Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07810g6.20ON1099109956840.0
TDEL0G044906.20ON1093109425430.0
Sklu_YGOB_Anc_6.20b6.20ON1088110320920.0
Suva_13.1606.20ON1090109620450.0
Skud_13.1526.20ON1090107820350.0
Smik_13.1576.20ON1090107820270.0
Sklu_YGOB_Anc_6.20singletonOFF84986718000.0
KLTH0C11242g6.20ON1097111017460.0
Ecym_30246.20ON1079112717120.0
Kpol_1037.256.20ON1105111816990.0
ACR006C6.20ON1071110216760.0
Kwal_56.224246.20ON1089111316020.0
TPHA0J003306.20ON1107110215810.0
CAGL0L07634g6.20ON1130109115580.0
NCAS0H008206.20ON1146114815520.0
KNAG0M011606.20ON1131114614650.0
KLLA0D01133g6.20ON1067111114410.0
YML002W6.20ON73772713861e-177
NDAI0D008006.20ON1193119212931e-158
TBLA0A072606.20ON1204117710921e-129
KAFR0L004006.20ON9428387906e-89
YML003WsingletonOFF2902915413e-61
Smik_8.905.267ON192768830.49
Smik_14.1482.73ON555151800.80
TPHA0K007507.409ON857106753.3
YHR023W (MYO1)5.267ON192868753.9
NCAS0D016805.129ON26565734.3
Skud_14.1522.73ON591113745.0
KAFR0B042705.94ON100479735.8
Kpol_526.325.626ON77758736.3
YNL182C (IPI3)2.73ON55582727.3
Suva_15.2095.267ON192968728.4
Ecym_42618.331ON3698139728.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C07810g
         (1099 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] ...  2194   0.0  
TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {...   984   0.0  
Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...   810   0.0  
Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML00...   792   0.0  
Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML00...   788   0.0  
Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML00...   785   0.0  
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...   697   0.0  
KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] ...   677   0.0  
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...   664   0.0  
Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON} (56141...   659   0.0  
ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...   650   0.0  
Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML00...   621   0.0  
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...   613   0.0  
CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]...   604   0.0  
NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6....   602   0.0  
KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6...   568   0.0  
KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some ...   559   0.0  
YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative p...   538   e-177
NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6....   502   e-158
TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_...   425   e-129
KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20...   308   6e-89
YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative p...   213   3e-61
Smik_8.90 Chr8 (131286..137069) [5784 bp, 1927 aa] {ON} YHR023W ...    37   0.49 
Smik_14.148 Chr14 complement(275170..276837) [1668 bp, 555 aa] {...    35   0.80 
TPHA0K00750 Chr11 (155270..157843) [2574 bp, 857 aa] {ON} Anc_7....    33   3.3  
YHR023W Chr8 (151666..157452) [5787 bp, 1928 aa] {ON}  MYO1Type ...    33   3.9  
NCAS0D01680 Chr4 (319293..320090) [798 bp, 265 aa] {ON} Anc_5.129      33   4.3  
Skud_14.152 Chr14 complement(286929..288704) [1776 bp, 591 aa] {...    33   5.0  
KAFR0B04270 Chr2 (885178..888192) [3015 bp, 1004 aa] {ON} Anc_5....    33   5.8  
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    33   6.3  
YNL182C Chr14 complement(295960..297627) [1668 bp, 555 aa] {ON} ...    32   7.3  
Suva_15.209 Chr15 (358888..364677) [5790 bp, 1929 aa] {ON} YHR02...    32   8.4  
Ecym_4261 Chr4 (543956..555052) [11097 bp, 3698 aa] {ON} similar...    32   8.7  

>ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] {ON}
            similar to uniprot|Q04257 Saccharomyces cerevisiae
            YML003W/YML002W Hypothetical ORF
          Length = 1099

 Score = 2194 bits (5684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1067/1099 (97%), Positives = 1067/1099 (97%)

Query: 1    MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS 60
            MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS
Sbjct: 1    MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS 60

Query: 61   MNDLCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGF 120
            MNDLCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGF
Sbjct: 61   MNDLCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGF 120

Query: 121  PLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPRGLAQGNFNGVDA 180
            PLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPRGLAQGNFNGVDA
Sbjct: 121  PLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPRGLAQGNFNGVDA 180

Query: 181  KGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPYEELFRMIVKQVHA 240
            KGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPYEELFRMIVKQVHA
Sbjct: 181  KGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPYEELFRMIVKQVHA 240

Query: 241  KMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEPLKFLSINELETEL 300
            KMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEPLKFLSINELETEL
Sbjct: 241  KMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEPLKFLSINELETEL 300

Query: 301  YQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQSLSNTREQDMDI 360
            YQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQSLSNTREQDMDI
Sbjct: 301  YQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQSLSNTREQDMDI 360

Query: 361  QTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGILGYAISTLEAV 420
            QTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGILGYAISTLEAV
Sbjct: 361  QTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGILGYAISTLEAV 420

Query: 421  VFYFXXXXXXXXXXXXXXXSNKAKELYILISDKSTGQAVLDISQFRSNLEFRTPQGESVL 480
            VFYF               SNKAKELYILISDKSTGQAVLDISQFRSNLEFRTPQGESVL
Sbjct: 421  VFYFDGLKGTKKLQKLQDDSNKAKELYILISDKSTGQAVLDISQFRSNLEFRTPQGESVL 480

Query: 481  SQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDNSEAAQMIVEVLQ 540
            SQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDNSEAAQMIVEVLQ
Sbjct: 481  SQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDNSEAAQMIVEVLQ 540

Query: 541  NSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSNGHTPLFTIFRCY 600
            NSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSNGHTPLFTIFRCY
Sbjct: 541  NSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSNGHTPLFTIFRCY 600

Query: 601  DQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVSILLDYDNVDIN 660
            DQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVSILLDYDNVDIN
Sbjct: 601  DQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVSILLDYDNVDIN 660

Query: 661  CTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYARNPLVLKELVSQ 720
            CTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYARNPLVLKELVSQ
Sbjct: 661  CTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYARNPLVLKELVSQ 720

Query: 721  AIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTLQNLFQVLLKMHF 780
            AIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTLQNLFQVLLKMHF
Sbjct: 721  AIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTLQNLFQVLLKMHF 780

Query: 781  ASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLRHDNLNKLVLRESRLV 840
            ASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLRHDNLNKLVLRESRLV
Sbjct: 781  ASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLRHDNLNKLVLRESRLV 840

Query: 841  SWIRSQDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELSAVXXXXXXXXXXXXXXXX 900
            SWIRSQDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELSAV                
Sbjct: 841  SWIRSQDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELSAVKLKLMTMKKLLIFLKL 900

Query: 901  XNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLEINCCAFGEEATMTFVREIAFLENCTGKL 960
             NTDLTHSYQFLSLFGTEYNLAQDRLLFKDLEINCCAFGEEATMTFVREIAFLENCTGKL
Sbjct: 901  KNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLEINCCAFGEEATMTFVREIAFLENCTGKL 960

Query: 961  LDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNISRNDSGTGIIASFFEGKREKMESK 1020
            LDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNISRNDSGTGIIASFFEGKREKMESK
Sbjct: 961  LDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNISRNDSGTGIIASFFEGKREKMESK 1020

Query: 1021 LSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKSNFFINGILRRAVRENINILKGR 1080
            LSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKSNFFINGILRRAVRENINILKGR
Sbjct: 1021 LSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKSNFFINGILRRAVRENINILKGR 1080

Query: 1081 LVEMRKRALYRSRKGENNI 1099
            LVEMRKRALYRSRKGENNI
Sbjct: 1081 LVEMRKRALYRSRKGENNI 1099

>TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {ON}
            Anc_6.20 YML002W
          Length = 1093

 Score =  984 bits (2543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/1094 (46%), Positives = 715/1094 (65%), Gaps = 21/1094 (1%)

Query: 1    MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS 60
            M YH+PVLLNPLVN+VFNC NPS S  KKLF  LK  +FILLVPP ++LL   D  SGS 
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSP 60

Query: 61   MNDLCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGF 120
            + +LC +Y+FVASH+LL+ +   ++       SQ ++ TLN K+V VRS +  ILT++GF
Sbjct: 61   LQELCYSYEFVASHVLLIDEQN-AEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGF 119

Query: 121  PLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIR--KIDIPRGLAQGNFNGV 178
             +++R  I   +L  NFN+YL    KF ++ ID P+    +R  ++ I + L  G     
Sbjct: 120  QVKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETK 179

Query: 179  DAKGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPYEELFRMIVKQV 238
            D   S   D +Q S SSF+NILR+HPDW+   N  F  YRSTP  + P+ ELF  I+++ 
Sbjct: 180  DG-SSPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGDDPHIELFHDIIRRA 238

Query: 239  HAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEPLKFLSINELET 298
            ++ M +D LF  +P L DLI+DYVELNL+DD+W+RI + ++  E+++  L++LS+++LET
Sbjct: 239  YSAMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVESNGLRYLSLHQLET 298

Query: 299  ELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQSLSNTREQDM 358
             LY  K+E+F L+ V +ME NI+LA+NSF  LPL H HA+KA  LI+TL++LS     D 
Sbjct: 299  GLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLSRV---DK 355

Query: 359  DIQTL-PITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGILGYAISTL 417
             IQ + P+ + ADTL+S FVLV+CRTQ++N+K  LFYL+ F+K+E SI FG+LGYAISTL
Sbjct: 356  SIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYAISTL 415

Query: 418  EAVVFYFXXXXXXXXXXXXXXXSNKAKELYILISDKSTGQAVLDISQFRSNLEFRTPQGE 477
            EA V YF                  A+ L   +S +S+    +++  ++  L +RT QGE
Sbjct: 416  EAAVCYFDELKGSKKMSRLESECENARSLVDKLSSESSS---VNLIHYQKTLSYRTEQGE 472

Query: 478  SVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDNSEAAQMIVE 537
            S+LS CI N KN +L ELL + E  FPLEDIL+D+T +G TLL+Q+LKC N +AA +IV+
Sbjct: 473  SLLSICIANGKNDILQELLSD-ERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASLIVD 531

Query: 538  VLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSNGHTPLFTIF 597
            ++++SCT++E+  Y NR+DK++RT AHYLTHE+NILE IG + +W  +DS+GHT LFTIF
Sbjct: 532  LIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALFTIF 591

Query: 598  RCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVSILLDYDNV 657
            R YDQ NY+ MI A+FR A  WY      F F+ HED K NTLLHI+K ++SILL+Y++V
Sbjct: 592  RSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEYESV 651

Query: 658  DINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYARNPLVLKEL 717
            D+N  N+KGLTPLM+Y +YNR DN K+I+ D+R+IL K+QHP  L S DYA+NPL+L E+
Sbjct: 652  DVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLILHEI 711

Query: 718  VSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTLQNLFQVLLK 777
              Q+   TAF   FVH LKYE+ SW  +ITV+  A     ++TV+ H+KT+QN F+ +L+
Sbjct: 712  AKQSAMDTAFGKCFVHTLKYESSSWLVNITVQ--ADRKGNFETVEFHLKTVQNFFRTVLR 769

Query: 778  MHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLRHDNLNKLVL-RE 836
                +FLPL+  L  L++L K+R+ SI KLET+ +   LT+CF+VL+    L K +L  E
Sbjct: 770  TCPMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILANE 829

Query: 837  SRLVSWIRSQDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELSAVXXXXXXXXXXXX 896
            S+L+SWI+ Q K   N       K VEPEE+ I+  FLRFN+ ELS +            
Sbjct: 830  SKLLSWIKVQYKAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKLAI 889

Query: 897  XXXXXNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLEINC-CAFGEEATMTFVREIAFLEN 955
                 ++D+  S + L   G+E     D     D + +C   +G ++ +  V +I  +  
Sbjct: 890  FLRLKSSDVEQSVELLLPLGSEG--MGDLYPLTDHKFSCTTVYGNDSMILLVEDIDLMLK 947

Query: 956  CTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNISRN---DSGTGIIASFFEG 1012
            CT +L D +  LL V IPEWWKLYG++L   K Y Q FP++ +N    +  GII    EG
Sbjct: 948  CTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETSTDAGIIGKILEG 1007

Query: 1013 KREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKSNFFINGILRRAVRE 1072
            K+EK+E +LS  +A+ ++ M + G  I+  HE LAE+LSK+MEFK  +   G+++R VRE
Sbjct: 1008 KKEKLEKRLSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWVRE 1067

Query: 1073 NINILKGRLVEMRK 1086
            NI  LK RL+ +++
Sbjct: 1068 NIKELKERLIHIQR 1081

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
            aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/1103 (40%), Positives = 655/1103 (59%), Gaps = 43/1103 (3%)

Query: 1    MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS 60
            M YH+P+LLNPLVNSVFNC  PS S  KK+F  L+ +RFIL+VP    LL++ D ++GSS
Sbjct: 1    MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60

Query: 61   MNDLCQNYDFVASHILLLQQDT-YSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEG 119
            + DLC  Y+FVA+HI++L++D+ YSD          E+KTLN K V +RS +G +LT +G
Sbjct: 61   LQDLCYTYEFVANHIIILKKDSKYSD---------QEFKTLNGKTVLIRSQNGIVLTGDG 111

Query: 120  FPLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPR-GLAQGNFNGV 178
            FP +RR +I N EL  NFNDYL GS+ F L+HID PL+   ++  ++   G+   N + +
Sbjct: 112  FPSKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGVRSTNTSSL 171

Query: 179  DAKGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTE----GPYEELFRMI 234
                 L  DLTQ+  SSFE + RLHP   +  +G F   R              + F   
Sbjct: 172  ----PLSTDLTQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKF 227

Query: 235  VKQVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEI----DTEPLKF 290
              +    + ++  F     L+  + +YVELNL+DD+W +I   YR DEI    D   LK+
Sbjct: 228  NYEAFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKY 287

Query: 291  LSINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQSL 350
            ++I+++ T  Y +K  KF L+ VT  EK+++ A + F  L  + +H+EK   +++TLQ+L
Sbjct: 288  IAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTL 347

Query: 351  SNTRE-QDMDIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGI 409
            ++  E  D DI+   +T+DADTLI   VLVVCR+QVKN+KSHLFYL+ FS DEN+IKFG+
Sbjct: 348  TDYSEFPDADIE--DVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGV 405

Query: 410  LGYAISTLEAVVFYFXXXXXXXXXXXXXXXSNKAKELYILISDKSTGQAVLDISQFRSNL 469
            + YA+STLEAV+ YF                 + K+ +  +S K+   +   +  +R  L
Sbjct: 406  VAYALSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKAV--SFDSLKSYRDIL 463

Query: 470  EFRTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDNS 529
              RT  GES LS CI       +  LL+N+E   PLEDILDD+T++GSTLL+Q L+  N+
Sbjct: 464  RIRTAGGESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNT 523

Query: 530  EAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSNG 589
              A +++E+L  SCT  ELREY+NR ++ +RT AHYLT ++ + + IG + +W+++D +G
Sbjct: 524  RMADVLLEILCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDISG 583

Query: 590  HTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVS 649
            HTPLF IFR YD  +Y  M++ AFR+A +WY+  GE+F FS H+D KGNTLLH++K N+ 
Sbjct: 584  HTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIE 643

Query: 650  ILLDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYAR 709
            ILL+ +N+D+N  NKKGLTPLM+Y +YNR DNVK I+RD R+I++K Q   FLN FDY +
Sbjct: 644  ILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVK 703

Query: 710  NPLVLKELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTLQ 769
            NP++  EL   A + T F     H  ++E   WF  IT+K G   + +++TVK +I+ +Q
Sbjct: 704  NPVIQAELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLK-GKDRETDFQTVKHNIRAIQ 762

Query: 770  NLFQVLLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLRHDNL 829
             L QV L+ +  SFLP++  LEDL  + K+ + S+ KLE   F   LT    ++ + +  
Sbjct: 763  GLLQVYLRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEF 822

Query: 830  NK-LVLRESRLVSWIRSQDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELSAVXXXX 888
             K L L  S LV+WIR   +K  N       + +EPEEI  + SFLRFN  ELS +    
Sbjct: 823  KKALYLPASDLVNWIRESGRKRTNV-----SRRIEPEEINSIQSFLRFNLSELSLIRDKI 877

Query: 889  XXXXXXXXXXXXXNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLEINCCAFGEEATMT--- 945
                           D+  +     LF     L +D  + +   I+  +  +   ++   
Sbjct: 878  SILQKLSIFSELKAQDINQAR--CMLFSQSVRL-EDTAISQAFGISGLSEKDSEDLSATI 934

Query: 946  FVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNISRN--DSGT 1003
                I FL+ CT KL+ +++QLL   +  WWKLY ++L+    Y + FPN  +   D   
Sbjct: 935  LTSNIDFLKECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKPHLDDNK 994

Query: 1004 GIIASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKSNFFIN 1063
            G+  ++ EGKR K+E KLS+ +  C +R++ +   +   HE LAEELS Y+EFK+N+   
Sbjct: 995  GLFGTYVEGKRSKLEEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRT 1054

Query: 1064 GILRRAVRENINILKGRLVEMRK 1086
            GI++      IN LK  +   ++
Sbjct: 1055 GIIQDFTVGKINTLKDTMRHFKR 1077

>Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/1096 (39%), Positives = 655/1096 (59%), Gaps = 32/1096 (2%)

Query: 3    YHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSSMN 62
            YH+P LLNPL+N++FNC  P  S  KKLF  L+T RFILL PP+  LL + D ++   ++
Sbjct: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLH 63

Query: 63   DLCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGFPL 122
            +LC N DF+ SHILL  +++Y     N +     Y+TL+ K V V+  +  I T  GFPL
Sbjct: 64   ELCYNADFINSHILLTTENSY----INTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPL 119

Query: 123  RRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPRGLAQGNFNGVDAKG 182
            RRR +I + +++ NFNDY  G+E FA+++ID PL G      D              A+ 
Sbjct: 120  RRRLKILDTKILPNFNDYFKGAEYFAILYIDQPL-GCEFVPNDYLHCFNSYEETSKTARN 178

Query: 183  S--LVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPYEELFRMIVKQVHA 240
            +  L+ D +Q   SSFENIL +HP W   L   F+ YR   L + P +++F  +V+Q   
Sbjct: 179  APNLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKMFEELVEQAFD 238

Query: 241  KMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEPLKFLSINELETEL 300
             M +D LF+   +LYDLI DY ELNL++D+W R+   ++  E++TE  ++ S+N+L T+ 
Sbjct: 239  GMKSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTENCEYFSVNQLLTDY 298

Query: 301  YQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQSLSNTREQDMDI 360
            Y K +E F+L D+T +E+ + +A   F  L L+H++AEK+  L+ TLQ LS T +     
Sbjct: 299  YSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTTDMGSHK 358

Query: 361  QTLP-----ITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGILGYAIS 415
              L      +TMDADTLIS FVLVVCR++ K+I+SHL+YL+ FS + +S KFGILGYAIS
Sbjct: 359  PDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFSNNSSSSKFGILGYAIS 418

Query: 416  TLEAVVFYFXXXXXXXXXXXXXXX-SNKAKELYILISDKSTGQAVLDISQFRSNLEFRTP 474
            TLEAVV YF                  K ++L   +S ++    V D++ ++  L +R  
Sbjct: 419  TLEAVVCYFENFNKNNNNVAKANLLCIKTRDLLDKLSCENPTNEVNDLATYKDILAYRNE 478

Query: 475  QGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDNSEAAQM 534
            QG+S+LS CI N+KN +L ++L  YE +FP+EDIL+DET+DGSTLLI+++K  N EA ++
Sbjct: 479  QGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVGNLEATKI 538

Query: 535  IVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSNGHTPLF 594
            ++ ++  +CT++EL  YVN+ DK  R+VAHYLTHEM+IL+SIG YINWK ++S+G TPLF
Sbjct: 539  LIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNSSGQTPLF 598

Query: 595  TIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVSILLDY 654
            +IFR YDQ NYE M+  AF  A  WYQ +   F +SDH DNKGN+LLH++K +VSILL  
Sbjct: 599  SIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDVSILLQL 658

Query: 655  DNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYARNPLVL 714
              ++IN  N KGLTPLM+Y +Y R  N+  I +D R+IL+K+Q+ +F   FDYA++ LVL
Sbjct: 659  TKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDYAKDRLVL 718

Query: 715  KELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTLQNLFQV 774
             ++  +    + F L ++H L+Y   +   ++T    +  +E + T  +++KT+Q L + 
Sbjct: 719  SKIGERGANDSIFGLIYLHSLRYHNLNATVNVTSV--SKTEEPFVTAVINMKTIQGLLRS 776

Query: 775  LLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLRHDNLNK-LV 833
            ++K +  +FLP++  ++ +S+L +S +  I K +     + LT+CF+VLL    + + L 
Sbjct: 777  IVKDNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLF 836

Query: 834  LRESRLVSWIRSQDKKCNNSKKLQK------QKNVEPEEIGIMASFLRFNRGELSAVXXX 887
              E+ ++ W+R      N S++ QK       K +EPEEI ++ SFLRFN  E+ +    
Sbjct: 837  TDEASVLYWMR-----INTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKAS 891

Query: 888  XXXXXXXXXXXXXXNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLEINCCAFGEEATMTFV 947
                          ++D   +Y  L   GT+    +    F  +  N   F + +    +
Sbjct: 892  LNILRKILIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHKMFSDLSLDELL 951

Query: 948  REIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNISRNDSGTGI-- 1005
              + FLE CT +L + ++ +L   IP WWK YG+ L +HK Y++ FP+  +  S  G   
Sbjct: 952  EHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGTSS 1011

Query: 1006 ---IASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKSNFFI 1062
               +  F E KRE+ E +LS  +    K ++ +G  I S HE LAEELS YMEF+     
Sbjct: 1012 HIPLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACLD 1071

Query: 1063 NGILRRAVRENINILK 1078
               +     +NI++L+
Sbjct: 1072 QRTIVAFAIKNISVLQ 1087

>Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/1078 (40%), Positives = 647/1078 (60%), Gaps = 36/1078 (3%)

Query: 2    AYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSSM 61
             YH+P LLNPL+N++FNC  P  S  KKLF  LKT RFILL PP   LL + D ++   +
Sbjct: 3    VYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPL 62

Query: 62   NDLCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGFP 121
            ++LC N DF+ SHILL  +++Y     N +   + Y+TL+ K V ++  +  I    GFP
Sbjct: 63   HELCYNVDFINSHILLTTENSY----LNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFP 118

Query: 122  LRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPRGLAQGNFNGVDAK 181
            +R+R +I   +++ NFNDY  G+  FA++ ID PL    +   D  +     ++  V   
Sbjct: 119  IRQRLKILETKVLPNFNDYFEGAADFAILFIDQPL-NCEVAPNDYLKCF--DSYEEVPKN 175

Query: 182  GSLVRDLTQKSW----SSFENILRLHPDWSNILNGYFNRYRSTPLTEGPYEELFRMIVKQ 237
               V +L   S+    SSF+NIL +H      L   F+ YR     + P +++F  IV+Q
Sbjct: 176  AQSVSNLPVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKMFEDIVQQ 235

Query: 238  VHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEPLKFLSINELE 297
                M +D LF+   +LYDLI DY ELNL+DD+W R+V  ++  E+DTE  K+ S+N+L 
Sbjct: 236  SFDGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEKYKYFSVNQLL 295

Query: 298  TELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQSLSNTREQD 357
             + + K +++F+L D+T +E+ +++A   F  L LTH++AEK+  L+ TLQ LS   E  
Sbjct: 296  ADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTEIS 355

Query: 358  MDIQTLP-----ITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGILGY 412
               Q LP     +TMDADTL+S FVLVVCR++ K++KSHL+YL+ FS + +S KFGILGY
Sbjct: 356  SHQQELPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGILGY 415

Query: 413  AISTLEAVVFYFXXXXXXXXXXXXXXXS-NKAKELYILISDKSTGQAVLDISQFRSNLEF 471
            AISTLEAVV YF               S  K +EL   +S ++    + +++ +  NL++
Sbjct: 416  AISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLATYEDNLQY 475

Query: 472  RTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDNSEA 531
            R  QG+S+LS CI N KN +L ++L  YED+FP+EDIL+DET+DGSTLLI+++K  N EA
Sbjct: 476  RNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKTGNIEA 535

Query: 532  AQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSNGHT 591
            A++++ ++  +C+E EL  YVN+ADK  RTVAHYLTHEM+IL+SIG Y++WK ++S+G T
Sbjct: 536  AKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKNSSGQT 595

Query: 592  PLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVSIL 651
            PLF+IFR YDQ NYE M+  AF  A  WYQ +   F + DH D+KGN+LLHI+K++VSIL
Sbjct: 596  PLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDVSIL 655

Query: 652  LDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYARNP 711
            L    +DIN  N KGLTPLMIY +Y R  N+  I +D R+IL+K+Q+ +F   FDYA++ 
Sbjct: 656  LQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFDYAKDH 715

Query: 712  LVLKELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTLQNL 771
             VL ++  +  + + F L ++H L+Y   +   +IT    +  D+ + T  +++KT+Q L
Sbjct: 716  SVLSKIGERGARDSLFGLVYLHSLRYHNLNATTNITT--ASNTDKPFLTTVINMKTIQGL 773

Query: 772  FQVLLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLRHDNLNK 831
             + +LK +  +FLPL   ++++S+L +S +  I K +     + LT+CF+VLL    + +
Sbjct: 774  LRSILKDNQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQ 833

Query: 832  -LVLRESRLVSWIRSQDKKCNNSKKLQK------QKNVEPEEIGIMASFLRFNRGELSAV 884
             L   E+ ++ W+R      N SK+ QK       K +EPEEI ++ SFLRFN  E+S+ 
Sbjct: 834  NLFTDEASVLYWMR-----INTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSF 888

Query: 885  XXXXXXXXXXXXXXXXXNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLEINCCAFGEEATM 944
                             + D   +Y  L   G +    +    F  +  N   F + A  
Sbjct: 889  KASLNILRKILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFSDLALA 948

Query: 945  TFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNISRNDSGTG 1004
              +  ++FLE CT +L   V+ +L   I +WWK YG+ L + K Y++ FP++ +  S T 
Sbjct: 949  ELLEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATD 1008

Query: 1005 I-----IASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFK 1057
                  + SF E KRE+ E +L+  +    K ++ +G  I + HE LAEELS YMEF+
Sbjct: 1009 TPSHIPLGSFIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFR 1066

>Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/1078 (39%), Positives = 644/1078 (59%), Gaps = 40/1078 (3%)

Query: 4    HIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSSMND 63
            H+P LLNPL+N++FNC  P  S  KKLF  LKT RFILL PP+E LL + D ++   +++
Sbjct: 5    HLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHE 64

Query: 64   LCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGFPLR 123
            LC N +F+ SHILL+ ++++     N ++  + Y+TL+ K V ++  +  I    GF +R
Sbjct: 65   LCYNAEFINSHILLMTENSF----INTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVR 120

Query: 124  RRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPRGLAQGNFN------G 177
            RR +I   +++ NFNDY  G+  F +++I+ PL         +P    Q   +       
Sbjct: 121  RRLKILGTKILPNFNDYFEGATDFVIIYIEQPLSCE-----SVPNDYLQCFHSYKKIPKS 175

Query: 178  VDAKGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPYEELFRMIVKQ 237
            V +  +L  D +Q+  SSFENIL +HP     L   F+ YR+   ++ P E++F  IV+Q
Sbjct: 176  VYSVHNLSLDSSQQERSSFENILHIHPTRLTQLGEMFSNYRTLAPSDDPSEKIFECIVQQ 235

Query: 238  VHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEPLKFLSINELE 297
                M +D LF+K P+LYDLI +Y ELNL+DD+W R+ + ++  E+ TE  K+ SIN L 
Sbjct: 236  AFEGMKSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEEYKYFSINHLL 295

Query: 298  TELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQSLSNTREQD 357
             + Y K + +F+LQDVT +EK + LA   F  L LTH++ EK+  L+ TLQ LS T +  
Sbjct: 296  ADFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMG 355

Query: 358  MDIQTLP-----ITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGILGY 412
                 +P     + MDADTLIS FVLV+CR++ K++KSHL+YL+ FS + +S KFGILGY
Sbjct: 356  SHQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFSNNSSSSKFGILGY 415

Query: 413  AISTLEAVVFYFXX-XXXXXXXXXXXXXSNKAKELYILISDKSTGQAVLDISQFRSNLEF 471
            A+STLEAVV YF                  K K L  ++S ++    V +++ ++  L +
Sbjct: 416  AVSTLEAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDILPY 475

Query: 472  RTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDNSEA 531
            R  QG+S+LS CI N+KN +L ++L  Y+ IFPLED+L+DET+DGSTLLI+++K  N EA
Sbjct: 476  RNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEA 535

Query: 532  AQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSNGHT 591
            A++++ ++  +CTE+EL  Y+NR DK  RTVAHYLTHE++IL+SIG Y++WK ++S G T
Sbjct: 536  AKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGGQT 595

Query: 592  PLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVSIL 651
            PLF+IFR YDQ NYEAM+  AF  A  WY+     F + DH DNKGN LLH++K + SIL
Sbjct: 596  PLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASIL 655

Query: 652  LDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYARNP 711
            L    +DIN  N KGLTPLM+Y +Y R +N++ II+DQR++L+K+Q  +F   FDYA++ 
Sbjct: 656  LQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAKDH 715

Query: 712  LVLKELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTLQNL 771
             VL ++  +  K + F L + H L+Y   +   +IT    +  ++ +    +++KT+Q L
Sbjct: 716  TVLSKVGERGAKDSLFGLIYFHSLRYHNLNAAVNIT--FASDTEKPFSNTVINMKTIQGL 773

Query: 772  FQVLLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLRHDNLNK 831
             + +LK +  +FLPL   ++++S L +S +  I K + +   + L++CF+VLL    + K
Sbjct: 774  LRSILKDNPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLFLKKVPK 833

Query: 832  -LVLRESRLVSWIRSQDKKCNNSKKLQKQ------KNVEPEEIGIMASFLRFNRGELSAV 884
             L   E+ ++ W+R      N SK+ QKQ      K +EPEEI ++ SFLRFN  E+S+ 
Sbjct: 834  SLFTDEASILYWMR-----INTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSF 888

Query: 885  XXXXXXXXXXXXXXXXXNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLEINCCAFGEEATM 944
                             + D       L+  G     A+    F     N   F + +  
Sbjct: 889  KASLSILRKILIFISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNMFNDYSLA 948

Query: 945  TFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNISRNDSGTG 1004
              +  + FLE CT +L + V+ +L   IP WWK YG+++ +HK Y++ FP++ +  S T 
Sbjct: 949  KLLEHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTD 1008

Query: 1005 I-----IASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFK 1057
                  +  F E KRE+ E +L+  +    K ++ +G  I   HE LAEELS YMEF+
Sbjct: 1009 TSGHIQLGGFIETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFR 1066

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/867 (43%), Positives = 540/867 (62%), Gaps = 30/867 (3%)

Query: 1   MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS 60
           M YH+P+LLNPLVNSVFNC  PS S  KK+F  L+ +RFIL+VP    LL++ D ++GSS
Sbjct: 1   MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60

Query: 61  MNDLCQNYDFVASHILLLQQDT-YSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEG 119
           + DLC  Y+FVA+HI++L++D+ YSD          E+KTLN K V +RS +G +LT +G
Sbjct: 61  LQDLCYTYEFVANHIIILKKDSKYSD---------QEFKTLNGKTVLIRSQNGIVLTGDG 111

Query: 120 FPLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPR-GLAQGNFNGV 178
           FP +RR +I N EL  NFNDYL GS+ F L+HID PL+   ++  ++   G+   N + +
Sbjct: 112 FPSKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGVRSTNTSSL 171

Query: 179 DAKGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTE----GPYEELFRMI 234
                L  DLTQ+  SSFE + RLHP   +  +G F   R              + F   
Sbjct: 172 ----PLSTDLTQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKF 227

Query: 235 VKQVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEI----DTEPLKF 290
             +    + ++  F     L+  + +YVELNL+DD+W +I   YR DEI    D   LK+
Sbjct: 228 NYEAFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKY 287

Query: 291 LSINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQSL 350
           ++I+++ T  Y +K  KF L+ VT  EK+++ A + F  L  + +H+EK   +++TLQ+L
Sbjct: 288 IAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTL 347

Query: 351 SNTRE-QDMDIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGI 409
           ++  E  D DI+   +T+DADTLI   VLVVCR+QVKN+KSHLFYL+ FS DEN+IKFG+
Sbjct: 348 TDYSEFPDADIED--VTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGV 405

Query: 410 LGYAISTLEAVVFYFXXXXXXXXXXXXXXXSNKAKELYILISDKSTGQAVLDISQFRSNL 469
           + YA+STLEAV+ YF                 + K+ +  +S K+   +   +  +R  L
Sbjct: 406 VAYALSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKAV--SFDSLKSYRDIL 463

Query: 470 EFRTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDNS 529
             RT  GES LS CI       +  LL+N+E   PLEDILDD+T++GSTLL+Q L+  N+
Sbjct: 464 RIRTAGGESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNT 523

Query: 530 EAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSNG 589
             A +++E+L  SCT  ELREY+NR ++ +RT AHYLT ++ + + IG + +W+++D +G
Sbjct: 524 RMADVLLEILCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDISG 583

Query: 590 HTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVS 649
           HTPLF IFR YD  +Y  M++ AFR+A +WY+  GE+F FS H+D KGNTLLH++K N+ 
Sbjct: 584 HTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIE 643

Query: 650 ILLDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYAR 709
           ILL+ +N+D+N  NKKGLTPLM+Y +YNR DNVK I+RD R+I++K Q   FLN FDY +
Sbjct: 644 ILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVK 703

Query: 710 NPLVLKELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTLQ 769
           NP++  EL   A + T F     H  ++E   WF  IT+K G   + +++TVK +I+ +Q
Sbjct: 704 NPVIQAELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLK-GKDRETDFQTVKHNIRAIQ 762

Query: 770 NLFQVLLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLRHDNL 829
            L QV L+ +  SFLP++  LEDL  + K+ + S+ KLE   F   LT    ++ + +  
Sbjct: 763 GLLQVYLRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEF 822

Query: 830 NK-LVLRESRLVSWIRSQDKKCNNSKK 855
            K L L  S LV+WIR   +K  N  +
Sbjct: 823 KKALYLPASDLVNWIRESGRKRTNVSR 849

>KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] {ON}
            similar to uniprot|Q04263 Saccharomyces cerevisiae
            YML002W Hypothetical ORF
          Length = 1097

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/1110 (35%), Positives = 625/1110 (56%), Gaps = 51/1110 (4%)

Query: 1    MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS 60
            M Y++PVLLNPL+N+VFNC  P +S  +K+F +++ +RF L+ P  E LL + D ESGSS
Sbjct: 1    MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS 60

Query: 61   MNDLCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGF 120
            + DLC +  FV+ HILLL       GG   S  + EYKTL+ K + +R+    + T EGF
Sbjct: 61   LQDLCYSASFVSDHILLL-------GGGGCSHEE-EYKTLSGKTITLRNQQKALFTGEGF 112

Query: 121  PLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPRGLAQGNFNGVD- 179
              RRR ++   EL++NFN+Y  GS  + ++H+D PL G L R+ + P G     F   D 
Sbjct: 113  DARRRCQVLETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWP-GFKAYRFASTDT 171

Query: 180  --AKGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPY-----EELFR 232
              A  SL      K+  S E +LR HP + + L+      R+  L+   Y        F 
Sbjct: 172  TSANSSLAASTEPKA--SLEQMLRAHPSYGDKLSAIIRTQRAA-LSSSTYNADNLAAHFM 228

Query: 233  MIVKQVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEP----L 288
               ++  A +  D+ FR  P+L   I +YVE+NL+DD W ++ NS +  EI+ +     L
Sbjct: 229  QTCEKALAAIQEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSIL 288

Query: 289  KFLSINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQ 348
            + +SI+++ + LY    +KF ++ VT +EKN+  A+     LP+T++H+ KA  ++ TLQ
Sbjct: 289  RNISISQVPSFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQ 348

Query: 349  SLSNTREQDMDIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFG 408
            ++S    + ++I    I++DADTL+S  V+VVC+ +VK++KSHLFYL++F+KD NSI FG
Sbjct: 349  TVS----RSLEINDKVISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFG 404

Query: 409  ILGYAISTLEAVVFYFXXXXXXXXXXXXXXXSNKAKELYILISDKSTGQAVLDISQFRSN 468
            IL Y +STLEAV+ YF               +    E    ++D       L+ S+ +  
Sbjct: 405  ILAYGMSTLEAVLSYFESREKLKLLEKHCSSNASYWEA---LADGKLPLGSLNPSEVKDI 461

Query: 469  LEFRTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDN 528
            L  RTP G S LS C+ N +  L   L   +E  FPLED+L+DETV+GS LLIQ L    
Sbjct: 462  LRTRTPAGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGC 521

Query: 529  SEAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSN 588
            S  +   +E+L  SCT+ EL  ++N  ++ +R+  HYL H ++++  +GK+INW+ +D N
Sbjct: 522  SSLSGNFIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCN 581

Query: 589  GHTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNV 648
            GHTPLF I R YD  +Y+AM+  A++SA  W    G+ F+ S H+DNKGNTLLH+IK+NV
Sbjct: 582  GHTPLFAIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNV 641

Query: 649  SILLDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYA 708
            S++LD   V++N  NKKGLTP+M+Y RYNR DN+K+I+RD+R+I+ K Q+ S+L  FDY 
Sbjct: 642  SVVLDDPLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYI 701

Query: 709  RNPLVLKELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTL 768
            +NP+VL EL   A           H++K+E   W   +T+ +G+  +   K ++  +K +
Sbjct: 702  KNPVVLGELGKHAFFLPQSYQIRAHNIKFEGDEWVLWMTL-VGSVPNAPAKVIQRSLKFI 760

Query: 769  QNLFQVLLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLRHDN 828
            Q+      K +  +F+P E   E+LS L K ++ SI +LET +F    +    ++ R + 
Sbjct: 761  QSFLISFSKTNSMTFIPAESLAEELSLLAKMKIISINRLETKHFLRRASVVLSLICRQEE 820

Query: 829  LNKLVLRES-RLVSWIRS-QDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELSAVXX 886
               +    S  LV+     Q+++ N++  +     +EPEE+  +   ++FNR E+ A+  
Sbjct: 821  FEHIFNNPSGSLVNAAEHVQEQEANSTYGM-----IEPEEVASIQKIMKFNRTEILAIKS 875

Query: 887  XXXXXXXXXXXXXXXNTDLTHSYQFLSLFGTEYN--LAQDRLLFKDLE--INCCAFGEEA 942
                             DL  S+      G  +   + +   +F  L+  +  C FG  A
Sbjct: 876  GALMLKKLAIFGILKGKDLERSHTMFQSHGNNFTKIIGRSTNVFGSLKHSLPQCEFGYLA 935

Query: 943  TMTFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPN--ISRND 1000
              T     A LE  +  L+ +++++L+ DIP WWK YG+++ +   Y + FP+    R  
Sbjct: 936  NNT-----ALLELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPDDVRPRVA 990

Query: 1001 SGTGIIASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKSNF 1060
              TG I+S+ E KR ++E  L   +    K + R    +  ++E LA EL+ ++ FK+ F
Sbjct: 991  ENTGFISSYIETKRVRLEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNNFINFKAEF 1050

Query: 1061 FINGILRRAVRENINILKGRLVEMRKRALY 1090
            +++  ++     NI  L+ +LV + + ALY
Sbjct: 1051 WVSATIKEHAAMNIKWLQEQLVCL-EEALY 1079

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
            Ashbya gossypii ACR006C
          Length = 1079

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/1127 (35%), Positives = 631/1127 (55%), Gaps = 78/1127 (6%)

Query: 1    MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS 60
            M YH+PVLLNPLVN+VFNC  P+ S  KKLF  +K +RFILLVP T+ LL + D +SG  
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLP 60

Query: 61   MNDLCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGF 120
            +++LC NYDFVASHIL+  Q++          ++ EY+TLN   V +RS +G +++    
Sbjct: 61   LSELCYNYDFVASHILIQLQES--------KVTEQEYRTLNGNSVIIRSQAGIVMSK--- 109

Query: 121  PLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPRGLAQGNFNGVDA 180
            P  R+ R+++ E++ NFNDYL+    F L+HID PL+G L+R  ++      G++   + 
Sbjct: 110  PELRKCRVKSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQ---VFGSYEMHNP 166

Query: 181  KGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTE----GPYEELFRMIVK 236
              S   +   ++   FE  +RL+P     L+GYF R R     E        ++F+ +V 
Sbjct: 167  SKSKTINTISENHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLVI 226

Query: 237  QVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDT----EPLKFLS 292
             V+  +  D+ FR    L ++  +YVELN+++D+W+++V      E D        K++S
Sbjct: 227  DVYGVIKEDKNFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYIS 286

Query: 293  INELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQSLSN 352
            +N + T LY +    F L+ VT +EK +  A + F  L LT++H EKA  +++T Q L+ 
Sbjct: 287  LNNVATILYPEGTNSFDLRVVTEVEKRVVKATDCFAKLSLTNSHNEKAKIVVSTFQILTT 346

Query: 353  TREQDMDIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGILGY 412
                 M+  ++  T+DADTLI   ++V+CR+QVKN+KSHL YL++F+   + +KFG+ GY
Sbjct: 347  ----KMEYTSIDPTIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGY 402

Query: 413  AISTLEAVVFYFXXXXXXXXXXXXXXXSNKAKELYILISDKSTGQAVLDISQFRSNLEFR 472
            ++ST+EAV+ YF               S   +  + LI    +G AV  +S ++++L  R
Sbjct: 403  SLSTIEAVLAYFEAGDGTEKLKKLISLSEANRVFWDLIR---SGVAV-SLSSYKNSLISR 458

Query: 473  TPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDNSEAA 532
            +   ES LS CI   +  L+ E+L NY++   LED+L D     STLLIQAL+  + E A
Sbjct: 459  SSNCESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIA 518

Query: 533  QMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSNGHTP 592
            +++++V+ ++CT  E  EYVNR++   RTVAHYL    +I+E IG Y++W+ +D N HTP
Sbjct: 519  ELLIDVMISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTP 578

Query: 593  LFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVSILL 652
            LF I R YDQ +Y  M+S +F     + +  GEDF F+DHED  GN+LLHI+K  +  +L
Sbjct: 579  LFIICRAYDQLHYSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSIL 638

Query: 653  DYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYARNPL 712
               N+++N +N KG+TPLM+Y +YNR +N++ I+ D+R+I+ K+Q+P  L + DY +NP+
Sbjct: 639  SQPNINVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPM 698

Query: 713  VLKELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTLQNLF 772
            +L  + +   K + + L     +K+E   W+  ITVK    +D  Y T++  +K +Q L 
Sbjct: 699  ILNLIGTHIAKNSLYGLLSADGIKFEDNCWYLWITVKF---SDNSYSTLRQSVKNIQGLL 755

Query: 773  QVLLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVL-LRHDNLNK 831
            Q   K H  +FLP++  L  L N+ K  +  +  LE   F  +LT    V+  R++ +  
Sbjct: 756  QFYNKKHPMNFLPIDHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAV 815

Query: 832  LVLRESRLVSWIRSQDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELSAVXXXXXXX 891
            L   ES L +W+R+ + K     +  K + +EPEE+  + SFL+FN  E S +       
Sbjct: 816  LRYNESDLSTWLRTNNFK----PRANKDERIEPEEVSSIQSFLKFNLSEFSEIKEKF--- 868

Query: 892  XXXXXXXXXXNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLEINCCAFGEEATMTFV---- 947
                       T L     F SL   +   AQ R++++ +EI   + G     TF+    
Sbjct: 869  -----------TILRKLVVFQSLKAQDIECAQ-RIIYQQMEIVSNSVGPSVEKTFIGSNE 916

Query: 948  --------REIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPN--IS 997
                    + I F+  C   L  +++ +L   +  WW+LYG++  + + Y++ FP+   S
Sbjct: 917  NYSLDSFQQAIEFIAMCLETLSSKIQYVLDSKVTLWWRLYGELSSLRREYQRNFPSDFKS 976

Query: 998  RNDSG---TGIIASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYM 1054
             + SG    G   S+ EGKR+K E KL + L  C  +++ +   +   HE LAEE+S ++
Sbjct: 977  SDVSGEESKGFFESYIEGKRQKTEDKLQARLRVCITKLQTLSGELKKDHENLAEEISFFV 1036

Query: 1055 EFKS----NFFINGILRRAVRENINILKGRLVEMRKRALYRSRKGEN 1097
             FK+    +F +       ++ + NIL+  + E RK   Y S K +N
Sbjct: 1037 TFKNFAYESFVMKTYANICIKHHRNILQ-VIEEFRK---YNSTKAKN 1079

>Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON}
            (56141..59458) [3318 nt, 1106 aa]
          Length = 1105

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/1118 (34%), Positives = 652/1118 (58%), Gaps = 36/1118 (3%)

Query: 1    MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS 60
            ++YH+PVLLNPL+N+VFNC +P +S  +KLF ++K + F+L+VPP E LL++ D E G +
Sbjct: 4    LSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLT 63

Query: 61   MNDLCQNYDFVASHILLLQQDTYSD----GGFNLSASQTEYKTLNDKRVAVRSSSGEILT 116
            + +LC  ++FVASHI+L   ++ ++    G  +       YK+LN+ ++ +++++   L 
Sbjct: 64   LKELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSLNNNQLLIKNNNIIPLD 123

Query: 117  TEGFPLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPR-GLAQGNF 175
                  +++ +I +++++ NFN+YL+GSEK+ +++ D+P   + + KI+I    +++   
Sbjct: 124  FNNSTQKKKYKIIDIKILPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKES 183

Query: 176  NGVDA------KGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPYEE 229
            N + A      K  L +DL QK+ SSF +I+ +H +W+NI + Y   +++  L       
Sbjct: 184  NNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLNLTSLPI 243

Query: 230  LFRMIVKQVHAKMVNDELFRKIPH-LYDLIFDYVELNLFDDVWIRIVNSYRKDE-IDTEP 287
             FR IV + + KM  +E+F    + LY+LIF+Y+E + ++ +W  I  +   ++ + TE 
Sbjct: 244  YFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQFLHTEM 303

Query: 288  LKFLSINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTL 347
            + FLSI++LE ELY + ++KF L +V  +E+ +  A + F  +  + +H+EK   LI+ L
Sbjct: 304  MDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKCQILIDAL 363

Query: 348  QSLSNTREQDMDIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKF 407
            Q L++      D+   P+ +DADTL++ F+LV+CR++V  +++HL+YL+ FS DEN++KF
Sbjct: 364  QKLTSYD----DVHYEPLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDENNVKF 419

Query: 408  GILGYAISTLEAVVFYFXXXXXXXXXXXXXXXSNKAKELYILISDKSTGQAVLDISQFRS 467
            G+LGY IST EA + Y                  + KEL   IS ++   +   +  ++ 
Sbjct: 420  GLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSEA-DHSTFQVKLYKD 478

Query: 468  NLEFRTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCD 527
              +FR   GES+L+ CI + KN  L+E+L N+ED+FPLEDILDDE ++G+TLL++ALK +
Sbjct: 479  CFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPLEDILDDEDIEGTTLLMKALKVE 538

Query: 528  NSEAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDS 587
            N   A++IV+VLQ+SC+E EL +Y NR D N+R  AHY+T+++++L+ IG + NWK +D 
Sbjct: 539  NEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFNWKIKDD 598

Query: 588  NGHTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNN 647
             G+TPL TI R YDQ+ YE MI  AF  A +WY+   +   F DH D+K NTLLHI+K +
Sbjct: 599  KGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLLHILKCD 658

Query: 648  VSILLDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDY 707
            + +LL YDN++IN  N K +TPLM Y +YNR  N++ IIRD+R+IL K Q  +FL+ +D+
Sbjct: 659  IQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTFLDCYDF 718

Query: 708  ARNPLVLKELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKT 767
             +N ++ ++L  ++++ + F L   + L+ E  +W  + T K      + Y T  + +K 
Sbjct: 719  VKNTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFK--DTNQDSYITKSVSLKI 776

Query: 768  LQNLFQVLLKMHFASFLPLEKALEDLSNLYKSRMPS-IAKLETLYFFYMLTDCFDVLLRH 826
            L N+ +   K++   F+P ++ L  L+ + K+   + I KL+   F  ++++ F  L+  
Sbjct: 777  LFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNYFGTLIET 836

Query: 827  DNLN-KLVLRESRLVSWIRSQDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELSAVX 885
            D+ + +L      L  WI++  +K    KK    K +  ++I ++ SF++FN  EL  + 
Sbjct: 837  DDFDTELFKNPESLTKWIKAGKRK---HKKENYYKRMTLDDINMIKSFVQFNINELGKLN 893

Query: 886  XXXXXXXXXXXXXXXXNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLE----INCCAFGEE 941
                              D+  SY+    FG    L Q + +   ++    +    + + 
Sbjct: 894  RTLAILKKLCTFLALKINDVNESYKLFRNFGA---LLQQKDISNQMKKIDGLIKPKYFQS 950

Query: 942  ATMTFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNI-SRND 1000
              +  + +I+FLE CT  + D    L+  DIPEW  ++  +  + K YK+ F +  SRN 
Sbjct: 951  IFLILLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDFDSRNG 1010

Query: 1001 SGTGIIASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKSNF 1060
                I++ + + KRE  E ++S ++ +      +V   I   HE LAEE +K++ FKS F
Sbjct: 1011 LNENILSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFKSRF 1070

Query: 1061 FINGILRRAVRENINILKGRLVEMRKRALYRSRKGENN 1098
            F + IL   +   I  LK +++ +       +++ ENN
Sbjct: 1071 FKDVILNMIIPSAIATLKDQVLNIEN---IHNKQFENN 1105

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML002W and
            YML003W; YML002W and YML003W represent one ORF in this
            genome
          Length = 1071

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/1102 (35%), Positives = 605/1102 (54%), Gaps = 65/1102 (5%)

Query: 1    MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS 60
            M YH+PVLLNPLVN+VFNC  P  S  KKLF   K ++FIL+VP TE LL + DA +   
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP 60

Query: 61   MNDLCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGF 120
            + +LC NY+FVASH L+  Q+           ++ E++T+N K V +R  SG I+T +  
Sbjct: 61   LTELCYNYEFVASHTLVQLQEA--------RVTELEFQTINGKSVVIRPQSG-IITAQ-- 109

Query: 121  PLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPRGLAQGNFNGVDA 180
            P  ++ RIQ  EL+ +FNDYL G   FAL++ID PL+G    +I++   L      G   
Sbjct: 110  PSAKKCRIQRCELLRSFNDYLLGRTAFALLYIDRPLVG----EIELITPL---RVFGPQE 162

Query: 181  KGSLVRDLTQKSWSSF--ENILRLHPDWSNILNGYFN----RYRSTPLTEGPYEELFRMI 234
            +    + +TQ + +    E  LRLHP   N L+  F     R R   L+      LF  +
Sbjct: 163  QPLQYQRITQTADAPLPLEQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHEL 222

Query: 235  VKQVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEP----LKF 290
            V++V+  +  D+ FR   +L +++  YVELN+++DVW ++V    K+E D  P     + 
Sbjct: 223  VEKVYCLIKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRS 282

Query: 291  LSINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQSL 350
            +S+N+L T +Y ++ +KF L  VT +EK +  A   F  L LT++H EKA  LI+T Q L
Sbjct: 283  ISLNQLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKL 342

Query: 351  SNTREQDMDIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGIL 410
            +    Q     TL   +DADTL+   V+VVCR QVKN+KSHL YL++F+++ + +KFG+L
Sbjct: 343  TTKTSQ----ATLDPMIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLL 398

Query: 411  GYAISTLEAVVFYFXXXXXXXXXXXXXXXSNKAKELYILISDKSTGQAV-LDISQFRSNL 469
            GY++STLEAVV YF                 + K  + LI      Q + +++ +    L
Sbjct: 399  GYSLSTLEAVVGYFDIGGSSIKLERLITQCQRNKIFWNLIE-----QGIPINLKEHEEVL 453

Query: 470  EFRTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDNS 529
              RTP  ESVLS CI   +  + Y+++ NY+  F LEDIL D      +LLIQAL+  N 
Sbjct: 454  ISRTPSCESVLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQALQAGNK 513

Query: 530  EAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSNG 589
            +  + ++++L  +CT  E+  Y+N+ D   RTV HYL     I++ +GK+++WK +D N 
Sbjct: 514  DITEAVIDLLIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNM 573

Query: 590  HTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVS 649
            HTPLFT+ R YD  +Y  ++S  F+    +Y   G+ F F+DHED  GNTLLHIIK+ + 
Sbjct: 574  HTPLFTVCRAYDHPSYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQ 633

Query: 650  ILLDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYAR 709
            + L     ++N  N +G+TPLM+Y +YNR +N++ I+ D+R+IL KLQ P  L + DY +
Sbjct: 634  LALSTPGANVNKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAIDYVK 693

Query: 710  NPLVLKELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTLQ 769
            NP++L  + +   K + +    VH++KYE  +W+  IT  +   + E YKT    +K +Q
Sbjct: 694  NPIILNLIGTAMAKNSLYGCLSVHNIKYEENAWYLWITSSL---SPESYKTSSYALKDIQ 750

Query: 770  NLFQVLLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVL-LRHDN 828
            +L Q+  K H  SFLP++  LE L  L KS + S+  LE       LT    ++  R D 
Sbjct: 751  SLLQIYNKKHPMSFLPIDHHLETLKTLGKSGIISVINLENSMLLEALTFSLSIIQQREDY 810

Query: 829  LNKLVLRESRLVSWIRSQDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELSAVXXXX 888
             N     ES L +W+R+   K    +K  K+  +EPEEI  + +FL+F+  E + +    
Sbjct: 811  KNVFSYTESELSTWLRASMVK----QKPNKRDKIEPEEIHSIQNFLKFSLTEFNYLREKF 866

Query: 889  XXXXXXXXXXXXXNTDLTHSYQFL----SLFGTEYNLAQDRLLFKDLEINCCAFGEEATM 944
                         + D+  S + L     +  +     + R    D E N      +   
Sbjct: 867  TVLKKLIIFEHYKSHDIECSQRILYSQGEIIASVVPSKRLRTSPFDNEFN------DGID 920

Query: 945  TFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNISRNDSGT- 1003
             F + + F+  C   L  ++ ++L   +  WW LYG++  + K Y++ FP   + +S + 
Sbjct: 921  PFEQAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSASS 980

Query: 1004 ----GIIASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKS- 1058
                G   S+ E KR+K+ESKL S L+ C + ++ +   +   HE+LAEE+S ++  K+ 
Sbjct: 981  EDSKGFFVSYMEDKRQKLESKLQSRLSVCSENLQHLDAELKHCHELLAEEISFFISSKNF 1040

Query: 1059 ---NFFINGILRRAVRENINIL 1077
               NF +   + R ++++ N+L
Sbjct: 1041 AYMNFMVKAYVNRRIKQHKNML 1062

>Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML002W -
            Hypothetical ORF [contig 185] FULL
          Length = 1089

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/1113 (35%), Positives = 600/1113 (53%), Gaps = 59/1113 (5%)

Query: 1    MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS 60
            M Y++PVLLNPL+N+VFNC  P +S  KK+F  ++  RF+L+ PPTE LL + D ESG  
Sbjct: 1    MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP 60

Query: 61   MNDLCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGF 120
            + DLC    FV+ HI+LL      DG   L   + EYKTL+ K + +RS  G I T   F
Sbjct: 61   LQDLCYATGFVSDHIVLL------DGREGLQ--EEEYKTLSGKTILLRSQQGIIFTAAAF 112

Query: 121  PLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKID-----IPRGLAQGNF 175
              RRR RIQ  EL+TNFN+YL G   F ++H+D PL G L R+ +     + +   Q + 
Sbjct: 113  DTRRRCRIQRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKN--QEHT 170

Query: 176  NGVDAKGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYR----STPLTEGPYEELF 231
            NG    G L       +  S E +LR++P++   LN      R    S+          F
Sbjct: 171  NGPKNSGKLSHG---DNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASHF 227

Query: 232  RMIVKQVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEP---- 287
                K+    +     F+ +P+L   + +Y+ELNL+DD W ++ NS R  EI++      
Sbjct: 228  VQTCKKALDVVRAYPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSL 287

Query: 288  LKFLSINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTL 347
            LK +S++++ + LY    EKF L+ +T  EKN+  A+ SF  + +T+ H+ KA  +I TL
Sbjct: 288  LKHISVSQVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETL 347

Query: 348  QSLSNTREQDMDIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKF 407
            Q+LS +    + +    +T+DADTL+S FV+VVC  QVK+++SHLFYL++F+KD N + F
Sbjct: 348  QTLSRS----LLVDDRAVTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTF 403

Query: 408  GILGYAISTLEAVVFYFXXXXXXXXXXXXXXXSNKAKELYILISDKSTGQAVLDISQ--- 464
            GIL Y +STLEAV+ YF               +        L   KS  +  +D++    
Sbjct: 404  GILAYGMSTLEAVLCYFESPEKVASLEKYCRAN--------LSHWKSISEGSIDLNADTT 455

Query: 465  --FRSNLEFRTPQGESVLSQCIINDKNGLLYELLKNY-EDIFPLEDILDDETVDGSTLLI 521
                  L+ RT  G+S L+ C+ + +    +EL+KN  E  FPLED+L DET DGS LLI
Sbjct: 456  VPLDDLLKIRTSDGQSCLAVCLQHRRTEE-FELIKNTREAWFPLEDLLHDETTDGSNLLI 514

Query: 522  QALKCDNSEAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYIN 581
              L+      A M++  L ++CT+ EL  ++N  +K +R+  HYL H   +++ +G  +N
Sbjct: 515  HMLESGCDRLAVMLINTLISNCTKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILN 574

Query: 582  WKSQDSNGHTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLL 641
            W+ +D NGHTPLF I R YD+ +Y  M+SAA+R+AV   +     F+ S+H D+KGNTLL
Sbjct: 575  WEQRDCNGHTPLFAIVRAYDRPDYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLL 634

Query: 642  HIIKNNVSILLDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSF 701
            H+IK++VSILL    +D+N TN KGLTPLM+Y RYNR  NV+TI++DQR+I+ K Q  ++
Sbjct: 635  HVIKSDVSILLADPFIDVNATNAKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAY 694

Query: 702  LNSFDYARNPLVLKELVSQAIKTTAFELAF-VHHLKYEAPSWFFHITVKIGAGADEEYKT 760
            L+ FDY +NP VLKEL   A     FE +  VH +K E   W   ITV  G       K 
Sbjct: 695  LSCFDYVKNPAVLKELGKYA-SYLPFEFSINVHSVKREGDEWVLWITV-TGGEKQVPVKV 752

Query: 761  VKLHIKTLQNLFQVLLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCF 820
             K  ++ +Q    +    H  +F+P+++ L +L  L +SR+  + K++T  F    +   
Sbjct: 753  FKRSLRFIQAFLTLFSDAHPMTFVPVDELLRELRALSQSRILILNKMDTKRFLKRCSVTL 812

Query: 821  DVLLRHDNLNKLVLRESRLVSWIRSQDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGE 880
              ++  + L      +S L            +    Q  K +EPEE+  + S L+FN  E
Sbjct: 813  S-MVSQERLFADAFTDSNLNLSSSRGLGS--SESFTQNMKMMEPEEVRSIQSILKFNLSE 869

Query: 881  LSAVXXXXXXXXXXXXXXXXXNTDLTHSYQFLSLFGTEYN-LAQDRLLFKDLEINCCAFG 939
            +SA+                   DL+ +      FG +   + Q ++   D  +N  A  
Sbjct: 870  ISALKTAMLLMKKLAVFEGLKGKDLSEACM---TFGAKCKYVTQGKIQSFDHFLNVQAPN 926

Query: 940  EEATMTFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNISRN 999
                      IA  E C+  L   + Q+L+ DIP+WW  YG++L + + YK+ FP+ +R 
Sbjct: 927  LFDFEGIANNIALCELCSSLLCKHIGQVLNDDIPKWWHTYGELLSLRREYKKSFPDANRP 986

Query: 1000 --DSGTGIIASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFK 1057
                 +G+  S+ E KR K+E   ++ +     R+  +  +I+  +E LA EL+ ++ FK
Sbjct: 987  HVSENSGLFGSYIETKRTKLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFK 1046

Query: 1058 SNFFINGILRRAVRENINILKGRLVEMRKRALY 1090
             N F+   ++     NI  L+ +LV   + ALY
Sbjct: 1047 -NEFLKSAIKEHADTNIKRLREQLV-CSEEALY 1077

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
            YML002W
          Length = 1107

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/1102 (34%), Positives = 597/1102 (54%), Gaps = 35/1102 (3%)

Query: 1    MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS 60
            MAY +PVL NPL+N+VFNC +P  S FKKL+ +L+ + F+LLVP    LLY+ D+ S  S
Sbjct: 1    MAYFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNIS 60

Query: 61   MNDLCQNYDFVASHILLLQQDTYSD--GGFNLSASQTEYKTLNDKRVAVRSSSGEILTTE 118
              +LC  YDFVA+HIL+L +++ +D     N        K+LN K V +R S    +  +
Sbjct: 61   FRELCYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLRQSL--CIPIK 118

Query: 119  GFPLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPRGLAQG----- 173
            G+  +R++++++  L+TNFNDYL+GS  F ++HID+PL  +    ID  +G  +      
Sbjct: 119  GYFSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGFEESRELPF 178

Query: 174  NFNGVDAKGSLVRDLTQKS-WSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPYEELFR 232
            +    D  G L R    K+    F  + +   DW+  L  Y  +Y++    +    ELF 
Sbjct: 179  HSQDKDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQNIGSELFH 238

Query: 233  MIVKQVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEPLKFLS 292
             IV  ++  +  ++ F++  +LYD+ ++Y+E  L+ D+W ++   YR   +D   +  LS
Sbjct: 239  DIVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDKILDFRLVSQLS 298

Query: 293  INELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQSLSN 352
            ++ L+T  Y + ++ F+L D+  ME  +  A++ F G+   +++++K D +  TL  ++ 
Sbjct: 299  LDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIFKTLNIITG 358

Query: 353  TREQDM----DIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFG 408
                D      +  LP+ +DADTL+S F L++CR  V+++  H+ YL+ F KDEN++KFG
Sbjct: 359  KNSDDTIRDNTLPKLPL-IDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYKDENTVKFG 417

Query: 409  ILGYAISTLEAVVFYFXXXXXXXXXXXXXXXSNKAKELYILISDKSTGQAVLDISQFRSN 468
             LGY +ST+EA + YF                +  ++   LI  +S    ++ I+QF+  
Sbjct: 418  ALGYTLSTIEATLSYFYELSNSDESRIQLQKLSLLEDF--LIKIRSQHDDLIPINQFKDY 475

Query: 469  LEFRTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDN 528
              +RT  GES+LS  I N KN  L E L N+EDIFPL+D+L D  V GSTLLI+ LK  N
Sbjct: 476  FRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLLIKCLKERN 535

Query: 529  SEAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSN 588
             EAA++++E+ QNSCT  EL  Y N+ DK +RT+AHY+T E+ ILE IGKYINW  +D  
Sbjct: 536  LEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIGKYINWTLKDLK 595

Query: 589  GHTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNV 648
            G T LFTIFR YDQ  Y + I  A   A+ WY+ N   F+ SDH D  G++LLHI+K+ V
Sbjct: 596  GRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSLLHILKSQV 655

Query: 649  SILLDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYA 708
            S+LL ++++DIN  N KG+TPLM Y +YNR DN+KTI+ D R+I+ KLQ   +LN  DY 
Sbjct: 656  SLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQKDKYLNCLDYG 715

Query: 709  RNPLVLKELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTL 768
            +N  V   L ++  K   FE A++ + +YE   W+  I+V+     D EY T  + +K  
Sbjct: 716  KNFTVFNLLAAKLSKDVIFENAYISYARYEKSHWYLCISVQ---KDDLEYTTNIIKLKKY 772

Query: 769  QNLFQVLLKMHFASFLPLEKALEDLSNLYKSR-MPSIAKLETLYFFYMLTDCFDVLLRHD 827
             NL   + K++ + F+P    L+ L  + +   +  I +L+   +   L+     LL  +
Sbjct: 773  YNLINAMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLSALLYFE 832

Query: 828  NLNKL-VLRESRLVSWIRS----QDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELS 882
             ++ L +L E+ ++ WI S    Q+K  ++       K +  E+I  + +F  F+  E+ 
Sbjct: 833  KIDPLTLLDENLIIKWISSKLQQQEKSIDDHSSF---KPLSAEDINNIKAFCDFSFQEIG 889

Query: 883  AVXXXXXXXXXXXXXXXXXNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLE-INCCAFGEE 941
                               NTDL  SY  L   G+ ++  +      DL+ I+       
Sbjct: 890  KTNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQSISPHVHSSM 949

Query: 942  ATMTFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNISRNDS 1001
                  ++I F++ CT  L  ++   +   +  W K    +LE  K Y  KF   +    
Sbjct: 950  VYYELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFLQSNEETG 1009

Query: 1002 GTGIIASFFE-----GKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEF 1056
                  S F        R++ E +L   + + ++ ++++G  I   HE LAEE S Y+  
Sbjct: 1010 NLSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDYVRM 1069

Query: 1057 KSNFFINGILRRAVRENINILK 1078
            KS F  N ++R+ V  N+  LK
Sbjct: 1070 KSKFNSNLLVRKFVSLNLAHLK 1091

>CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa] {ON}
            some similarities with uniprot|Q04257 Saccharomyces
            cerevisiae YML002w and some similarities with
            uniprot|Q04257 Saccharomyces cerevisiae YML003w
          Length = 1130

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/1091 (32%), Positives = 598/1091 (54%), Gaps = 60/1091 (5%)

Query: 15   SVFNCSNPSDSQFKKLFGKL-KTERFILLVPPTEKLLYHVDAESGSSMNDLCQNYDFVAS 73
            ++ NC  P+ S  KKL+ +L K +++++LVPPTE LLY+ D ES S ++DLC   +F ++
Sbjct: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78

Query: 74   HILLLQQ-DTYSDGGFN---------------LSASQTEYKTLNDKRVAVRSSSGEILTT 117
            HILLL   DT  + G                 + A    +K +N K   +          
Sbjct: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYE-----FNK 133

Query: 118  EGFPLRRRARIQNVELITNFNDYLNGSEK-FALVHIDHPLI-GTL---IRK-IDIPRGLA 171
             G  ++ RA+I ++E I  FN+Y+  ++    +++ID   + GTL   +R  ID+ R  +
Sbjct: 134  LGDQIKNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPS 193

Query: 172  QGNFNGVDAKGSLVRDLT----QKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPY 227
              +         + +  T     KS ++F++ILR++  WS+    +F ++R     +   
Sbjct: 194  MRSIPTAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLANQDDLP 253

Query: 228  EELFRMIVKQVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEP 287
             ++F  I++++H +MV+D LF+ I  L ++I++YVELNLFDD+W  I+   ++ EID  P
Sbjct: 254  IDVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEIDLNP 313

Query: 288  LKFLSINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTL 347
               +SI ++++E    +Y KF L++V T E+NI  A  S   +     +  KA+ LI TL
Sbjct: 314  FGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANILILTL 373

Query: 348  QSLSNTREQDM--------DIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFS 399
            ++L+  +E D         ++   P+ +DAD L++ FVLV CR Q+KN+K HL YL+ F 
Sbjct: 374  RTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHLSYLQNFY 433

Query: 400  KDENSIKFGILGYAISTLEAVVFYFXXXXXXXXXXXXXXXSNKAKELYILISDKS---TG 456
             +++  KFGILGYA+STLEAVV YF                N  + L  ++S      T 
Sbjct: 434  NNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLSSTKKYETN 493

Query: 457  QAVLDISQFRSNLEFRTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDG 516
             A+  + ++  +L +R   G+S+L+ CII+ +N  LY +L  YE +FP+ED+L DE++DG
Sbjct: 494  AALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLLADESIDG 553

Query: 517  STLLIQALKCDNSEAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESI 576
            STLLIQA+K DN  +A +++ +L+++CTE EL  Y+NR D N+RT  H+LT+E+ +L+ +
Sbjct: 554  STLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNELEVLKLM 613

Query: 577  GKYINWKSQDSNGHTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNK 636
            GKYINW  +D+ G TPLFTIFR YDQ NY+ M+S +   A  WY  NG++F + DH D K
Sbjct: 614  GKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNYLDHVDKK 673

Query: 637  GNTLLHIIKNNVSILLDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKL 696
            GNTLLHI+K N+ ILL   ++++N TN+ G TPLM   RY R +N++ ++ D R+ +D  
Sbjct: 674  GNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDPRLRVDIT 733

Query: 697  QHPSFLNSFDYARNPLVLKELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADE 756
            Q  + L +FD++++  +   L    +  + +   + H LKY    W   +TVK+      
Sbjct: 734  QKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSLTVKLKDAP-- 791

Query: 757  EYKTVKLHIKTLQNLFQVLLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYML 816
              KT    +KTL+ + +V++K +   FLP+++ +EDL +  + R   + +++ L     +
Sbjct: 792  --KTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRIKVLEMLPFI 849

Query: 817  TDCFDVLLRHDNLNKLVLR-ESRLVSWIR---SQDKKCNNSKKLQKQKNVEPEEIGIMAS 872
            + C   L+    L+  V + E   + W++   S DKK N +       ++ PE+I ++ +
Sbjct: 850  SFCLSALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQT------SDITPEDISMIQN 903

Query: 873  FLRFNRGELSAVXXXXXXXXXXXXXXXXXNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLE 932
            FL+FN  E+                    + DL +S +      ++ +  + R   K   
Sbjct: 904  FLKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLKYSA 963

Query: 933  INCCAFGEEATMTFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQK 992
             +       A    + +I +L+ C  KL + +  + +  I  WW +YG++L  HK Y + 
Sbjct: 964  EDTKLLSVRAEKALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHYTRA 1023

Query: 993  FP---NISRNDSGTGIIASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEE 1049
            FP   N++  +    +       KR K+E +LS  + D  +++  VG  I   HE+ AEE
Sbjct: 1024 FPELANVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELAAEE 1083

Query: 1050 LSKYMEFKSNF 1060
            +S++++ K+ F
Sbjct: 1084 VSRFIDLKTKF 1094

>NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6.20
            YML002W
          Length = 1146

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/1148 (35%), Positives = 623/1148 (54%), Gaps = 78/1148 (6%)

Query: 3    YHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSSMN 62
            YH+P LLNPL+NS+FNC NPS+S  KKL+  LK + FILLVPPTE LL + D ++   + 
Sbjct: 4    YHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLE 63

Query: 63   DLC-QNYDFVASHILLLQQDTYSDG------GFNLSASQTEYKTLNDKRVAVRSSSGEIL 115
            DLC  N DF+ +HILL  +D+ S        G+   AS  ++ TLN   + V+  +  ++
Sbjct: 64   DLCYHNVDFIGAHILLPPKDSISSSSSTIDDGYTRLASIEQFDTLNGDNILVKWRNNFLV 123

Query: 116  TTEGFPLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPRGLAQGNF 175
               G P R++ +I+ ++++ NFNDYL GS  F LVHID PL+  +IR  D          
Sbjct: 124  LLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDTLTL 183

Query: 176  NGVDAKGS-----LVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPYEEL 230
            +  D   S     L++D++Q   S FENI+  +  W+     + N Y+ +   E P E L
Sbjct: 184  HDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPNETL 243

Query: 231  FRMIVKQVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVN-SYRKDEIDTEPLK 289
            F+ IV   + ++ ++++F+   HL  LI +Y+E+NL+D +W++I       DE     +K
Sbjct: 244  FKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALDDETKGTRIK 303

Query: 290  FLSINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQS 349
             +SI E++     K YE F L  +T +EKN+  + NS   L   ++  EK++ LI TLQ 
Sbjct: 304  NISIEEID----DKFYEMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLIATLQI 359

Query: 350  LSN--------TREQDMDIQTLPITMDADTLISFFVLVVCRTQVK--NIKSHLFYLKKFS 399
            L+N         +E +     L   +DADTLI+  +L++CR+++   ++K ++FYLKKF+
Sbjct: 360  LTNMDNPIGELNQENEKGANNL---IDADTLINLLILIICRSEINIVDLKRNIFYLKKFN 416

Query: 400  KDENSIKFGILGYAISTLEAVVFYFXXXXXXXXXXXXXXXSNKAKELYILISDKSTGQAV 459
             DEN I FGIL Y IST E V++ F                ++  E  I + D       
Sbjct: 417  YDENLINFGILSYTISTFEIVIYSFENIVEYDKLKSY----SEIIEKLIKVDDLKKVPKT 472

Query: 460  LDISQFRSNLEFRTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTL 519
            +   QF   L FR+  GES+L  CI N++     +LL +YE+IF +++ILDD  V+G+TL
Sbjct: 473  IKWEQF---LTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANVEGTTL 529

Query: 520  LIQALKCDNSEAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKY 579
            L+QAL   N + + +++ +L  +C+ +++ EY+N+ DK  R V HYL +E+ IL+ IGKY
Sbjct: 530  LMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEILKIIGKY 589

Query: 580  INWKSQDSNGHTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNT 639
            +NWK +D  G TPLFTIFR YDQ NY+ +IS  F   + WY  NG  FQ SDH D K N+
Sbjct: 590  VNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYDLKDNS 649

Query: 640  LLHIIKNNVSILLDYDN-----VDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILD 694
            +LHI+++N+ IL  Y       +DIN  N KG TPLMIY +Y+R  NVK I+ D R++ +
Sbjct: 650  ILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDDRLLFN 709

Query: 695  KLQHPSFLNSFDYARNPLVLKELVSQAIK-TTAFELAFVHHLKYEAPS-WFFHITVKIGA 752
            + Q   +   FDYA +  +  EL   A++  T F   ++H LK  + +   F +T  +  
Sbjct: 710  RYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATFSLTFPL-P 768

Query: 753  GADEEYKTVKLHIKTLQNLFQVLLKMHFASFLPLEKALEDLSNLYKSRMPSIA--KLETL 810
              + E  TV + +K + +L +V+ K    S LPL++ ++ L  L       I   K+E L
Sbjct: 769  DKENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIVRKIEML 828

Query: 811  ---YFFYMLTDCFDVLLRHD---NLNKLVLRESRLVSWIRSQDKKC--NNSKKLQKQKNV 862
                    LTDC D LL  D   +   L+  E++L+ W+ +++ K   N +K   ++K++
Sbjct: 829  RNQSLLRRLTDCLDTLLFFDIGIDYLSLITDETKLLGWVTNENTKLKHNVNKTHGEKKSL 888

Query: 863  EPEEIGIMASFLRFNRGELSAVXXXXXXXXXXXXXXXXXNTDLTHS-YQFLSLFGTEYN- 920
            +PE+I I+ SFL+FN  EL  V                 + D+  S   F+ L  +  N 
Sbjct: 889  KPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKSIKND 948

Query: 921  ---LAQDRLLFKDLEINCCAFGEEATMTFVR-EIAFLENCTGKLLDRVEQLLSVDIPEWW 976
                A +R L   +E+      +    T +R E+ FL+ CT  L   +E +L   IP WW
Sbjct: 949  QIAQATNRSLEPIIEMQSLE-NQYYNNTLIRDELDFLKACTLILTGNIEDILRTQIPNWW 1007

Query: 977  KLYGDVLEMHKVYKQKFP----------------NISRNDSGTGIIASFFEGKREKMESK 1020
            KLYG++LE++K Y + FP                 +S + +  G+     E +R K   K
Sbjct: 1008 KLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQRNKAVKK 1067

Query: 1021 LSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKSNFFINGILRRAVRENINILKGR 1080
            L +D+   K  +  +G+ I   HE+LAEEL+KYMEFK  FF   I+R   R ++  +   
Sbjct: 1068 LKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIRNWRRGDLEAVNDD 1127

Query: 1081 LVEMRKRA 1088
            L+   ++ 
Sbjct: 1128 LITFTEKT 1135

>KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6.20
            YML002W
          Length = 1131

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/1146 (32%), Positives = 603/1146 (52%), Gaps = 67/1146 (5%)

Query: 5    IPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSSMNDL 64
            +P LLNPLV++VFNC +   S  +K++  L    FILLVPPT  L Y+ D  +   +++L
Sbjct: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60

Query: 65   CQNYDFVASHILLL-----QQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEG 119
            C + +FV+SHIL        +   +D     +  + ++ T N K +    S   + TT+G
Sbjct: 61   CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDG 120

Query: 120  FPLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGT--LIRKIDIPRGLAQGNFNG 177
            F  R   RI   E + +F +YL GS  F L++ID PLI T  L++  D+         N 
Sbjct: 121  FSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLD-CFPNLTINT 179

Query: 178  VDAKGSLVRDLTQKSWSSFENIL---RLHPDWSNILNGYFNRYRS-TPLTEGPYEELFRM 233
              +  SL  +L+        N L    +H  ++      F  YR     +E      FR 
Sbjct: 180  TPSTRSLA-NLSSAEVPPQRNPLLNSMIHAQYNWKFRAVFQNYRKEITQSESMLIPGFRK 238

Query: 234  IVKQVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVN------SYRKDEIDTEP 287
             + +++  +  D  F  IP +  LI +YVE N++DDVW  ++N         K    ++ 
Sbjct: 239  TIDKIYDGL--DNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQSESSDI 296

Query: 288  LKFLSINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTL 347
             +F+S+++L+T+ Y+ K+ KF L+D+  +EKNI  A  SF  L +THT+ EK   L+ TL
Sbjct: 297  FRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVLVETL 356

Query: 348  QSLSNTREQDMDIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKF 407
            Q LS   ++    Q +PIT  ADTL+S F+L++ RT++KNI+ HL+YL+ F +DENSIKF
Sbjct: 357  QILSKPVKRVGGYQ-VPIT--ADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENSIKF 413

Query: 408  GILGYAISTLEAVVFYFXXXXXXXXXXXXXXXSNKAKE--LYILISDKSTGQAVLDISQF 465
            G+LGYAISTLEAV+ Y                ++   E  L +L   K      LD+S++
Sbjct: 414  GLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKCVSNEGLDLSKY 473

Query: 466  RSNLEFRTPQGESVLSQCIINDKNGLLYELL-KNYEDIFPLEDILDDETVDGSTLLIQAL 524
              N  +R   G S LS CIIN KN + +ELL +NYE  F  ED+L+D+T +G+TLL+Q+L
Sbjct: 474  SHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQTTEGTTLLMQSL 533

Query: 525  KCDNSEAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKS 584
            +  N E  + + +++  + TE+EL  Y  + DK +R + HY+  +  +L+ IGKYI W S
Sbjct: 534  QHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKIGKYIKWDS 593

Query: 585  QDSNGHTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQA-NGEDFQFSDHEDNKGNTLLHI 643
            +D  G TPL  IFR YDQ  Y+ M+  +F  AV WY       F F DH D+KGNTLLHI
Sbjct: 594  KDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGNTLLHI 653

Query: 644  IKNNVSILLDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLN 703
            IK N+S LL   +VDIN  N +GL+PL     Y+R +NV+ +++D R+I        FL 
Sbjct: 654  IKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLIFSSFD---FLK 710

Query: 704  SFDYARNPLVLKELVSQAIKTTAFELAFVHHLKYE-APSWFFHITVKIGAGADEEYKTVK 762
             +   ++  +L            F      H  +  +      +T +    A E   +  
Sbjct: 711  QYPNTKSAPILSHYCLD--NEAPFRNIIASHFDFRISNKRSVVLTSRSKEDAQELIGSEA 768

Query: 763  LHIKTLQNLFQVLLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLY---FFYMLTDC 819
              +K L+ LF++LLK H  +F PLE+ L++LS + K+   S + +++ +       LT C
Sbjct: 769  FELKNLKALFRLLLKQHPFTFFPLEELLDELSVVEKT-ASSRSLMKSSFCSKVLKKLTYC 827

Query: 820  FDVLLRHDNLNKLVLRESRLVSWIRSQDKKCNNSKKLQ---KQKNVEPEEIGIMASFLRF 876
             D ++  + L    L+   L+    +++K   + +KL+   K K ++PE IG + +FL++
Sbjct: 828  LDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKLKRRSKDKKMQPESIGTITTFLKY 887

Query: 877  NRGELSAVXXXXXXXXXXXXXXXXXNTDLTHSYQFLSLFGTEYNLAQ-DRLLFKDLEINC 935
                L  +                 + D++ S   +   G E +  +  R + +   I+ 
Sbjct: 888  ILESLLKLKGTIIELRKFSILSKLKSKDISESKNIVCTLGAEVSSKKIGRAMVRYSTIDN 947

Query: 936  CAFGEEATMTFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKV------- 988
               GE++    V +I F E+C   +++ ++ LL + IPEWWK YG +LE+ K        
Sbjct: 948  KFLGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWKCYGQLLELSKEDPSVLAR 1007

Query: 989  ---YKQKFPNISRN--------DSGTGIIASFFEGKREKMESKLSSDLADCKKRMRRVGD 1037
               +KQ  PN S N         SG G++ +F EGKR K + +  + ++D ++R++ + +
Sbjct: 1008 ESDHKQT-PNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQERTRAAISDLQRRLKLLDN 1066

Query: 1038 RISSTHEILAEELSKYMEFKSNFFINGILRRAVRENINILKGRLVE-----MRKRALYRS 1092
             I + + ++  E   ++ F+S F  + +L + V+ NIN+LK  L++     +RK A+ RS
Sbjct: 1067 EIDTNNTLVVIEYCIFINFQSKFIHSAMLEKWVKLNINLLKKSLLDSKEKRIRKEAV-RS 1125

Query: 1093 RKGENN 1098
            +  +N+
Sbjct: 1126 KASDNS 1131

>KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some
            similarities with uniprot|Q04257 Saccharomyces cerevisiae
            YML002W and some similarities with uniprot|Q04257
            Saccharomyces cerevisiae YML003W Hypothetical ORF
          Length = 1067

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/1111 (34%), Positives = 596/1111 (53%), Gaps = 73/1111 (6%)

Query: 1    MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS 60
            M YH+PVLLNPL+N++FNC +P  S  K++F +L  ERF +LVP TE LL   D ESG  
Sbjct: 1    MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLE 60

Query: 61   MNDLCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGF 120
            + +LC +YDFVASHI++++ D   D     S   T++ TLN +++++R  +  I+T +GF
Sbjct: 61   LAELCYHYDFVASHIVVIK-DPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGF 119

Query: 121  PLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIR--KIDIPRGLAQGNFNGV 178
              RR+  I+ + L+  FNDYL GS    ++HI  PL G L+   ++ +   +A GN    
Sbjct: 120  TERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSKVA-GNKYSK 178

Query: 179  DAKGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPYEELFRMIVKQV 238
              +  L  D  QK    FE  ++   D +  +   F+      LT+   ++   +I  + 
Sbjct: 179  QEQAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFH------LTKARIKKAISVIGIRT 232

Query: 239  HAKMVNDE------LFRKIPHLYDL---IFDYVELNLFDDVWIRIVNSYRKDEI----DT 285
                  D       L +++ HL DL   I+DYVEL LF D+  ++       E+    D 
Sbjct: 233  EWLNTRDSIRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFDF 292

Query: 286  EPLKFLSINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLIN 345
            + L+ +S+N++ T  Y K  + F L  V  +EK+++ A+     + L  TH+ K + L  
Sbjct: 293  KALRSISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLST 352

Query: 346  TLQSLSNTREQDMDIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSI 405
            T++ LS  RE +       I+ DADTL+S FVL++CR+QV  +   L YL  F   E SI
Sbjct: 353  TMRLLS--REIN------GISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSI 404

Query: 406  KFGILGYAISTLEAVVFYFXXXXXXXXXXXXXXXSNKAKELYILISDKSTGQAVLDISQF 465
            KFG+ GY +ST EA + +F               SNK  +++  I   S  +A L     
Sbjct: 405  KFGLQGYVLSTFEAALSFFHQDTVDSLTKKCA--SNK--KIWASIQKHSKVEAEL----L 456

Query: 466  RSNLEFRTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALK 525
             SNL  RT  GES+LS CI +  N +L  LL N+E  FPLEDILDD     STLLIQAL+
Sbjct: 457  SSNLRIRTDSGESLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLLIQALQ 516

Query: 526  CDNSEAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQ 585
              NS+AA ++ E++  SCTE E+R Y+N  + + R  AHY+  ++++LES+G+Y NW+ +
Sbjct: 517  VQNSQAAAILSEIILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHK 576

Query: 586  DSNGHTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIK 645
            D NGHTPLF +FR YD  NY+ +++      V+WY  N + F F  HED KGNTLLH++K
Sbjct: 577  DINGHTPLFAVFRSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMK 636

Query: 646  NNVSILLDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSF 705
            + +  LL   +V++N  + KGLTPLMIY+RYNR  N++TI++D+R++ D +Q P  + S 
Sbjct: 637  SGIESLLKLPDVNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSL 696

Query: 706  DYARNPLVLKELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHI 765
            D+ +NP V K ++         E   +H L++E   W      KIG  ++  +K   L +
Sbjct: 697  DFTKNPKVTKTILDATFNR---EPVVIHSLRFEERKW------KIGIFSEGIFKKYSLDL 747

Query: 766  KTLQNLFQVLLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLR 825
              +Q   + L  M+  SF P++    +L  L    +P + +L++ + F  L    D+L  
Sbjct: 748  --IQYYLRYLKIMYPCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKL----DMLFS 801

Query: 826  HDNL-NKLVLR--ESRLVSWIRSQDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELS 882
            + N   KL L   E  L   +       + S++  K   +EPEEI  + +FL++N  E  
Sbjct: 802  YVNTRGKLWLGKDEEELKVLLDVPTPYLSESERFIK---LEPEEINGIQTFLKYNLAEFQ 858

Query: 883  AVXXXXXXXXXXXXXXXXXNTD-LTHSYQFLSLFGTEYNLAQDRLLFKDLEINCCAFGEE 941
             +                 + D +T    FLSL     N    + + K  E   CA+  +
Sbjct: 859  KLRNCLIILKKLAIVQQIKHRDVITMRNSFLSL----GNQMSQKGVAKSFENTNCAWSYD 914

Query: 942  AT-MTFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPN--ISR 998
             +   F R + +LE+    LL+  E LL+     WWK +G+++E+ K +K+ FPN     
Sbjct: 915  LSYYEFTRNLEYLEHSVVTLLNNFESLLA-KTTLWWKHFGELMELKKEWKKNFPNDKAPP 973

Query: 999  NDSGTGIIASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKS 1058
            + +    I ++ EGKR K  +KLS+ L      ++++G  I +THE +A  ++ ++EFK 
Sbjct: 974  SSANRNFIDTYIEGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKE 1033

Query: 1059 NFF----INGILRRAVRENINILKGRLVEMR 1085
             F+    +  I+ + +REN  I++  +  M+
Sbjct: 1034 QFYHDHIVKSIVDQRIRENKQIMQQLIDTMK 1064

>YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative
            protein of unknown function; expression induced by heat
            and by calcium shortage
          Length = 737

 Score =  538 bits (1386), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 293/727 (40%), Positives = 439/727 (60%), Gaps = 20/727 (2%)

Query: 365  ITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGILGYAISTLEAVVFYF 424
            +TMDADTLIS FVLVVCR++ K++KSHL+YL+ FS + +S KFGILGYA+STLEAVV YF
Sbjct: 15   MTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCYF 74

Query: 425  XX-XXXXXXXXXXXXXSNKAKELYILISDKSTGQAVLDISQFRSNLEFRTPQGESVLSQC 483
                              K K L   +S ++    V D++ ++  L +R  QG+S+LS C
Sbjct: 75   EDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQGQSILSIC 134

Query: 484  IINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDNSEAAQMIVEVLQNSC 543
            I N KN +L ++L  YE+ FP+ED+L+DET+DGSTLLI+++K  N EAA+++++++  +C
Sbjct: 135  ITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIMLFNC 194

Query: 544  TEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSNGHTPLFTIFRCYDQQ 603
            TE+EL  Y+N+ DK  RTVAHYLTHEM+IL+SIG YI+WK ++S+G TPLF+IFR YDQ 
Sbjct: 195  TEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIFRSYDQP 254

Query: 604  NYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVSILLDYDNVDINCTN 663
            NYE M+  AF  A  WY+ +   F + DH DNKGN+LLH++K N+ ILL    +DIN  N
Sbjct: 255  NYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTKLDINEEN 314

Query: 664  KKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYARNPLVLKELVSQAIK 723
             KGLTPLM+Y +Y R  N+  I +D+R+IL+K+Q+ +F   FDYA++  VL ++  + +K
Sbjct: 315  YKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSKIGERGVK 374

Query: 724  TTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTLQNLFQVLLKMHFASF 783
             + F L + H L+Y   +   +IT    + A++ + T  +++KT+Q L + +LK +  +F
Sbjct: 375  DSLFGLIYFHSLRYHNLNATTNITSV--SNAEKPFATTVINMKTIQGLLRSILKDNPFTF 432

Query: 784  LPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLRHDNL-NKLVLRESRLVSW 842
            LPL   ++++S+L +S +  I K +     + LT+CF+VLL    +   L   E+ ++ W
Sbjct: 433  LPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFTDEASILYW 492

Query: 843  IRSQDKKCNNSKKLQK------QKNVEPEEIGIMASFLRFNRGELSAVXXXXXXXXXXXX 896
            +R      N SK+ QK       K +EPEEI ++ SFLRFN  E+S+             
Sbjct: 493  MR-----INTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKVLI 547

Query: 897  XXXXXNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLEINCCAFGEEATMTFVREIAFLENC 956
                 + D   +Y+ L+  G +   ++    FK +  N   F E +    +  + FLE C
Sbjct: 548  FINLKSDDFEDAYKGLNEMGRKLINSEASSAFKGIITNHNMFSELSLAALLENVRFLEQC 607

Query: 957  TGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNISRNDSGT-----GIIASFFE 1011
            T +L   V+ +L   IP WWK YG+ L +HK Y++ FPN+ +  S +       +  F E
Sbjct: 608  TIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRAPLGGFIE 667

Query: 1012 GKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKSNFFINGILRRAVR 1071
             KRE+ E +L+  +    K ++ +G  I   HE LAEELS YMEF+        L     
Sbjct: 668  TKREQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQRSLVAFAT 727

Query: 1072 ENINILK 1078
             NI++L+
Sbjct: 728  TNISVLQ 734

>NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6.20
            YML002W
          Length = 1193

 Score =  502 bits (1293), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 381/1192 (31%), Positives = 613/1192 (51%), Gaps = 130/1192 (10%)

Query: 3    YHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSSMN 62
            YH+P LLNPL+N+VFNC +PS S FKKLF  LK ++FILLVPPT  LL + D+    S+N
Sbjct: 4    YHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLN 63

Query: 63   DLC-QNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGFP 121
            +LC  N DF+ SHIL       S+     +    E+  LN  +  ++     I T   F 
Sbjct: 64   ELCYHNSDFLGSHILTWSNAIDSNKDSTTTNDDEEFDNLNGNKFIIKWKHNIIFTRGNFS 123

Query: 122  LRRRARIQNVELITNFNDYLNGSEKFALVHIDHPL-IGTLIRKIDIPRGLAQG-NFNGVD 179
              +R +I  +  +TNFNDY +GS++F L+ ID P+ + +LI    +   L    +    +
Sbjct: 124  NDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLKSQE 183

Query: 180  AKGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPYEELFRMIVKQVH 239
             +  LV+DL+Q+S SSFEN L  +  W+       N Y+       P  +LFR +V +  
Sbjct: 184  KETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELEPNHKLFRELVNEAF 243

Query: 240  AKM------------VNDELFRKIPHLYDLIFDYVELNLFDDVWIRI-------VNSYRK 280
             ++             +D+LF+       L  DY+E +L+D++W RI       V +Y  
Sbjct: 244  IEIDSKKFFQKKKNFTSDQLFQ-------LTHDYMERHLYDEIWSRIWKMMMNSVKNYAD 296

Query: 281  DEIDTEPLKFLSINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKA 340
            D+     +K  SI E++   Y    + F L+ V  +EKN+  ++     L  T ++ EK+
Sbjct: 297  DQKAQHLIKHFSIVEIDPNFY----DIFPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKS 352

Query: 341  DCLINTLQSLSNTR---EQDMDIQTLPITMDADTLISFFVLVVCRTQV--KNIKSHLFYL 395
              LI +LQ ++++    E+  D       +DAD L++   LV+ ++ +   ++K++L+YL
Sbjct: 353  TILIESLQIITDSNTGGEESKDKNKSGYLIDADNLLNLLTLVILQSNITLHDLKANLYYL 412

Query: 396  KKFSKDENSIKFGILGYAISTLEAVVFYFXXXXXXXXXXXXXXXSNKAKELYILISDKST 455
            K FS DE+S  FGIL Y I+T   V                   S+  +EL I+  D ST
Sbjct: 413  KYFSTDESSSSFGILNYTIATFHMVSHVLENVIDWDRLKEK---SDLIEEL-IMTDDLST 468

Query: 456  GQAVLDISQFRSNLEFRTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVD 515
              +  +  + ++ L +R   GES+L+  IIN +N    + L  YEDI  ++ I +D+++D
Sbjct: 469  LSSTFENDK-KTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISNDQSMD 527

Query: 516  GSTLLIQALKCDNSEAAQMIVEVLQNSCTEQ-ELREYVNRADKNRRTVAHYLTHEMNILE 574
             STLL+QA++ +N EAA ++V++L  +C  Q EL  Y+N+ D + R + HYL   + IL+
Sbjct: 528  SSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVINLTILK 587

Query: 575  SIGKYINWKSQDSNGHTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHED 634
             IG++INWK +D NG TPLFTIFR YDQ NY+ ++   F+ A++WY AN   FQ +DH+D
Sbjct: 588  IIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQMNDHDD 647

Query: 635  NKGNTLLHIIKNNVSILLDYDN-----VDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQ 689
            + GN+LLHI++NN+SILLDY       +++N  N KG TPLM+Y +Y R+DN++ II+++
Sbjct: 648  SNGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMIIKEE 707

Query: 690  RIILDKLQHPSFLNSFDYARNPLVLKELVSQAIKTTA-FELAFVHHLKYE---APS---- 741
            ++I +K Q P+F++ FDY+ +  ++ ++    +     F    V  LK +    PS    
Sbjct: 708  KLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTVPSLPRG 767

Query: 742  WFFHITVKIGAGADEEYKTVKLHIKTLQNLFQVLLKMHFASFLPLEKALEDL-------- 793
             + + T+ I   AD+   T  +   +L    +++ + +  SFLPL+  L +         
Sbjct: 768  LYINYTILIDE-ADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSFLDKKS 826

Query: 794  ---SNLYKSRMPSIAKLETLYFFYMLTDCFDVLLRHDN--------------LNKLVLRE 836
               +NL    +  I KL    F   L  C DVLL  D+              L  + + E
Sbjct: 827  KNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPLLLSETELLEWISIEE 886

Query: 837  SRL--VSWIRSQDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELSAVXXXXXXXXXX 894
            S+L   S   S   K  N+   +K+K ++PE I I+ +FL+FN  EL+ +          
Sbjct: 887  SKLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLKVLSKL 946

Query: 895  XXXXXXXNTDLTHSYQ--FLSLFGTEYNLAQDRLLFKDLE-INCCAFGEEATM---TFVR 948
                     D+ H  Q  F  L     N     ++ K    I+   + ++  +   +   
Sbjct: 947  VIFMNLKTLDI-HDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGVLLESLHE 1005

Query: 949  EIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNI------------ 996
            +I+F   CT KL+  VE ++ + IP WWKLYG++LE++K Y + FPN             
Sbjct: 1006 DISFFNECTLKLIHDVENIIKIKIPNWWKLYGELLELNKYYHKNFPNCVVHARRTDLLSG 1065

Query: 997  --------------------------SRNDSGTGIIASFFEGKREKMESKLSSDLADCKK 1030
                                       +N+S  G+ A+  E ++ K+E K S  + +   
Sbjct: 1066 NNANTNTNTNTNTNTNSPQRLHHHSEHQNNSNNGVFANLIENQKNKLERKTSHHIDETIS 1125

Query: 1031 RMRRVGDRISSTHEILAEELSKYMEFKSNFFINGILRRAVRENINILKGRLV 1082
             +  +G  + + HE LAEEL++YMEFK+ FF   I++  V E+I +L+  ++
Sbjct: 1126 LLESLGSGLLNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDIKLLEEHVL 1177

>TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_6.20
            YML002W
          Length = 1204

 Score =  425 bits (1092), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 343/1177 (29%), Positives = 554/1177 (47%), Gaps = 166/1177 (14%)

Query: 43   VPPTEKLLYHVDAES--------GSS---MNDLCQN-YDFVASHILLLQQDTYSDGGFNL 90
             PPT+ LL ++D+ +        GS+   + DLC N YDF+ASHILL            +
Sbjct: 42   APPTDILLNYLDSSNITPRNPYNGSNAKPLEDLCMNSYDFIASHILLYDSKV-------I 94

Query: 91   SASQTEYKTLNDKRVAVRSSSGEILTTEGFPL-----------RRRARIQNVELITNFND 139
               Q   +++N K + ++  +G      G  L           ++  +I  ++L  NFN 
Sbjct: 95   KNDQCVMESINGKTITIKRVTGNGALNNGEMLVITPSKNYNTPKKMLKIIKMDLWHNFNS 154

Query: 140  YLNGSEKFALVHIDHPLIGTLIRK---IDIPRGLAQG-NFNGVDAKGSLVRDLTQKSWSS 195
            YL G E + + +ID+PL   +I+        R L +   ++ +    + + + T+     
Sbjct: 155  YLQGMENYPIWYIDYPLYPNIIKNEFLTAFDRKLIETEQYSDIAQPVNDLENTTKDQNHK 214

Query: 196  FENILRLHPDWSNILNGYF---------------NRYRSTPLTEGPYEELFRMIVKQ--- 237
              NI +L PD S    G F               N YR+T       E L + I +    
Sbjct: 215  IRNISKLEPDISQSDRGGFTKLIKDDRVIWQPLINSYRATTKHIEQAEGLPQAIDENQTD 274

Query: 238  VHAKMVND---ELFRKIP-----------HLYDLIFDYVELNLFDDVWIRIVNSYRKDEI 283
            V+ +MV D   +LF ++            +L +LI++++E+ L DD+W RI   + + + 
Sbjct: 275  VNIEMVRDINCDLFEQLKDEKRYNFLSHDNLMELIYEFIEIKLHDDIWGRISFKFTESDF 334

Query: 284  DTEPLKFLSINELETELYQ-KKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADC 342
            D   L  +S+N+L    Y    ++ F+L D+  MEK I  A+  F       T  EK+  
Sbjct: 335  DFSKLSNISVNKLLLNFYSTNNFKNFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTA 394

Query: 343  LINTLQSLSNTREQDMDIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDE 402
            LI TLQ           I T+    DADTLI    +V+CR +V+N+KSHLFYL+ F+ D 
Sbjct: 395  LIKTLQ-----------ILTINKLTDADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADP 443

Query: 403  NSIKFGILGYAISTLEAVVFYFXXXXXXXXXXXXXXXSNKAKELY--ILISDKSTGQAVL 460
            N+IKFGILGY+ISTLEA+ +YF                +K   LY  IL + KS    +L
Sbjct: 444  NTIKFGILGYSISTLEAITYYFDHISHSHKADLIAF-CDKLHNLYDTILNNIKSLDNDIL 502

Query: 461  DISQFRSNLEFRTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLL 520
                      +R+  GES+LS CIIN+K  +  ELL  YE  FP+EDILDD  ++GS+LL
Sbjct: 503  ---------SYRSQNGESLLSLCIINNKMDIFLELLTTYEHSFPIEDILDDSDLNGSSLL 553

Query: 521  IQALKCDNSEAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHY--LTHEMNILESIGK 578
            +QA K +N  A++++V +L+NSC E+ELR ++N+ DK  R+VAHY  + + + IL   G 
Sbjct: 554  MQACKYNNYVASEILVTILKNSCNEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGN 613

Query: 579  YINWKSQDSNGHTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGN 638
             I+W+ +D    TPL TIF+ +     E+ I   FR  + WY+ + + F    H D  GN
Sbjct: 614  LIDWELKDIKKLTPLLTIFKVHKVNYNESFIKILFRVVLTWYKIHNKPFNLKAHVDQNGN 673

Query: 639  TLLHIIKNNVSILLD----YDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILD 694
             LLH++K+ ++ L++     + ++IN  N KGL+P M+Y + NR+DN++ I+++  +I  
Sbjct: 674  NLLHVMKDYINCLIENPELCETININANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITS 733

Query: 695  KLQHPSFLNSFDYARNPLVLKELVSQAIKTTAFELAFVHHLKYEAPS---------WFFH 745
            + Q P  + S +   N  V   L +  ++T  F    +H L++  PS         W   
Sbjct: 734  EGQLPFLITSTN-LYNSKVNHLLATHFLRTLDFAYICLHSLRFNDPSSSTSGTSLAWLVD 792

Query: 746  ITV-----KIGAGADEEYKTVKLHIKTLQNLFQVLLKMHFASFLPLEKALEDLSNLYKSR 800
            I++     +         +T  L +KT+++L    ++ +  S LPL+ ALE  ++L KS 
Sbjct: 793  ISILEKESEFPTSHPSICRTKTLKLKTIKSLLHHFIRKYKYSSLPLKSALEFCNDLIKSN 852

Query: 801  -----------MP---SIAKLETLYFFYMLTDCFDVLLRHDNLN-KLVLRESRLVSWIRS 845
                       +P    I KLE  Y   ++++C + L    + +  L+  E +L ++++ 
Sbjct: 853  NSISWTSNRHFLPLSLLIDKLEIQYNLKLISNCLNFLFITTDFDFTLLFDELKLQAFLKI 912

Query: 846  QDKK---CNNSKKLQKQKN----------VEPEEIGIMASFLRFNRGELSAVXXXXXXXX 892
             +KK    N+S K   + N           +PE+I  + +F++FN GEL           
Sbjct: 913  NNKKLKESNSSNKFSHKNNSDQTTELSKAYQPEDINAIQTFIKFNLGELENFKNTITTIK 972

Query: 893  XXXXXXXXXNTDLTHSYQF----------------LSLFGTEYNLAQDRLLFKDL-EINC 935
                       DL  S  F                L  + T+  L  +    +   + N 
Sbjct: 973  DVSILIKYKIMDLNSSQFFFQKNTLKIGINNLSEILKYYSTQKPLITNAYTSRKFYDYNS 1032

Query: 936  CAFGEEATMTFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPN 995
              +  E     +  + F E    KL    E L +  I  WW  YG +L+    Y + +PN
Sbjct: 1033 YDYKVEFLNKLLENLIFFEKLVCKLYYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPN 1092

Query: 996  --ISRNDSGTGIIASFFEGKREKMES------KLSSDLADCKKRMRRVGDRISSTHEILA 1047
              I  N++       F   KR   +S       +  ++ +    +RR  ++I   HE LA
Sbjct: 1093 RKIDINNNFESFNTMF--DKRVNFDSITHFERNIILNIKNTSTLLRRFNNKIKFLHENLA 1150

Query: 1048 EELSKYMEFKSNFFINGILRRAVRENINILKGRLVEM 1084
             EL+ +M FK+ F    I++ +  E I ILK  ++ M
Sbjct: 1151 IELNNFMNFKNKFIREYIIKFSTIEVIKILKDNIIYM 1187

>KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20
            YML002W
          Length = 942

 Score =  308 bits (790), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 258/838 (30%), Positives = 413/838 (49%), Gaps = 106/838 (12%)

Query: 263  ELNLFDDVWIRIVNSYRKDE-IDTEPLKFLSINELE-TELYQKKYEKFRLQDVTTMEKNI 320
            E  L+  +W ++V+   + + ID     ++S +EL   + Y   + KF L+DV  +E  +
Sbjct: 179  EARLYSSIWNKLVHQTSEPQNIDKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIENVV 238

Query: 321  DLAINSFVGLPLTHTHAEKADCLINTLQSLSNTREQDMDIQTLPITMDADTLISFFVLVV 380
            DLA   FV L  + +  EK D L++T   L++   Q        + +DAD L++F ++++
Sbjct: 239  DLACKEFVKLRESLSFDEKIDILLSTFNILTSKLPQ--------LEIDADNLLNFMLIII 290

Query: 381  CRTQVKNIKSHLFYLKKFSKDENSIKFGILGYAISTLEAVVFYFXXXXXXXXXXXXXXXS 440
             R ++ N+  H  YL+ F+  +N   FGIL YAISTL AV++Y                 
Sbjct: 291  NRVKLNNLNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYYIDNN------------- 336

Query: 441  NKAKELYILISDKSTGQAVLDISQFRSNLEFRTPQGESVLSQCIINDKNGLLYELLKNYE 500
                    L   K    A+ D       L++R   GES L  CII   N  L ELL + E
Sbjct: 337  --------LDKFKRYTDAIQDSKISEEKLKYRNENGESYLCHCIITKDNDTLRELLFSSE 388

Query: 501  DI--FPLEDILDDETVDGSTLLIQALKCDNSEAAQMIVEVLQNSCTEQELREYVNRADKN 558
             I  FP+EDILDD+T+DGSTLL+ A+KC N+ AA +++ ++ N+ T  E+R YVN  D+N
Sbjct: 389  YIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASILINIIINNGTPDEIRTYVNSVDEN 448

Query: 559  RRTVAHYLTHEMNILESIGKYINWKSQDS-NGHTPLFTIFRCYDQ--QNYEAMISAAFRS 615
             R V H++T++  +L  IG Y+NW  +D   G TPLF IFR YDQ  ++Y+ M   +FR 
Sbjct: 449  NRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKKMSRRSFRF 508

Query: 616  AVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVSILLDYDNVDINCTNKKGLTPLMIYTR 675
            A+     +  DFQ   H DN  NTLLHI+K N+ ++L + ++ IN  N  G+TPLM++ +
Sbjct: 509  AM-----DSGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPNSLGMTPLMVFCK 563

Query: 676  YNRFDNVKTII----RDQRIILDKLQ-HPSFLNSFDYARNPLVLKELVSQAIKT-TAFEL 729
            Y R  N++ ++    +D+  I +  Q H ++ N F    +  +L  L   AIK  + F  
Sbjct: 564  YRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFAIKNYSIFGN 623

Query: 730  AFVHHLKYEAPSWFFH---------ITVKIGAGADEEYKTVKLHIKTLQNLFQVLL--KM 778
             F H LK      F H          +VKI    +++YKT++ +IKT++ L  ++L    
Sbjct: 624  CFTHSLKQ-----FLHKSKHGNKNQYSVKITLKFEKKYKTIRFNIKTIKALINMVLTSNS 678

Query: 779  HFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLRHDNLNKLVLR--- 835
            H +SFLPL K   +L+ +       I+    + F   L    D +L      +LV R   
Sbjct: 679  HVSSFLPLYKVFNELNGI----ASMISTKSKILFINNLNVILDTIL----FLELVPREGF 730

Query: 836  --ESRLVSWIRSQDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELSAVXXXXXXXXX 893
              E+RL  ++R+Q K         K K ++ E+I ++++FL+FN  EL+A          
Sbjct: 731  ILEARLKDYLRNQRKI---KTVATKSKKLQIEDINMISNFLKFNLNELNAFKNGVKKILR 787

Query: 894  XXXXXXXXNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLEINCCAFGEEATMTFVREIAFL 953
                      D   SY  L L   +  +  +  L+ +L  N            +     L
Sbjct: 788  QMNSINLKLFDQRISYMDL-LHCPDVVVHLNNPLW-NLNYN----------ILISNFQIL 835

Query: 954  ENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNISRNDSGTGIIASFFEGK 1013
            EN     L  ++   +  I +WWKL  +++ + K+          ++S   ++ SFF  K
Sbjct: 836  ENSIDNTLHFLKVFQNEKIRKWWKLNNELINLTKL---------ASNSDDDLLRSFFNRK 886

Query: 1014 REKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKSNFFINGILRRAVR 1071
                  KLS ++ D  + +  +   I  +HE+LA E++ +M+FK  F    ++  A R
Sbjct: 887  E-----KLSIEIDDKIRSINELNCDIFVSHELLAVEINNFMKFKPLFITRTLVVWAHR 939

>YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative
           protein of unknown function
          Length = 290

 Score =  213 bits (541), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 116/291 (39%), Positives = 165/291 (56%), Gaps = 15/291 (5%)

Query: 2   AYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSSM 61
            YH+P LLNPLVN++FNC  P  S  KKLF  LKT RFILL PP+E LL + D +S   +
Sbjct: 3   VYHLPTLLNPLVNAIFNCPEPERSPLKKLFANLKTRRFILLAPPSEYLLNYHDVKSKLPL 62

Query: 62  NDLCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGFP 121
           +DLC N +F+ S+ILL+ +++Y     N ++  + Y+TL+ K V ++  +  I    GF 
Sbjct: 63  HDLCYNAEFINSYILLMTENSY----INTNSRDSHYETLDGKTVVIQWKNNVIHALNGFH 118

Query: 122 LRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPRGLAQGNFN----- 176
           +RRR +I   +++ NFNDY  G+  F ++ ID PL         +P    Q   N     
Sbjct: 119 IRRRLKILETKILPNFNDYFEGAADFIILFIDQPLNCEF-----VPNDYLQCFHNYEKIP 173

Query: 177 -GVDAKGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPYEELFRMIV 235
               A  +L  D  Q+  SSFENIL +HP     L   F+ YR+    + P   +F  IV
Sbjct: 174 KNAHAMPNLSIDSFQQERSSFENILHIHPARLTQLGQLFSSYRTLAPGDDPSRSIFESIV 233

Query: 236 KQVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTE 286
           +Q    M +D LF+   +LYDLI DY ELNL+DD+W R+   ++  E+DTE
Sbjct: 234 QQAFDGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLTTHFKGHEVDTE 284

>Smik_8.90 Chr8 (131286..137069) [5784 bp, 1927 aa] {ON} YHR023W
            (REAL)
          Length = 1927

 Score = 36.6 bits (83), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 3/68 (4%)

Query: 996  ISRNDSGTGIIASFFEGKR-EKMESKLSSDLADCKKRMRRVGDRISSTHEI--LAEELSK 1052
            + RNDS   +  +  E KR + ++  LS DLA  K+R+  V DR   T+EI  L EELS 
Sbjct: 1538 MERNDSDMQLQETLLELKRVQDVKKILSDDLAHLKERLSAVDDRSQYTNEINRLKEELSC 1597

Query: 1053 YMEFKSNF 1060
             ++ ++N 
Sbjct: 1598 SLKVETNL 1605

>Smik_14.148 Chr14 complement(275170..276837) [1668 bp, 555 aa] {ON}
           YNL182C (REAL)
          Length = 555

 Score = 35.4 bits (80), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 59/151 (39%), Gaps = 21/151 (13%)

Query: 221 PLTEGPYEELFRMIVKQVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRK 280
           P   G   +LF    K+  +   N     KIP+L  +IFD        D+W +I     +
Sbjct: 402 PYRLGNDSQLFGEETKEKRSGNGNGHNSMKIPNLQRVIFDSKNKAHLHDIWYQI----GE 457

Query: 281 DEIDTEPLKFLSINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKA 340
            E +T+P   L +N  E  L Q K ++     +  +  ++ +  N               
Sbjct: 458 PETETDPDLALPLNNFEAYLEQIKSQESMFTHIGKISSDVRVVDNE-------------- 503

Query: 341 DCLINTLQSLSNTREQDMDIQTLPITMDADT 371
              +NT  SL N   +D +I  L   ++A T
Sbjct: 504 ---VNTASSLDNNTAKDEEITELKANIEALT 531

>TPHA0K00750 Chr11 (155270..157843) [2574 bp, 857 aa] {ON} Anc_7.409
           YER111C
          Length = 857

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 52/106 (49%), Gaps = 24/106 (22%)

Query: 584 SQDSNGHTPL-----FTIFRCYDQQNYEAMISAAFRSAVRWYQANGED----FQFS-DHE 633
           +QD NG  PL      T+ +  DQ    ++I+      + + Q+N  D     + + +H+
Sbjct: 420 AQDKNGRLPLHYLIELTVNKTKDQ----SIITHYIDLILEYLQSNDNDDISILKLTVNHQ 475

Query: 634 DNKGNTLLHI--IKNNVSILLDYDN-VDINC----TNKKGLTPLMI 672
           D+ GNT+LHI  + NN+ I   Y+  + I C    TN    TPL I
Sbjct: 476 DSYGNTILHIAALNNNLKI---YNKLLKIGCSEKLTNMNNETPLSI 518

>YHR023W Chr8 (151666..157452) [5787 bp, 1928 aa] {ON}  MYO1Type II
            myosin heavy chain, required for wild-type cytokinesis
            and cell separation; localizes to the actomyosin ring;
            binds to myosin light chains Mlc1p and Mlc2p through its
            IQ1 and IQ2 motifs respectively
          Length = 1928

 Score = 33.5 bits (75), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 38/68 (55%), Gaps = 3/68 (4%)

Query: 996  ISRNDSGTGIIASFFEGKR-EKMESKLSSDLADCKKRMRRVGDRISSTHEI--LAEELSK 1052
            + RNDS   +  +  E KR + ++  LS DLA  K+R+  V DR   T EI  L EEL+ 
Sbjct: 1539 MERNDSDMQLQETLLELKRVQDVKKILSDDLAHLKERLSAVEDRSQYTDEINRLKEELNC 1598

Query: 1053 YMEFKSNF 1060
             ++ ++N 
Sbjct: 1599 SLKAETNL 1606

>NCAS0D01680 Chr4 (319293..320090) [798 bp, 265 aa] {ON} Anc_5.129
          Length = 265

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 6/65 (9%)

Query: 577 GKYIN----WKSQDSNGHTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDH 632
           G+Y+N     K+   +  TPLF+I  CY+ +N  A+I    ++AV      G++FQ S+ 
Sbjct: 96  GEYVNKPLVSKNYKPSACTPLFSI--CYEAKNAGAVIHTHSQNAVICSMIFGDEFQISNI 153

Query: 633 EDNKG 637
           E  K 
Sbjct: 154 EQIKA 158

>Skud_14.152 Chr14 complement(286929..288704) [1776 bp, 591 aa] {ON}
           YNL182C (REAL)
          Length = 591

 Score = 33.1 bits (74), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 51/113 (45%), Gaps = 7/113 (6%)

Query: 229 ELFRMIVKQVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEPL 288
           +LF    K  H    ND    KIP+L  +IFD    +   D+W +I     + E +T+P 
Sbjct: 447 QLFEGESKGKHTNSNNDHNSVKIPNLQRVIFDTKNKSNLHDIWYQI----GEPETETDPN 502

Query: 289 KFLSINELETELYQKKYEK---FRLQDVTTMEKNIDLAINSFVGLPLTHTHAE 338
             L +N+    L + K ++     +  +++  K +D  IN+ + L  T    E
Sbjct: 503 LLLPLNDFNAYLERIKSQESMFTHIGKISSDVKVVDDEINASLSLDQTDKDKE 555

>KAFR0B04270 Chr2 (885178..888192) [3015 bp, 1004 aa] {ON} Anc_5.94
           YHR154W
          Length = 1004

 Score = 32.7 bits (73), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 34/79 (43%), Gaps = 2/79 (2%)

Query: 670 LMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYARNPLVLKELVSQA--IKTTAF 727
           + I++  +   N+  II  +R+   K       NS DYA  P  + E++      K T F
Sbjct: 797 IKIFSNIDDTHNLNAIIAPKRLRTIKFLKSLSFNSLDYAITPGFINEILKSVYNTKNTTF 856

Query: 728 ELAFVHHLKYEAPSWFFHI 746
           +   + H KY  P    H+
Sbjct: 857 DTLKIAHDKYAIPDMTSHV 875

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 32.7 bits (73), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 12/58 (20%)

Query: 623 NGEDFQFSDHEDNKGNTLLHIIKNNVSILL---------DYDNVDINCTNKKGLTPLM 671
           NG D   +D   ++G  LLH+  N+ +I+L         D   +D+NCT+  G TPL+
Sbjct: 172 NGADPTITD---DQGFNLLHLSINSSNIMLILYVLYFVVDKGIIDVNCTDPNGRTPLL 226

>YNL182C Chr14 complement(295960..297627) [1668 bp, 555 aa] {ON}
           IPI3Essential component of the Rix1 complex (Rix1p,
           Ipi1p, Ipi3p) that is required for processing of ITS2
           sequences from 35S pre-rRNA; highly conserved and
           contains WD40 motifs; Rix1 complex associates with Mdn1p
           in pre-60S ribosomal particles
          Length = 555

 Score = 32.3 bits (72), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 4/82 (4%)

Query: 244 NDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEPLKFLSINELETELYQK 303
           N   F KIP+L  +IFD        D+W +I     + E +T+P   L +N+    L Q 
Sbjct: 425 NGHNFMKIPNLQRVIFDGKNKGHLHDIWYQI----GEPEAETDPNLALPLNDFNAYLEQV 480

Query: 304 KYEKFRLQDVTTMEKNIDLAIN 325
           K ++     +  +  N+ +  N
Sbjct: 481 KTQESIFSHIGKVSSNVKVIDN 502

>Suva_15.209 Chr15 (358888..364677) [5790 bp, 1929 aa] {ON} YHR023W
            (REAL)
          Length = 1929

 Score = 32.3 bits (72), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 38/68 (55%), Gaps = 3/68 (4%)

Query: 996  ISRNDSGTGIIASFFEGKR-EKMESKLSSDLADCKKRMRRVGDRISSTHEI--LAEELSK 1052
            + RNDS   +  +  E KR + ++  LS DL+  K+R+  V DR   T EI  L EEL+ 
Sbjct: 1540 MERNDSDMQLQETLLELKRVQDVKKILSDDLSHLKERLGAVEDRSQYTDEINRLKEELNH 1599

Query: 1053 YMEFKSNF 1060
             ++ ++N 
Sbjct: 1600 SLKTETNL 1607

>Ecym_4261 Chr4 (543956..555052) [11097 bp, 3698 aa] {ON} similar to
            Ashbya gossypii AGR043W
          Length = 3698

 Score = 32.3 bits (72), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 62/139 (44%), Gaps = 23/139 (16%)

Query: 601  DQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKG---NTLLH--IIKNNVSILLDY- 654
            +  N+  + S  +R   + Y+    ++  +  +DN     NT +H  ++KN  +  L Y 
Sbjct: 1298 ESHNHICVPSDEYRLLKKTYEQPSMNYLSAKAKDNNSIILNTGIHSEMVKNIKAPSLSYL 1357

Query: 655  --DNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYARNPL 712
                +D+ C          +      F+N+K +  +  ++L+KL++P    SF+Y +   
Sbjct: 1358 RSKALDLGC----------VVVSEKEFNNIKELAAEHTVLLNKLENP----SFEYLKQKA 1403

Query: 713  VLKELVSQAIKTTAFELAF 731
            V  ELV    K T FE  F
Sbjct: 1404 VGYELVPSE-KFTEFESVF 1421

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 116,089,414
Number of extensions: 5291493
Number of successful extensions: 16859
Number of sequences better than 10.0: 59
Number of HSP's gapped: 17171
Number of HSP's successfully gapped: 66
Length of query: 1099
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 979
Effective length of database: 39,721,479
Effective search space: 38887327941
Effective search space used: 38887327941
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)