Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07832g6.19ON28124612541e-176
TDEL0G045006.19ON30124010031e-137
SAKL0E01144g6.19ON4302409971e-134
Kpol_1037.246.19ON3662409891e-134
Smik_15.1756.19ON3122409811e-133
YOR006C (TSR3)6.19ON3132469741e-132
Suva_15.1816.19ON3362409721e-132
Skud_15.1676.19ON3122409571e-130
KLLA0D01111g6.19ON3142409311e-126
TPHA0J003206.19ON3422439321e-126
CAGL0E02717g6.19ON3252409001e-121
ACR007W6.19ON3132408991e-121
KNAG0M011506.19ON3072418861e-119
KLTH0C11264g6.19ON3462388751e-117
Ecym_30236.19ON3492468541e-114
NCAS0H008106.19ON3232488471e-113
Kwal_56.224216.19ON3372308471e-113
NDAI0D007906.19ON4012648331e-110
KAFR0L003906.19ON3292257492e-98
TBLA0A072506.19ON3042427272e-95
AGR273C6.68ON115879790.20
SAKL0A01474g6.332ON46882658.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C07832g
         (281 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar...   487   e-176
TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19...   390   e-137
SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON...   388   e-134
Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {O...   385   e-134
Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {O...   382   e-133
YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}  ...   379   e-132
Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {...   379   e-132
Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {O...   373   e-130
KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {O...   363   e-126
TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON...   363   e-126
CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {O...   351   e-121
ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic hom...   350   e-121
KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {O...   345   e-119
KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} simila...   341   e-117
Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON} s...   333   e-114
NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON...   330   e-113
Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {...   330   e-113
NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {O...   325   e-110
KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}...   293   2e-98
TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {...   284   2e-95
AGR273C Chr7 complement(1248862..1252338) [3477 bp, 1158 aa] {ON...    35   0.20 
SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {...    30   8.8  

>ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar to
           uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 281

 Score =  487 bits (1254), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 234/246 (95%), Positives = 234/246 (95%)

Query: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60
           MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD
Sbjct: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60

Query: 61  PKRCSGKKLERLGLIRSLRVGQKFQXXXXXXXXXXXXCPNDKSIVEEHGASVVECSWARL 120
           PKRCSGKKLERLGLIRSLRVGQKFQ            CPNDKSIVEEHGASVVECSWARL
Sbjct: 61  PKRCSGKKLERLGLIRSLRVGQKFQGVVVTPNGTGVVCPNDKSIVEEHGASVVECSWARL 120

Query: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180
           DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS
Sbjct: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180

Query: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240
           YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR
Sbjct: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240

Query: 241 MPAASQ 246
           MPAASQ
Sbjct: 241 MPAASQ 246

>TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19
           YOR006C
          Length = 301

 Score =  390 bits (1003), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 186/240 (77%), Positives = 207/240 (86%), Gaps = 4/240 (1%)

Query: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60
           M KGKNKN E ++   G+G+NGH+S+QNHK MEMK G    +  T FPVKL MWDFDHCD
Sbjct: 1   MSKGKNKNREAKNGHSGKGSNGHSSRQNHKRMEMKRG----TEDTKFPVKLAMWDFDHCD 56

Query: 61  PKRCSGKKLERLGLIRSLRVGQKFQXXXXXXXXXXXXCPNDKSIVEEHGASVVECSWARL 120
           PKRCSGKKLERLGLI+SLRVGQKFQ            CP+DKSIVEEHGASVVECSWARL
Sbjct: 57  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARL 116

Query: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180
           DEVPFN+IGG+HERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLS+FS
Sbjct: 117 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFS 176

Query: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240
           +G  FLE+N ELLEIYQQCTDA+SVK AESAWL KI+KE+++RK+QAK+EDIWMTGNVNR
Sbjct: 177 WGLGFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNR 236

>SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 430

 Score =  388 bits (997), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 187/240 (77%), Positives = 203/240 (84%), Gaps = 1/240 (0%)

Query: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60
           MGKGKNKNHE RS+RP RGANGH+S+ NHK MEMK GG S++    FPVKL MWDFDHCD
Sbjct: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAG-NKFPVKLAMWDFDHCD 59

Query: 61  PKRCSGKKLERLGLIRSLRVGQKFQXXXXXXXXXXXXCPNDKSIVEEHGASVVECSWARL 120
           PKRCSGKKLERLGLI+SLRVGQKFQ            CPND+ IVEEHGASVVECSWARL
Sbjct: 60  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARL 119

Query: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180
           DEVPF RIGG+HERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGR D ASELLSNFS
Sbjct: 120 DEVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFS 179

Query: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240
           +G  FLE+N ELLEIYQQCTDA+SVK AE AWL+KIE+E + RK Q+K EDIWM GNVNR
Sbjct: 180 WGLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNR 239

>Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {ON}
           complement(54258..55358) [1101 nt, 367 aa]
          Length = 366

 Score =  385 bits (989), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 180/240 (75%), Positives = 199/240 (82%)

Query: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60
           M KGKNK HE R+ +P RG+NGH+SK NHKHMEMK  G + S    FPVKL MWDFDHCD
Sbjct: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60

Query: 61  PKRCSGKKLERLGLIRSLRVGQKFQXXXXXXXXXXXXCPNDKSIVEEHGASVVECSWARL 120
           PKRCSGK+LERLGLI+SLRVGQKFQ            CPND+ IVEE GASVVECSWARL
Sbjct: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120

Query: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180
           DEVPFN+IGG+HERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMDWA+ELLSNFS
Sbjct: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180

Query: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240
           +G  FLEIN ELL+IYQQCTD+ESVK AE  WL KIE+EI++RK QA+  DIWM GN NR
Sbjct: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240

>Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  382 bits (981), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 180/240 (75%), Positives = 205/240 (85%), Gaps = 3/240 (1%)

Query: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60
           MGKGKNK HE ++ RP RGANGH+S+QNH+ MEMK+    NS+K  FPVKL MWDFDHCD
Sbjct: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKY---ENSDKVKFPVKLAMWDFDHCD 57

Query: 61  PKRCSGKKLERLGLIRSLRVGQKFQXXXXXXXXXXXXCPNDKSIVEEHGASVVECSWARL 120
           PKRCSGKKLERLGLI+SLRVGQKFQ            CP+D  +VE+HGASVVECSWARL
Sbjct: 58  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARL 117

Query: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180
           +EVPFN+IGG+HERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMDWASELLS+FS
Sbjct: 118 EEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFS 177

Query: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240
           +G  FLE+N ELLEIYQQCTDA+SVK AE  WL+K+EKE ++RK+QAK EDIWM GN+NR
Sbjct: 178 WGMGFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINR 237

>YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}
           TSR3Protein required for correct processing of the 20S
           pre-rRNA at site D to generate mature 18S rRNA; green
           fluorescent protein (GFP)-fusion protein localizes to
           both the cytoplasm and the nucleus
          Length = 313

 Score =  379 bits (974), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 181/246 (73%), Positives = 205/246 (83%), Gaps = 3/246 (1%)

Query: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60
           MGKGKNK HE ++ RP RGANGH+S+QNH+ MEMK+    NS K  FPVKL MWDFDHCD
Sbjct: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKY---DNSEKMKFPVKLAMWDFDHCD 57

Query: 61  PKRCSGKKLERLGLIRSLRVGQKFQXXXXXXXXXXXXCPNDKSIVEEHGASVVECSWARL 120
           PKRCSGKKLERLGLI+SLRVGQKFQ            CP+D  IVE+HGASVVECSWARL
Sbjct: 58  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARL 117

Query: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180
           +EVPFN+IGG+HERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMDWASELLS+FS
Sbjct: 118 EEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFS 177

Query: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240
           +G  FLE+N ELLEIYQQCTD +SVK AE  WL+K+EKE ++RK++AK EDIWM GN+NR
Sbjct: 178 WGMGFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINR 237

Query: 241 MPAASQ 246
               SQ
Sbjct: 238 RGNGSQ 243

>Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {ON}
           YOR006C (REAL)
          Length = 336

 Score =  379 bits (972), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 178/240 (74%), Positives = 204/240 (85%), Gaps = 3/240 (1%)

Query: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60
           MGKGKNK HE ++ RP RGANGH+S+QNHK MEMK+    NS  TNFPVKL MWDFDHCD
Sbjct: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKY---DNSEMTNFPVKLAMWDFDHCD 81

Query: 61  PKRCSGKKLERLGLIRSLRVGQKFQXXXXXXXXXXXXCPNDKSIVEEHGASVVECSWARL 120
           PKRCSGKKLERLGLI+SLRVGQKFQ            CP+D  +VE+HGASVVECSWARL
Sbjct: 82  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARL 141

Query: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180
           +EVPFN+IGG+HERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMDWAS LLS+FS
Sbjct: 142 EEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFS 201

Query: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240
           +G  FL++N ELLEIYQ+CTD+ SVK AE  WL+K+EKE ++RK+Q+K+EDIWM GNVNR
Sbjct: 202 WGLGFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNR 261

>Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  373 bits (957), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 175/240 (72%), Positives = 199/240 (82%), Gaps = 3/240 (1%)

Query: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60
           MGKGKNK HE ++ R  RGANGH+++QNHKHMEMK+     S K  FPVKL MWDFDHCD
Sbjct: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKY---DKSEKMKFPVKLAMWDFDHCD 57

Query: 61  PKRCSGKKLERLGLIRSLRVGQKFQXXXXXXXXXXXXCPNDKSIVEEHGASVVECSWARL 120
           PKRCSGKKLERLGLIRSLRVGQKFQ            CPND  IVE+HGASVVECSWARL
Sbjct: 58  PKRCSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARL 117

Query: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180
           +EVPFN+IGG++ERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVG+MDWASELLS+FS
Sbjct: 118 EEVPFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFS 177

Query: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240
           +G  FL++N ELLEIYQ+CTDA+SVK AE  WLEK+E E ++RK+  K  DIWM GN+NR
Sbjct: 178 WGLGFLDLNKELLEIYQRCTDADSVKKAEKEWLEKLEMETQERKSHTKKTDIWMMGNINR 237

>KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 314

 Score =  363 bits (931), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 173/240 (72%), Positives = 198/240 (82%), Gaps = 4/240 (1%)

Query: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60
           MGKGKNK    R  R  +G+NGH+S+ NHK MEMKH    +S  + FPVKL MWDFDHCD
Sbjct: 1   MGKGKNKESSTR-PRSQKGSNGHSSRLNHKRMEMKH---VDSTTSKFPVKLAMWDFDHCD 56

Query: 61  PKRCSGKKLERLGLIRSLRVGQKFQXXXXXXXXXXXXCPNDKSIVEEHGASVVECSWARL 120
           PKRCSGKKLERLGLI+SLRVGQKFQ            CP+DK++VEE+GASVVECSWARL
Sbjct: 57  PKRCSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARL 116

Query: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180
           DEVPFN+IGG++ERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGR D A++LLSNFS
Sbjct: 117 DEVPFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFS 176

Query: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240
           +GP+FLE+N ELL+IYQQCTD +SVK AE  WL+KIE+E  +RK QAK EDIWM GNVNR
Sbjct: 177 WGPAFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNR 236

>TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON}
           Anc_6.19 YOR006C
          Length = 342

 Score =  363 bits (932), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 169/243 (69%), Positives = 198/243 (81%), Gaps = 3/243 (1%)

Query: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKH---GGASNSNKTNFPVKLGMWDFD 57
           M KGKNK+ E RS +P RG+NGH+++ NHK MEMK    G  +NS +  FPVKL MWDFD
Sbjct: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60

Query: 58  HCDPKRCSGKKLERLGLIRSLRVGQKFQXXXXXXXXXXXXCPNDKSIVEEHGASVVECSW 117
           HCDPKRCSGKKLERLGLI+SLRVGQKFQ            CP+DK  VEE GASVVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120

Query: 118 ARLDEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLS 177
           ARLDEVPFN+IGG+HERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGR+D A+ELL 
Sbjct: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180

Query: 178 NFSYGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGN 237
           +FS+G  FLE+N ELLE+YQ+CTD+ESVK  E  WLEKI+KE+++RK+Q++  DIW+ GN
Sbjct: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240

Query: 238 VNR 240
            NR
Sbjct: 241 TNR 243

>CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006c
          Length = 325

 Score =  351 bits (900), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 165/240 (68%), Positives = 199/240 (82%), Gaps = 4/240 (1%)

Query: 2   GKGKNKNH-EVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60
           GKGKNK+H E RS + G G+NGH++++NH+HMEMK+ G S    ++FPVKL MWDFDHCD
Sbjct: 4   GKGKNKSHDEGRSNKSG-GSNGHHTRRNHRHMEMKYCGGSKD--SSFPVKLAMWDFDHCD 60

Query: 61  PKRCSGKKLERLGLIRSLRVGQKFQXXXXXXXXXXXXCPNDKSIVEEHGASVVECSWARL 120
           PKRCSGKKLERLGLI+SLRVGQKFQ            CP+D+ IVE HGASVVECSWARL
Sbjct: 61  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARL 120

Query: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180
           +EVPFN+IGG+HERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGR D A ELLS+FS
Sbjct: 121 EEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFS 180

Query: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240
           +G  FLE+N +LLE YQQCTD+ES+K  E  WL++I++E+++RK +A+ ED+WM GN NR
Sbjct: 181 WGLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNR 240

>ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR006C
          Length = 313

 Score =  350 bits (899), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 163/240 (67%), Positives = 189/240 (78%), Gaps = 4/240 (1%)

Query: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60
           M KGKNK  E R  +P +G++ HN K N +  E+KHG   ++ +T FP KL MWDFDHCD
Sbjct: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELKHG---HTKETEFPAKLAMWDFDHCD 56

Query: 61  PKRCSGKKLERLGLIRSLRVGQKFQXXXXXXXXXXXXCPNDKSIVEEHGASVVECSWARL 120
           PKRCSGKKLERLGLI+SLR+GQKFQ            CPNDK IVE+HG SVVECSWARL
Sbjct: 57  PKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARL 116

Query: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180
           DE+PF++IGGRHERLLPYLVAANQVNYGRPW+LNCVEA+AACFAIVGR D A ELLS+FS
Sbjct: 117 DEIPFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFS 176

Query: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240
           +GP FLE+N ELLE YQQCTD  S+K AE AWL+K+E+E + R+ Q   EDIWM GNVNR
Sbjct: 177 WGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNR 236

>KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {ON}
           Anc_6.19 YOR006C
          Length = 307

 Score =  345 bits (886), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 168/241 (69%), Positives = 194/241 (80%), Gaps = 5/241 (2%)

Query: 2   GKGKNKNHEVRSTRPG-RGANGHNSKQNHKHMEMK-HGGASNSNKTNFPVKLGMWDFDHC 59
           GKGKNK+    ++R   +G+NGH+S+ NHK ME++ H G      T FPVK+ MWDFDHC
Sbjct: 4   GKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKG---TKFPVKMAMWDFDHC 60

Query: 60  DPKRCSGKKLERLGLIRSLRVGQKFQXXXXXXXXXXXXCPNDKSIVEEHGASVVECSWAR 119
           DPKRCSGKKLERLGLI SL+VGQKFQ            CP+D++IVEE GASVVECSWAR
Sbjct: 61  DPKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWAR 120

Query: 120 LDEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNF 179
           LDEVPFNRIGG+HERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMD AS+LLSNF
Sbjct: 121 LDEVPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNF 180

Query: 180 SYGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVN 239
           S+G  FLE+N ELLE+YQ+CTD ESVK AE  WL KIE+E + RK +A++ DIWM GNVN
Sbjct: 181 SWGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVN 240

Query: 240 R 240
           R
Sbjct: 241 R 241

>KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} similar
           to uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 346

 Score =  341 bits (875), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 162/238 (68%), Positives = 195/238 (81%), Gaps = 7/238 (2%)

Query: 2   GKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCDP 61
           GKG NK     S++P   ++GH S   H+H+E KHG  +N +  NFPVKL MWDFD CDP
Sbjct: 7   GKGSNKQRGAHSSKP---SSGHTS--THRHVESKHG--ANKSGKNFPVKLAMWDFDQCDP 59

Query: 62  KRCSGKKLERLGLIRSLRVGQKFQXXXXXXXXXXXXCPNDKSIVEEHGASVVECSWARLD 121
           KRCSGKKLERLG+I+SLRVGQKFQ            CPND++IVEE+GA+VVECSWARLD
Sbjct: 60  KRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLD 119

Query: 122 EVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFSY 181
           EVPFN+IGGR+ERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGR+D A+ELLS+FS+
Sbjct: 120 EVPFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSW 179

Query: 182 GPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVN 239
           G  FLE+N ELLE+YQ+CTDA+S+K AE AWLE+IEKE ++RKA+   +D+W+TGNVN
Sbjct: 180 GLQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVN 237

>Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii ACR007W
          Length = 349

 Score =  333 bits (854), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 156/246 (63%), Positives = 190/246 (77%), Gaps = 5/246 (2%)

Query: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60
           MGKG+NK+++   ++  +G+NGH+S+ NH+ +E K+     S    FPV L MWDFDHCD
Sbjct: 1   MGKGRNKDYDKNHSQ--KGSNGHSSRTNHRRIETKYNAIQGSK---FPVTLAMWDFDHCD 55

Query: 61  PKRCSGKKLERLGLIRSLRVGQKFQXXXXXXXXXXXXCPNDKSIVEEHGASVVECSWARL 120
           PKRCSGKKLERLGLI+SLRV QKFQ            CPND+ I E++G SVVECSWARL
Sbjct: 56  PKRCSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARL 115

Query: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180
           +E+PF +IGGRHERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMD A  LLS+FS
Sbjct: 116 EEIPFEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFS 175

Query: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240
           +G  FLE+N E+LEIYQ+CTD +S+K AE AWL++IE E  +R+ Q K  DIWM GNVNR
Sbjct: 176 WGLGFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNR 235

Query: 241 MPAASQ 246
             A+ +
Sbjct: 236 KNASKE 241

>NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON}
           Anc_6.19 YOR006C
          Length = 323

 Score =  330 bits (847), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 156/248 (62%), Positives = 194/248 (78%), Gaps = 7/248 (2%)

Query: 1   MGKGKNKNHEVRST--RPGRGANGHNSKQNHKHMEM-KHGGASNSNKTNFPVKLGMWDFD 57
           MGKGKNK  +   +  R  RGANGH+S+ NHK+MEM KH     SN    PVKLGMWDFD
Sbjct: 1   MGKGKNKKRDDGDSKGRQHRGANGHSSRHNHKNMEMRKHENEDTSNVKKIPVKLGMWDFD 60

Query: 58  HCDPKRCSGKKLERLGLIRSLRVGQKFQXXXXXXXXXXXXCPNDKSIVEEHGASVVECSW 117
           HCDPKRCSGKKLERLGLI+SL++GQ+FQ             P D  I++E GA+VVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPEDADIIKEFGAAVVECSW 120

Query: 118 ARLDEVPFNRI----GGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWAS 173
           ARLDE+PF+++    GG++ERLLPYLVAANQVNYGRPWKLNCVEALAACFAI+GR DWA+
Sbjct: 121 ARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWAA 180

Query: 174 ELLSNFSYGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIW 233
           +LLSNFS+G +FL +N EL E+Y QCTD++S+++A+ AWL KI++E K+RK QA++ DIW
Sbjct: 181 DLLSNFSWGMNFLTLNEELFELYSQCTDSDSIQEAQEAWLNKIDEEAKERKLQAQDNDIW 240

Query: 234 MTGNVNRM 241
           + GN NR+
Sbjct: 241 LMGNTNRV 248

>Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {ON}
           YOR006C - Hypothetical ORF [contig 185] FULL
          Length = 337

 Score =  330 bits (847), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 154/230 (66%), Positives = 190/230 (82%), Gaps = 6/230 (2%)

Query: 15  RPGRGAN----GHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCDPKRCSGKKLE 70
           R  +G+N    GH+++ +  ++E KHG  +++N  NFPVKL MWDFD CDPKRCSGKKLE
Sbjct: 6   RSNKGSNKVRTGHSNRSSSGYVETKHG--AHNNGRNFPVKLAMWDFDQCDPKRCSGKKLE 63

Query: 71  RLGLIRSLRVGQKFQXXXXXXXXXXXXCPNDKSIVEEHGASVVECSWARLDEVPFNRIGG 130
           RLG+I+SLRVGQKFQ            CPNDK IVEE GA+VVECSWARL+E+PFN+IGG
Sbjct: 64  RLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIGG 123

Query: 131 RHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFSYGPSFLEINA 190
           R+ERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMD A+ELL++FS+G  FLE+N 
Sbjct: 124 RNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELNK 183

Query: 191 ELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240
           EL+E+YQ+CTDAESVK+AE++WLEKIE+E  +R+  +  +D+WMTGNVNR
Sbjct: 184 ELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNR 233

>NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {ON}
           Anc_6.19 YOR006C
          Length = 401

 Score =  325 bits (833), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 158/264 (59%), Positives = 198/264 (75%), Gaps = 21/264 (7%)

Query: 1   MGKGKNKNHE--VRSTRPGRGANGHNSKQNHKHMEMK-HGGASNSNKTN----------- 46
           MGKGKNK+ +   ++ R  RGANGH+S+ NHK+MEMK H   +++   N           
Sbjct: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104

Query: 47  ---FPVKLGMWDFDHCDPKRCSGKKLERLGLIRSLRVGQKFQXXXXXXXXXXXXCPNDKS 103
               PVKLGMWDFDHCDPKRCSGKKLERLGLI+SL++GQ+FQ             P+D  
Sbjct: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164

Query: 104 IVEEHGASVVECSWARLDEVPFNRI----GGRHERLLPYLVAANQVNYGRPWKLNCVEAL 159
           I++E GA+VVECSWARLDE+PF+++    GG++ERLLPYLVAANQVNYGRPWKLNCVEAL
Sbjct: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224

Query: 160 AACFAIVGRMDWASELLSNFSYGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKE 219
           AACFAI+GR DWAS+LLSNFS+G +FL++N EL E+Y +CTD++SVK A+  WL+KIE+E
Sbjct: 225 AACFAIIGRSDWASDLLSNFSWGLNFLKLNEELFELYSKCTDSDSVKAAQEEWLDKIEQE 284

Query: 220 IKDRKAQAKNEDIWMTGNVNRMPA 243
             +RK QA+  DIWM GN NR+ A
Sbjct: 285 ATERKLQAQETDIWMMGNTNRLDA 308

>KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}
           Anc_6.19 YOR006C
          Length = 329

 Score =  293 bits (749), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 139/225 (61%), Positives = 176/225 (78%), Gaps = 6/225 (2%)

Query: 20  ANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCDPKRCSGKKLERLGLIRSLR 79
           +NGH+S+ N+K ME K      S +T+FPVKL MWDFDHCDPKRCSGKKLERL LIRSL+
Sbjct: 23  SNGHHSRHNNKKMEFKQHV---SRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLK 79

Query: 80  VGQKFQXXXXXXXXXXXXCPNDKSIVEEHGASVVECSWARLDEVPFNRIGG-RHERLLPY 138
           + QKFQ             P D+ +V E G +VVECSWAR+DE+PF++    + +RLLPY
Sbjct: 80  INQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPY 139

Query: 139 LVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFSYGPSFLEINAELLEIYQQ 198
           LVAANQVNYGRPWKLNCVEA+AAC AIVG MD A ELLS+FS+G +FL++N ELLEIYQQ
Sbjct: 140 LVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQ 199

Query: 199 CTDAESVKDAESAWLEKIEKEIKDRKAQ--AKNEDIWMTGNVNRM 241
           CTD++ ++ A+ AW+++IEKE+++RKA   A+N DIWM+GNVNR+
Sbjct: 200 CTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRI 244

>TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {ON}
           Anc_6.19 YOR006C
          Length = 304

 Score =  284 bits (727), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 142/242 (58%), Positives = 173/242 (71%), Gaps = 11/242 (4%)

Query: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60
           M KGKNK HE RS R       +NS++N    E KH  +  S KTNFPVKL MWDFDHCD
Sbjct: 1   MAKGKNKGHEERSNR-----KSNNSRRN----ESKHSLSIKSTKTNFPVKLAMWDFDHCD 51

Query: 61  PKRCSGKKLERLGLIRSLRVGQKFQXXXXXXXXXXXXCPNDKSIVEEHGASVVECSWARL 120
           PKRCSGKKLER GL +SLRVGQ+F              P D+  +E++G +VVECSWARL
Sbjct: 52  PKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARL 111

Query: 121 DEVPFNRIGGR--HERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSN 178
           DEVPFN++GG+  +E LLPYLVAAN VNYGRPW+LNCVEA AAC AIVG  ++AS++L  
Sbjct: 112 DEVPFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEG 171

Query: 179 FSYGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNV 238
           FS+G +FLE+N ELL+IY  CTD+ SV+ A+  WLEKIE E K+RK +  + D W+ GN 
Sbjct: 172 FSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNT 231

Query: 239 NR 240
           NR
Sbjct: 232 NR 233

>AGR273C Chr7 complement(1248862..1252338) [3477 bp, 1158 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR272C
           (YCS4)
          Length = 1158

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 7/79 (8%)

Query: 130 GRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWA-SELLSNFSYGPSFLEI 188
           G   R L  LV   QV   +  KL  +  +A C    G+     + +LSN +Y P     
Sbjct: 192 GLFTRPLFVLVETEQVVKVQSLKLFIINVIATCVKKHGQYSSVQNAILSNLTYFPHLTAF 251

Query: 189 NAELLEI------YQQCTD 201
           NAELL++      Y Q T+
Sbjct: 252 NAELLQVISTEFEYPQLTE 270

>SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {ON}
           similar to gnl|GLV|CAGL0J03586g Candida glabrata
           CAGL0J03586g and weakly similar to YCR066W
           uniprot|P10862 Saccharomyces cerevisiae YCR066W RAD18
           Protein involved in postreplication repair binds
           single-stranded DNA and has single-stranded DNA
           dependent ATPase activity forms heterodimer with Rad6p
           contains RING-finger motif
          Length = 468

 Score = 29.6 bits (65), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 2/82 (2%)

Query: 162 CFAIVGRMDWASELLSNFSYGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIK 221
           C   +      SE L N   G S+L+I + L++  +   + E+ K+ ES+    IE    
Sbjct: 81  CLVELRESMLRSEFLVNEIIG-SYLDIRSRLMKCLEPVKNLET-KENESSVSTMIEIPSD 138

Query: 222 DRKAQAKNEDIWMTGNVNRMPA 243
           D  A   ++DI +TG  N  PA
Sbjct: 139 DGNATDGDDDIEITGVNNSRPA 160

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,861,953
Number of extensions: 1009496
Number of successful extensions: 4107
Number of sequences better than 10.0: 23
Number of HSP's gapped: 4159
Number of HSP's successfully gapped: 23
Length of query: 281
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 173
Effective length of database: 41,097,471
Effective search space: 7109862483
Effective search space used: 7109862483
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)