
          Length = 449

 Score = 36.2 bits (82), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 47/105 (44%), Gaps = 16/105 (15%)

Query: 381 YMVIDFLYLNGVSLINVPLNTRKQYLSA----------ILNP--C---PHAVEIIQSMHC 425
           Y++ D L +NG  L   P ++R  +L            ++ P  C   P  + +      
Sbjct: 144 YLMFDCLAINGRCLTPSPTSSRLAHLGKEFFKPYFDLRLVYPDQCVTFPFKISMKHMSFS 203

Query: 426 YDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPE 470
           YD   + +SLEK   M S+G+I    K+ Y +G +    +K KPE
Sbjct: 204 YDLLKVANSLEKLPHM-SDGLIFTPVKTPYFVGGKDSLLLKWKPE 247

>KLLA0B02200g Chr2 (196341..197741) [1401 bp, 466 aa] {ON} highly
           similar to uniprot|Q01159 Saccharomyces cerevisiae
           YGL130W CEG1 mRNA guanylyltransferase (mRNA capping
           enzyme), alpha subunit
          Length = 466

 Score = 35.8 bits (81), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 47/105 (44%), Gaps = 16/105 (15%)

Query: 381 YMVIDFLYLNGVSLINVPLNTRKQYL------------SAILNPC---PHAVEIIQSMHC 425
           Y++ D L +NG SL+  P ++R  +L            S   + C   P  + +      
Sbjct: 145 YLMFDCLAVNGRSLVQSPTSSRLAHLGKEFFKPYYDLRSYFPDRCSTFPFKISMKHMNFS 204

Query: 426 YDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPE 470
           YD   +  +L+ ++   S+G+I    ++ Y IG +    +K KPE
Sbjct: 205 YDLAKVAKTLD-SLPHVSDGLIFTPVQAAYHIGGKDSYLLKWKPE 248

>SAKL0A04114g Chr1 (386331..387728) [1398 bp, 465 aa] {ON} highly
           similar to uniprot|Q01159 Saccharomyces cerevisiae
           YGL130W CEG1 mRNA guanylyltransferase (mRNA capping
           enzyme), alpha subunit
          Length = 465

 Score = 35.0 bits (79), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 47/105 (44%), Gaps = 16/105 (15%)

Query: 381 YMVIDFLYLNGVSLINVPLNTRKQYL------------SAILNPC---PHAVEIIQSMHC 425
           Y++ D L +NG SL+  P ++R  +L            S   + C   P  + +      
Sbjct: 145 YLMFDCLAINGRSLLQSPTSSRLAHLCKDFFRPYYDLRSLYPDHCTNFPFKISVKLMHFS 204

Query: 426 YDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPE 470
           YD   + S+L+K   + S+G+I     + Y +G +    +K KPE
Sbjct: 205 YDLVKVASTLDKLPHV-SDGLIFTPVTTPYYVGGKDSFLLKWKPE 248

>Smik_7.141 Chr7 (260116..261495) [1380 bp, 459 aa] {ON} YGL130W
           (REAL)
          Length = 459

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 86/215 (40%), Gaps = 43/215 (20%)

Query: 275 LKSDFYIEEKMDGERIQLHYM---DYGRKLKWFSRRGNDYTYLYGEDIGTGTVAKYLQLD 331
           L  D+Y+ EK DG R+ +  +     G +  +   R N+Y  + G         K  +L 
Sbjct: 61  LAQDYYVCEKTDGLRVLMFIVINPVTGEQGCFMIDRENNYYLVNGFRFPKLPQKKKEELL 120

Query: 332 PKVRE-CVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEGILTQGYRPLYMVIDFLYLN 390
             +++  +LDGE++              ++++    L       Q  R  Y++ D L +N
Sbjct: 121 ETLQDGTLLDGELV--------------IQTNPMTKL-------QELR--YLMFDCLAIN 157

Query: 391 GVSLINVPLNTRKQYL------------SAILNPC---PHAVEIIQSMHCYDDTSIKSSL 435
           G  L   P ++R  +L            +A  N C   P  + +      Y    +  SL
Sbjct: 158 GRCLTQSPTSSRLAHLGKEFFKPYFDLRAAFPNRCTTFPFKISMKHMDFSYQLVKVAKSL 217

Query: 436 EKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPE 470
           +K   + S+G+I    K+ Y  G +    +K KPE
Sbjct: 218 DKLPHL-SDGLIFTPVKAPYTAGGKDSLLLKWKPE 251

>KNAG0E00410 Chr5 complement(65732..68185) [2454 bp, 817 aa] {ON}
           Anc_7.46 YOR346W
          Length = 817

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 50/112 (44%), Gaps = 12/112 (10%)

Query: 680 AKTSSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNGGKLTFNVISDHRVKGGLRII 739
           A    IF GL+ YV + Y    D  ++  E     I  +GG+    +    +V     II
Sbjct: 36  ASRGGIFAGLVVYV-NGYTRPWDRLKLHAE-----IVKHGGEFCHYMSGKRQVT---HII 86

Query: 740 SGKYTLECKALIE-RGYDILSPQWLMDCVNTGFLVTIEPRHCFSVSEDMEKI 790
           +   TL  K  +E R Y ++S QW++D +  G L+  +        +D +K+
Sbjct: 87  ASNLTL--KKFVEFRNYKVVSAQWVVDSIQRGRLLPWQDYRVEGQGDDQQKL 136

>CAGL0G07843g Chr7 (744599..746395) [1797 bp, 598 aa] {ON} highly
           similar to uniprot|P53261 Saccharomyces cerevisiae
           YGR103w
          Length = 598

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 45/101 (44%), Gaps = 21/101 (20%)

Query: 682 TSSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNGGKLTFNVISDHRVKGGLRIISG 741
           T+++F+  +FYV            +  E +  LI   GGK+      D +++G       
Sbjct: 346 TATLFEDFVFYV---------GREVPIEAIEFLILSCGGKVISEAAMD-QIEGNTEFDLS 395

Query: 742 KYTLECKALIER--------GYDILSPQWLMDCVNTGFLVT 774
           K T +   +++R        G   + PQW+ DC+N G L++
Sbjct: 396 KVTHQ---IVDRPVLKHKVAGRTYIQPQWVFDCINKGELLS 433

>TBLA0A02070 Chr1 complement(499281..500642) [1362 bp, 453 aa] {ON}
           Anc_6.228 YGL130W
          Length = 453

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 46/105 (43%), Gaps = 16/105 (15%)

Query: 381 YMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHC--------------- 425
           Y++ D L +NG  L+  P ++R  +L        + +      HC               
Sbjct: 144 YLMFDCLAINGRCLVPSPTSSRLAHLGKEFFKPYYDLRTYYPDHCGTFPFKLSMKHMNFS 203

Query: 426 YDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPE 470
           YD   ++++L+K +   S+G+I    K+ Y +G +    +K KPE
Sbjct: 204 YDLVKVENTLDK-LPHKSDGLIFTPVKTSYYVGGKDSYLLKWKPE 247

>KAFR0C05190 Chr3 (1031636..1034326) [2691 bp, 896 aa] {ON} Anc_7.46
           YOR346W
          Length = 896

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 11/86 (12%)

Query: 682 TSSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNGGKLTFNVISDHRVKGGLRIISG 741
           TS++F  L  Y I+ Y       R S+ QL ++I  NGGK   ++ +   V     II+ 
Sbjct: 106 TSNLFKDLTVY-INGYT------RPSRFQLHEMIVLNGGKFLHHLSAKRSVT---HIIAS 155

Query: 742 KYTLECKALIERGYDILSPQWLMDCV 767
             TL+ K +    Y ++ P+WL+D +
Sbjct: 156 TLTLK-KKIEFANYKVVKPEWLVDSI 180

>CAGL0I09570g Chr9 complement(914062..915411) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|Q01159 Saccharomyces
           cerevisiae YGL130w mRNA guanylyltransferase
          Length = 449

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 47/105 (44%), Gaps = 16/105 (15%)

Query: 381 YMVIDFLYLNGVSLINVPLNTRKQYL------------SAILNPC---PHAVEIIQSMHC 425
           Y++ D L +NG SL+  P ++R  +L            S   + C   P  + +      
Sbjct: 144 YLMFDCLAINGRSLVQSPTSSRLAHLGKEFYKPYYDLRSIYPDKCATFPFKLSMKHMDFS 203

Query: 426 YDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPE 470
           Y    + +SL+K   + S+G+I    ++ Y +G +    +K KPE
Sbjct: 204 YSLVKVANSLDKLPHL-SDGLIFTPVRTPYAVGGKDSLLLKWKPE 247

>YGL130W Chr7 (266145..267524) [1380 bp, 459 aa] {ON}  CEG1Alpha
           (guanylyltransferase) subunit of the mRNA capping
           enzyme, a heterodimer (the other subunit is CET1, an RNA
           5'-triphosphatase) involved in adding the 5' cap to
           mRNA; the mammalian enzyme is a single bifunctional
           polypeptide
          Length = 459

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 86/215 (40%), Gaps = 43/215 (20%)

Query: 275 LKSDFYIEEKMDGERIQLHYM---DYGRKLKWFSRRGNDYTYLYGEDIGTGTVAKYLQLD 331
           L  D+Y+ EK DG R+ +  +     G +  +   R N+Y  + G         K  +L 
Sbjct: 61  LAHDYYVCEKTDGLRVLMFIVINPVTGEQGCFMIDRENNYYLVNGFRFPRLPQKKKEELL 120

Query: 332 PKVRE-CVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEGILTQGYRPLYMVIDFLYLN 390
             +++  +LDGE++              ++++    L       Q  R  Y++ D L +N
Sbjct: 121 ETLQDGTLLDGELV--------------IQTNPMTKL-------QELR--YLMFDCLAIN 157

Query: 391 GVSLINVPLNTRKQYL------------SAILNPC---PHAVEIIQSMHCYDDTSIKSSL 435
           G  L   P ++R  +L            +A  N C   P  + +      Y    +  SL
Sbjct: 158 GRCLTQSPTSSRLAHLGKEFFKPYFDLRAAYPNRCTTFPFKISMKHMDFSYQLVKVAKSL 217

Query: 436 EKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPE 470
           +K   + S+G+I    K+ Y  G +    +K KPE
Sbjct: 218 DKLPHL-SDGLIFTPVKAPYTAGGKDSLLLKWKPE 251

>Skud_7.142 Chr7 (270563..271942) [1380 bp, 459 aa] {ON} YGL130W
           (REAL)
          Length = 459

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 44/105 (41%), Gaps = 16/105 (15%)

Query: 381 YMVIDFLYLNGVSLINVPLNTRKQYL------------SAILNPC---PHAVEIIQSMHC 425
           Y++ D L +NG  L   P ++R  +L            +A  N C   P  + +      
Sbjct: 148 YLMFDCLAINGRCLTQSPTSSRLAHLGKEFFKPYFDLRAAYPNRCTTFPFKISMKHMDFS 207

Query: 426 YDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPE 470
           Y    +  SL+K   + S+G+I    K+ Y  G +    +K KPE
Sbjct: 208 YQLVKVAKSLDKLPHL-SDGLIFTPVKAPYTAGGKDSLLLKWKPE 251

>Ecym_6341 Chr6 (656835..659138) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii AFR095C
          Length = 767

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 40/87 (45%), Gaps = 2/87 (2%)

Query: 691 FYVISDYMASQDSERISKEQLCDLISGNGGKLTFNVISDHRVKGGLRIISGKYT-LECKA 749
           FY+    +++ +      +QLC+ I  +   LT + I D         I+   T    KA
Sbjct: 112 FYMFIGRISAPEVSTGELQQLCE-IGHSYRCLTNHFIKDIECSAQSVFITDCATGARAKA 170

Query: 750 LIERGYDILSPQWLMDCVNTGFLVTIE 776
             E G  I+ P+W+MDC   G ++ +E
Sbjct: 171 AREEGVPIVHPKWVMDCTKRGAVLEME 197

>TBLA0E00570 Chr5 complement(110459..112249) [1791 bp, 596 aa] {ON}
           Anc_3.447 YGR103W
          Length = 596

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 46/107 (42%), Gaps = 19/107 (17%)

Query: 674 LSCDDEAKTSSIFDGLIFYV-------ISDYMASQDSERISKEQLCDLISGNGGKLTFNV 726
           L    E ++SS+F   IFYV       I++++      ++  E   D I     ++  + 
Sbjct: 340 LEQPSEHESSSLFSDFIFYVGREVPIDIAEFLILSCGGKVISEAALDQIE-KSNEIDLSN 398

Query: 727 ISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLV 773
           ++ H        I  +  L+ K     G   + PQW+ DC+N G LV
Sbjct: 399 VTHH--------IVDRPVLKNKIA---GRTYVQPQWIFDCINKGELV 434

>AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL090C
           (DPB11)
          Length = 670

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 38/92 (41%), Gaps = 12/92 (13%)

Query: 691 FYVISDYMASQDSERISKEQLCDLISGNGGKLTFNVISDHRVKGGLRIISGKYTLECKAL 750
           FYV    +A     R+S  +L  L    G +    V++ H V+         +  +C   
Sbjct: 114 FYVFIGRVAGG---RVSAAELQQLCESGGAR---RVVTSHFVRDTASSARSVFVTDCAEG 167

Query: 751 IE------RGYDILSPQWLMDCVNTGFLVTIE 776
                   +G  ++ P+W+ DCV  G +V +E
Sbjct: 168 ARAAAAREQGVAVVHPKWVTDCVRRGAVVEME 199

>NDAI0I00830 Chr9 complement(187083..188441) [1359 bp, 452 aa] {ON}
           Anc_6.228 YGL130W
          Length = 452

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 42/106 (39%), Gaps = 17/106 (16%)

Query: 381 YMVIDFLYLNGVSLINVP-------LNT---------RKQYLSAILNPCPHAVEIIQSMH 424
           Y+  D L +NG SL+  P       LN          RK Y        P  +   +   
Sbjct: 144 YLAFDCLAINGRSLVQSPTDKRLGHLNNEFYMPYFELRKYYEQDYCRTFPFKISPKRMDF 203

Query: 425 CYDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPE 470
            Y    +  SL+K   M S+G+I       Y++G +  N +K KPE
Sbjct: 204 SYRLMRVADSLDKLPHM-SDGLIFTPISLPYQLGGKDSNLLKWKPE 248

>Kwal_27.12016 s27 (1046016..1046696) [681 bp, 226 aa] {ON} YPL069C
           (BTS1) - geranylgeranyl diphosphate synthase [contig 24]
           PARTIAL
          Length = 226

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 45/82 (54%), Gaps = 7/82 (8%)

Query: 688 GLIFYVISDYMASQDSERISKEQLCDLISGNGGKLTFNVISDHRVKGGLRIISGKYTLEC 747
           G+++ +  DYM  QD++ I  +   D +S   GKL+F +I  H ++ G+ I   K T+  
Sbjct: 105 GILYQIRDDYMNLQDAQMIQNKGFADDVS--EGKLSFPII--HGIRHGIEI---KDTVVW 157

Query: 748 KALIERGYDILSPQWLMDCVNT 769
             L +R  D +  + L+D ++T
Sbjct: 158 DTLKKRTRDNVLKKQLVDYLDT 179

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 103,671,380
Number of extensions: 4778957
Number of successful extensions: 13751
Number of sequences better than 10.0: 69
Number of HSP's gapped: 13911
Number of HSP's successfully gapped: 69
Length of query: 944
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 825
Effective length of database: 39,836,145
Effective search space: 32864819625
Effective search space used: 32864819625
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)