Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07788g6.21ON33433413800.0
TDEL0G044806.21ON3433189591e-129
YOR007C (SGT2)6.21ON3463238631e-114
SAKL0E01210g6.21ON3233188611e-114
Smik_15.1766.21ON3453238451e-112
Skud_15.1686.21ON3483258441e-111
Suva_15.1826.21ON3463238321e-110
CAGL0E02739g6.21ON3433148221e-108
Kwal_56.224336.21ON3223188191e-108
Kpol_1037.266.21ON3423268061e-106
KNAG0M011706.21ON3393228001e-105
TPHA0J003406.21ON3383297981e-105
TBLA0G010506.21ON3503247606e-99
KLTH0C11220g6.21ON3273257561e-98
KAFR0L004106.21ON3313227553e-98
NCAS0H008306.21ON3383287413e-96
NDAI0D008106.21ON3493377208e-93
Ecym_30256.21ON3183197012e-90
ACR005W6.21ON3273286927e-89
KLLA0D01155g6.21ON3353286711e-85
Kpol_1032.86.21ON3433285363e-65
NCAS0D026706.21ON3512163692e-40
NDAI0I022406.21ON3502233631e-39
TBLA0A072706.21ON3732543413e-36
TPHA0M002706.21ON3773663152e-32
CAGL0H08195g5.617ON5831032313e-20
NDAI0F009105.617ON5831032181e-18
Kpol_1018.695.617ON5901012153e-18
TPHA0D028805.617ON5851202134e-18
KLTH0E02178g5.617ON5931012134e-18
AEL224W5.617ON5801252118e-18
ZYRO0A05676g5.617ON5721012118e-18
Kwal_55.199355.617ON5931012119e-18
NCAS0G008105.617ON5841052119e-18
Ecym_55825.617ON5841042091e-17
SAKL0G07084g5.617ON5851232082e-17
YOR027W (STI1)5.617ON5891012064e-17
TBLA0E033005.617ON5821012039e-17
Smik_15.2055.617ON5891012021e-16
TDEL0A048405.617ON5761422021e-16
KLLA0A07062g5.617ON5811001993e-16
KAFR0C058905.617ON5751041993e-16
Skud_15.1925.617ON5891231932e-15
KNAG0B032005.617ON5791031913e-15
Suva_8.805.617ON5861011914e-15
NCAS0A00490singletonON620991791e-13
KNAG0A079003.481ON512781551e-10
KAFR0B066103.481ON5111271551e-10
TDEL0D055003.481ON5121161522e-10
NCAS0F034903.481ON5121101497e-10
YGR123C (PPT1)3.481ON513771471e-09
Ecym_44133.481ON510721461e-09
Skud_7.4323.481ON513771442e-09
Smik_6.2153.481ON513761442e-09
TBLA0C039503.481ON5121221433e-09
SAKL0F03102g3.481ON5131291434e-09
CAGL0D05060g3.481ON510791424e-09
NDAI0B057903.481ON5231201416e-09
Kpol_505.413.481ON513841407e-09
AAR083C3.481ON5381061408e-09
Suva_7.4083.481ON513771381e-08
KLLA0F24046g2.152ON6041211381e-08
TPHA0D032203.481ON513761372e-08
Kwal_27.118908.506ON3341281246e-07
KLLA0B10912g3.481ON512751248e-07
YBR155W (CNS1)8.506ON3851211221e-06
SAKL0H10934g8.506ON3801281202e-06
ZYRO0B04224g3.481ON5131161203e-06
NCAS0G024802.152ON596831203e-06
Smik_2.2958.506ON3851131193e-06
CAGL0H07425g8.506ON3801441174e-06
Kwal_33.147672.152ON5941201175e-06
KAFR0E029808.506ON3801381166e-06
AGL268C8.506ON3791551167e-06
KNAG0A039508.506ON3861161157e-06
KLLA0B09966g8.506ON3701331157e-06
TDEL0B051402.152ON5991261151e-05
Suva_4.4058.506ON3851211132e-05
KLTH0F14542g3.481ON513961132e-05
NCAS0B024008.506ON380951122e-05
KLTH0B05170g2.152ON593741123e-05
Kwal_55.211753.481ON511961113e-05
TBLA0H033808.506ON3751371113e-05
NDAI0C052908.506ON379961104e-05
CAGL0K09240g6.328ON142961044e-05
Ecym_25598.506ON3701011094e-05
NDAI0B043402.152ON6641111105e-05
NCAS0B070102.152ON6251181096e-05
CAGL0L04048g2.152ON587791079e-05
Ecym_20906.328ON172901021e-04
Skud_8.1782.152ON6381411061e-04
TDEL0B013108.506ON3801391051e-04
TBLA0I023106.328ON11665982e-04
Kpol_513.28.506ON3741131033e-04
ABR131W2.152ON594741024e-04
Skud_2.2828.506ON3851211014e-04
KAFR0F007202.152ON608711024e-04
SAKL0E10956g2.152ON600741025e-04
KLTH0E11748g8.506ON3781731015e-04
NDAI0F028102.152ON609891016e-04
Ecym_82042.152ON597721008e-04
Suva_15.3142.152ON644101990.001
TPHA0I015102.152ON60380990.001
ZYRO0G06512g2.152ON604109980.001
YHR117W (TOM71)2.152ON639104980.001
ADR230W5.689ON68571980.001
Skud_14.2112.152ON617149970.002
TBLA0C055302.152ON610105960.002
SAKL0A01672g6.328ON12863900.002
TPHA0L014208.506ON37495940.003
Smik_8.1952.152ON635104950.003
Skud_2.247.412ON769102950.003
KLLA0C08910g6.328ON11553870.005
Kpol_1018.1067.412ON75391930.005
NDAI0I004406.328ON12867860.008
ZYRO0F08624g8.506ON379117910.008
KNAG0I025206.328ON11761850.009
Suva_2.347.412ON763102910.009
Smik_2.367.412ON751102910.010
CAGL0M08030g1.456ON387148900.011
YBL084C (CDC27)7.412ON758102900.013
NCAS0D045006.328ON12158840.013
YNL121C (TOM70)2.152ON617125890.014
Ecym_40315.689ON68864890.016
Kpol_1048.212.152ON59772880.020
KNAG0H035302.152ON61474880.021
NCAS0E024907.412ON809109870.027
NDAI0E040407.412ON783103870.028
YCR060W (TAH1)6.328ON11169810.028
KAFR0J025706.328ON12162820.030
Kpol_1043.605.689ON70657860.039
Kpol_1028.516.328ON11777800.039
TPHA0D038606.328ON12082800.051
TDEL0A074306.328ON12463800.053
Kwal_27.107407.412ON628112840.065
Smik_14.2072.152ON617115830.076
Suva_14.2192.152ON617108800.17
Kpol_1006.43.367ON732113800.21
SAKL0D11110g1.456ON432163790.22
Kpol_1067.251.456ON391131790.23
Skud_4.5068.470ON61150790.24
Smik_4.4918.470ON61250790.26
TDEL0C027207.412ON700136790.28
Suva_2.4108.470ON61150780.31
KLTH0C06204g7.412ON627120780.31
KAFR0L018707.412ON71285780.31
NDAI0C051308.470ON59055780.39
AAR054C6.328ON13364730.49
Smik_3.1596.328ON11556720.50
YDR244W (PEX5)8.470ON61249760.59
Kwal_55.218395.689ON690105750.86
NDAI0C043205.352ON706129750.93
ZYRO0E03300g1.456ON397115740.95
AEL062C1.456ON383125741.0
TPHA0G004305.689ON72856741.2
CAGL0K11209g8.470ON59064731.5
CAGL0J09570g8.470ON549122731.5
SAKL0E14542g5.689ON69053731.6
TBLA0H019705.352ON84092722.0
Kwal_34.160921.456ON395129712.0
ZYRO0A02926g8.470ON57748712.3
ZYRO0C02970g3.32ON89665712.5
Suva_3.956.328ON11166662.9
Kpol_1031.648.470ON60748703.0
CAGL0H07095g5.352ON661156703.1
KLLA0F14102g1.267ON716103703.2
TPHA0B039701.456ON39690693.4
TDEL0E027505.352ON564101703.4
SAKL0F12936g7.412ON63291703.5
KLLA0E20857g7.412ON71075703.5
KAFR0E040705.402ON373354704.1
SAKL0H11946g8.470ON57363694.2
AFR088W1.267ON72268694.3
KLTH0F18150g5.689ON68988694.8
Skud_3.1356.328ON11863654.9
KNAG0B022407.412ON73993685.2
Ecym_63481.267ON73080686.1
TBLA0E019907.313ON374156676.1
YDR320C (SWA2)5.352ON668134686.4
ZYRO0C03564g3.5ON1096105686.6
Kwal_27.117378.470ON57549676.8
NDAI0J001307.546ON140365686.8
NCAS0A147707.458ON30091667.3
KLTH0E10934g8.470ON56849677.3
Suva_12.1141.456ON370115667.7
KLLA0A05258g5.72ON632100677.8
Kwal_YGOB_23.38053.401ON2353111677.9
Ecym_23738.699ON57981678.1
Kwal_55.220393.32ON90482678.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C07788g
         (334 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   536   0.0  
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   374   e-129
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   337   e-114
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   336   e-114
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   330   e-112
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   329   e-111
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   325   e-110
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   321   e-108
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   320   e-108
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   315   e-106
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   312   e-105
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   311   e-105
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   297   6e-99
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   295   1e-98
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   295   3e-98
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   290   3e-96
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   281   8e-93
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   274   2e-90
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   271   7e-89
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   263   1e-85
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   211   3e-65
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   146   2e-40
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   144   1e-39
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   135   3e-36
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   125   2e-32
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    94   3e-20
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     89   1e-18
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    87   3e-18
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    87   4e-18
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    87   4e-18
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    86   8e-18
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    86   8e-18
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    86   9e-18
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    86   9e-18
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    85   1e-17
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    85   2e-17
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    84   4e-17
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    83   9e-17
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    82   1e-16
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    82   1e-16
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    81   3e-16
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    81   3e-16
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    79   2e-15
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    78   3e-15
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    78   4e-15
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       74   1e-13
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    64   1e-10
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    64   1e-10
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    63   2e-10
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    62   7e-10
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    61   1e-09
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    61   1e-09
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    60   2e-09
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    60   2e-09
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    60   3e-09
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    60   4e-09
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    59   4e-09
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    59   6e-09
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    59   7e-09
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    59   8e-09
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    58   1e-08
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    58   1e-08
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    57   2e-08
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    52   6e-07
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    52   8e-07
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    52   1e-06
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    51   2e-06
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    51   3e-06
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    51   3e-06
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    50   3e-06
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    50   4e-06
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    50   5e-06
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    49   6e-06
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    49   7e-06
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    49   7e-06
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    49   7e-06
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    49   1e-05
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    48   2e-05
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    48   2e-05
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    48   2e-05
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    48   3e-05
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    47   3e-05
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    47   3e-05
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    47   4e-05
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    45   4e-05
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    47   4e-05
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    47   5e-05
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    47   6e-05
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    46   9e-05
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    44   1e-04
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    45   1e-04
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    45   1e-04
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    42   2e-04
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    44   3e-04
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    44   4e-04
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    44   4e-04
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    44   4e-04
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    44   5e-04
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    44   5e-04
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    44   6e-04
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    43   8e-04
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    43   0.001
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    43   0.001
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    42   0.001
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    42   0.001
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    42   0.001
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    42   0.002
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    42   0.002
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    39   0.002
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    41   0.003
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    41   0.003
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    41   0.003
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    38   0.005
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    40   0.005
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    38   0.008
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    40   0.008
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    37   0.009
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    40   0.009
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    40   0.010
CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa] ...    39   0.011
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    39   0.013
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    37   0.013
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    39   0.014
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    39   0.016
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    39   0.020
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    39   0.021
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    38   0.027
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    38   0.028
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    36   0.028
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    36   0.030
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    38   0.039
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    35   0.039
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    35   0.051
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    35   0.053
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    37   0.065
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    37   0.076
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    35   0.17 
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    35   0.21 
SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} simila...    35   0.22 
Kpol_1067.25 s1067 (57301..58476) [1176 bp, 391 aa] {ON} (57301....    35   0.23 
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    35   0.24 
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    35   0.26 
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    35   0.28 
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    35   0.31 
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    35   0.31 
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    35   0.31 
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    35   0.39 
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    33   0.49 
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    32   0.50 
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    34   0.59 
Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR08...    33   0.86 
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    33   0.93 
ZYRO0E03300g Chr5 complement(259634..260827) [1194 bp, 397 aa] {...    33   0.95 
AEL062C Chr5 complement(519416..520567) [1152 bp, 383 aa] {ON} S...    33   1.0  
TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}...    33   1.2  
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    33   1.5  
CAGL0J09570g Chr10 complement(941571..943220) [1650 bp, 549 aa] ...    33   1.5  
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    33   1.6  
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    32   2.0  
Kwal_34.16092 s34 complement(198730..199917) [1188 bp, 395 aa] {...    32   2.0  
ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {...    32   2.3  
ZYRO0C02970g Chr3 (230414..233104) [2691 bp, 896 aa] {ON} simila...    32   2.5  
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    30   2.9  
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    32   3.0  
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...    32   3.1  
KLLA0F14102g Chr6 (1302743..1304893) [2151 bp, 716 aa] {ON} simi...    32   3.2  
TPHA0B03970 Chr2 (938053..939243) [1191 bp, 396 aa] {ON} Anc_1.4...    31   3.4  
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    32   3.4  
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    32   3.5  
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    32   3.5  
KAFR0E04070 Chr5 complement(804691..815892) [11202 bp, 3733 aa] ...    32   4.1  
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    31   4.2  
AFR088W Chr6 (587441..589609) [2169 bp, 722 aa] {ON} Syntenic ho...    31   4.3  
KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weak...    31   4.8  
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    30   4.9  
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    31   5.2  
Ecym_6348 Chr6 complement(674740..676932) [2193 bp, 730 aa] {ON}...    31   6.1  
TBLA0E01990 Chr5 (483675..484799) [1125 bp, 374 aa] {ON} Anc_7.3...    30   6.1  
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...    31   6.4  
ZYRO0C03564g Chr3 (281661..284951) [3291 bp, 1096 aa] {ON} simil...    31   6.6  
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    30   6.8  
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    31   6.8  
NCAS0A14770 Chr1 complement(2911657..2912559) [903 bp, 300 aa] {...    30   7.3  
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    30   7.3  
Suva_12.114 Chr12 (164933..166042) [1110 bp, 370 aa] {ON} YJR032...    30   7.7  
KLLA0A05258g Chr1 (466776..468674) [1899 bp, 632 aa] {ON} simila...    30   7.8  
Kwal_YGOB_23.3805 s23 complement(441696..448757) [7062 bp, 2353 ...    30   7.9  
Ecym_2373 Chr2 complement(724722..726461) [1740 bp, 579 aa] {ON}...    30   8.1  
Kwal_55.22039 s55 (1084478..1087192) [2715 bp, 904 aa] {ON} YNL3...    30   8.9  

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/334 (82%), Positives = 277/334 (82%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAAFGGKNL 60
           MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAAFGGKNL
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAAFGGKNL 60

Query: 61  AELLSAGAGAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAI 120
           AELLSAGAGAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAI
Sbjct: 61  AELLSAGAGAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAI 120

Query: 121 SVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEA 180
           SVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEA
Sbjct: 121 SVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEA 180

Query: 181 LEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEPAGANPXXX 240
           LEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEPAGANP   
Sbjct: 181 LEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEPAGANPGGG 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETMMQNPNVRQMAEKFAGGNGTP 300
                                                ETMMQNPNVRQMAEKFAGGNGTP
Sbjct: 241 FDLSSMLGGGLGGLLNNPQVMQAAQQMMQNPQAMSQMETMMQNPNVRQMAEKFAGGNGTP 300

Query: 301 NLNDIMNNPALRDMXXXXXXXXXXXXXXXXXPRP 334
           NLNDIMNNPALRDM                 PRP
Sbjct: 301 NLNDIMNNPALRDMAGGLFGGAGGGANPGGAPRP 334

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  374 bits (959), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 192/318 (60%), Positives = 232/318 (72%), Gaps = 4/318 (1%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAAFGGKNL 60
           M+PSNK+++SLIVDYL+ +V+KK+VSE++IDSLNVAI+CI E+F ++KG S A FGGK L
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAVFGGKGL 60

Query: 61  AELLSAGAGAPS----SQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKY 116
            ELL   +G+ S    +Q E++KVNIPAEDAE K+KAE+LKLEGNKAMA KD++LAIKKY
Sbjct: 61  VELLQNESGSSSETATTQAESIKVNIPAEDAETKAKAETLKLEGNKAMACKDFDLAIKKY 120

Query: 117 SEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGK 176
           S+AI V+PTNAVYYANRAAAHSS+K Y+EAIKDAESA+K D +YSKGYSRLGYAKFA G+
Sbjct: 121 SDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQ 180

Query: 177 SEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEPAGAN 236
           +E+ALEAYKKVLDIEGD A+DVMKRDYETAK+KVEQ+L+L K  ET+      G      
Sbjct: 181 AEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARGADAGAGGAGG 240

Query: 237 PXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETMMQNPNVRQMAEKFAGG 296
                                                    E+MMQNP VRQMAE FA G
Sbjct: 241 SGGFGDFASMLGGGLGGLLNNPQLMQAAQQMMQNPQAMSQMESMMQNPGVRQMAENFAQG 300

Query: 297 NGTPNLNDIMNNPALRDM 314
           NG PN+ D+MNNPALRDM
Sbjct: 301 NGMPNMGDLMNNPALRDM 318

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  337 bits (863), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 172/323 (53%), Positives = 225/323 (69%), Gaps = 9/323 (2%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAAFG---- 56
           M+ S ++I++LIV+Y + +V+KK +SED  DSLNVA++CI+EAFG E+ + S   G    
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 57  -GKNLAELLSAGAGAPSSQ----GENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYEL 111
            G++LA++L++ +  P S      ENV++NIP +DAE K+KAE LK++GNKAMA KDYEL
Sbjct: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 112 AIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAK 171
           AI KY+EAI V+PTNA+YYANRAAAHSSLK YD+A+KDAESA+ +D SY +GYSRLG+AK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180

Query: 172 FAQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGE 231
           +AQGK EEALEAYKKVLDIEGD+AT+ MKRDYE+AK+KVEQ+L L KT   ++ D     
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA 240

Query: 232 PAGANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETMMQNPNVRQMAE 291
             GA+                                         + MMQ+P++RQMAE
Sbjct: 241 SQGASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300

Query: 292 KFAGGNGTPNLNDIMNNPALRDM 314
            FA G GTPNL+D+MNNPALR+M
Sbjct: 301 GFASGGGTPNLSDLMNNPALRNM 323

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  336 bits (861), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 180/318 (56%), Positives = 223/318 (70%), Gaps = 7/318 (2%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSA----AFG 56
           MA SNK+I++LIVD+L+  V+K +VSED  DSLNVAI+CI+EAF  E+ + S     +F 
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60

Query: 57  GKNLAELLSAGAGAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKY 116
            + L ELL + A A  +Q E VKVNIPAEDA  K+KAE LKL+GNKAMA KD+E AIKKY
Sbjct: 61  NRKLDELLKSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKY 120

Query: 117 SEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGK 176
           +EAI V+P+NAVYYANRAAA+SSLK Y+E+++DAESA+KV+ SYSKGYSRLG+AK+A GK
Sbjct: 121 TEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGK 180

Query: 177 SEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEPAGAN 236
            EEALEAYK VLDIEGD ATDVMKRDYETAKRKVEQ+L L K+  T+T ++ +   AGA 
Sbjct: 181 PEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDAGAG 240

Query: 237 PXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETMMQNPNVRQMAEKFAGG 296
                                                    + MM+NP VRQMAE F+ G
Sbjct: 241 ---ASGFPDMASLLGGGLGGLLNNPQVMSAAQKLMQNPGAMDEMMKNPAVRQMAENFSSG 297

Query: 297 NGTPNLNDIMNNPALRDM 314
            GTPNL D+M+NPA++DM
Sbjct: 298 GGTPNLGDLMSNPAIKDM 315

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  330 bits (845), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 170/323 (52%), Positives = 221/323 (68%), Gaps = 9/323 (2%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAAFG---- 56
           M  S ++I++LIV+Y + +V+KK +SED  DSLNVA++CI+EAFG E+ ++S   G    
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 57  -GKNLAELLSAGAGAPSSQ----GENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYEL 111
            GK+LA++L++ + A  S      +NV+VNIP EDAE K+KAE LK++GNKAMA KDYEL
Sbjct: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 112 AIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAK 171
           AI KY+EAI V+PTNA+YYANRAAAHSSL+ YDEA+KDAES++ +D SY +GYSRLG+AK
Sbjct: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180

Query: 172 FAQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGE 231
           +AQGK EEALEAYKKVLDIEGD+AT+ MKRDYE+AK+KVEQ+L L K    ++ D     
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANA 240

Query: 232 PAGANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETMMQNPNVRQMAE 291
             GA                                          + MMQ+P++RQMAE
Sbjct: 241 SQGAGSSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300

Query: 292 KFAGGNGTPNLNDIMNNPALRDM 314
            F  G G PNL+D+MNNPALR+M
Sbjct: 301 GFTSGGGAPNLSDLMNNPALRNM 323

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  329 bits (844), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 171/325 (52%), Positives = 223/325 (68%), Gaps = 11/325 (3%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGS-----SSAAF 55
           M+ S  +I+SLIV+Y + +V+KK +SEDS DSLNVA++CI+EAFG E+ +      ++ F
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60

Query: 56  GGKNLAELLSAGAGAPSS----QGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYEL 111
            G+NL +LL++ +    S      +NV+VNIP EDAE+K+KAE LK++GNKAMA KDYEL
Sbjct: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMANKDYEL 120

Query: 112 AIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAK 171
           AI KY+EAI V+PTNA+YYANRAAAHSSLK YDEA++DAESA+ +D +Y +GYSRLG+AK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180

Query: 172 FAQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKT--DETETSDRGT 229
           +AQGK EEALEAYKKVLDIEGD+AT+ MKRDYE+AK+KVEQ+L L KT  +++  +D   
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240

Query: 230 GEPAGANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETMMQNPNVRQM 289
               GA                                          + MMQ+PN++QM
Sbjct: 241 DASQGAGTSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQM 300

Query: 290 AEKFAGGNGTPNLNDIMNNPALRDM 314
           AE F  G G PNL+D+MNNPALR M
Sbjct: 301 AEGFTSGGGAPNLSDLMNNPALRSM 325

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  325 bits (832), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 179/323 (55%), Positives = 223/323 (69%), Gaps = 9/323 (2%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSA-----AF 55
           M+ S ++I+SLIV+Y + +V+KK VSEDS DSLNVA++CI+EAFG E+ + S+      F
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 56  GGKNLAELLSAGAGAPSS----QGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYEL 111
            G++L  LLS+ +  P S      +NV+VNIP EDAE K+KAE LK++GNKAMA K+YEL
Sbjct: 61  KGQSLNNLLSSSSKLPESGKKDDAQNVEVNIPEEDAETKAKAEELKIQGNKAMANKEYEL 120

Query: 112 AIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAK 171
           AIKKY+EAI V+PTNA+YYANRAAAHSSLK YDEAIKDAESA+ VD SY +GYSRLG+AK
Sbjct: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180

Query: 172 FAQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGE 231
           +AQGK EEALEAYKKVLDIEGD+ATD MKRDYE+AK++VEQ+L L KT   +  D G   
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDAGANA 240

Query: 232 PAGANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETMMQNPNVRQMAE 291
             GA                                          + MMQ+P++RQMAE
Sbjct: 241 GQGAGAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQMAE 300

Query: 292 KFAGGNGTPNLNDIMNNPALRDM 314
            F  G GTPNL+D+M NPALR+M
Sbjct: 301 GFTSGGGTPNLSDLMKNPALRNM 323

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  321 bits (822), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 171/314 (54%), Positives = 220/314 (70%), Gaps = 5/314 (1%)

Query: 5   NKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAAFG----GKNL 60
           +K+++++I+ YL  VV +K+V ED +DS+NVAI+CI E+F +E+G   +        K L
Sbjct: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61

Query: 61  AELLSAGAGAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAI 120
            E L    G  + + E+VKVNIPAEDAE K+KAE+LKLEGNKAMAGKD+ELAI KYSEAI
Sbjct: 62  EECLECMKGG-AVKSEDVKVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKYSEAI 120

Query: 121 SVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEA 180
            V+PTNA+YYANRAAAHSSLK YDEA+ DAE A+++D +YSKGYSRLG+AK+AQ K EEA
Sbjct: 121 EVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEA 180

Query: 181 LEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEPAGANPXXX 240
           LEAYKKV+D+EGD ATD+MKRDYETAK+KVEQ+L L KT +   +D G G  AGA     
Sbjct: 181 LEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARGADSGAGAGAGAGGAGG 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETMMQNPNVRQMAEKFAGGNGTP 300
                                                ++MMQ+P++RQMAE+F  GNGTP
Sbjct: 241 FDFSSMLSGGLSGLMNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSGNGTP 300

Query: 301 NLNDIMNNPALRDM 314
           N++D+M+NPALR+M
Sbjct: 301 NMDDLMSNPALRNM 314

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  320 bits (819), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 170/318 (53%), Positives = 214/318 (67%), Gaps = 10/318 (3%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAA----FG 56
           M+PSNKD+++LIVD+L+  V+ K VSED +DSLNVAI+CITEAF  ++ S +      F 
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60

Query: 57  GKNLAELLSAGAGAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKY 116
           G++L +++ A +   SS  E+VKVNIP EDAE K+KAESLKLEGNKAMA KD+E A+ KY
Sbjct: 61  GRSLKQVVEAASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKY 120

Query: 117 SEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGK 176
           SEAI V+PTNAVYYANRAAAHSSLK Y+EA+KDAE A+KV+ SYSKGYSRLG+A++A GK
Sbjct: 121 SEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGK 180

Query: 177 SEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEPAGAN 236
            EEAL+AYKKVLDIEG++ATD MKRDY+TA +KV Q+L + K+    T D          
Sbjct: 181 PEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSA----- 235

Query: 237 PXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETMMQNPNVRQMAEKFAGG 296
                                                    + +M NP V+QMAEKF  G
Sbjct: 236 -TGSGGLPDISSMLGGGLGGLLNNPQLMQAAQQMMQNPNAMQEVMNNPAVKQMAEKFQSG 294

Query: 297 NGTPNLNDIMNNPALRDM 314
            GTP++ D+MNNPAL DM
Sbjct: 295 GGTPSMADLMNNPALMDM 312

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  315 bits (806), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 169/326 (51%), Positives = 223/326 (68%), Gaps = 12/326 (3%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEK----GSSSAAFG 56
           M+ SNKDI++LI+D+L+ VVDK  VSED+ DSLNVA++CI EAF  E+    G   ++F 
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60

Query: 57  GKNLAELLSAGAGAPSSQG---ENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAI 113
           G +L+  L+    A ++     E VKVN+  +D E    AE+LKLEGNKAMAGKDYELAI
Sbjct: 61  GNSLSSYLNGSTSASAATTTADETVKVNVTEDDTEASEAAEALKLEGNKAMAGKDYELAI 120

Query: 114 KKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFA 173
           KKY+EAI+ +PTNAVY+ANRAAA+SSLK YDEA++DA SA+K++ +YSKGYSRLG+AKFA
Sbjct: 121 KKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFA 180

Query: 174 QGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKT----DETETSDRGT 229
           QGK+E+ALEAYKKVLDIEGD AT++MKRDYETAK+KVEQ+L L K+    + T  SD  +
Sbjct: 181 QGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAESDSAS 240

Query: 230 -GEPAGANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETMMQNPNVRQ 288
             +P                                             E+MMQNP+V+Q
Sbjct: 241 AADPFAGMGGMPDFSSMLGGGGLGNLLNNPQLMQAAQQMMQDPEAMKQVESMMQNPSVKQ 300

Query: 289 MAEKFAGGNGTPNLNDIMNNPALRDM 314
           MA++F+ GNGTP+ + +MN+P++RDM
Sbjct: 301 MADQFSSGNGTPDFSALMNDPSIRDM 326

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  312 bits (800), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 169/322 (52%), Positives = 220/322 (68%), Gaps = 12/322 (3%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAA----FG 56
           MA SNK++SSLI+DYL  VV K  VS D IDSLNVAI+C+TE FG+EK + SA     F 
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60

Query: 57  GKNLAELLSAGA----GAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELA 112
           GK+L ELL A +         + E VK+NIP EDAE K+KAE+LKLEGNKA+A KDY+LA
Sbjct: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQEDAETKAKAEALKLEGNKAVASKDYDLA 120

Query: 113 IKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKF 172
           ++KY+EAI ++PTNAVY+ANRAAA+++ +NYDEA+KDAE A+K+D +YSKGYSRL YAK+
Sbjct: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180

Query: 173 AQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEP 232
            Q   EE+LEAYKKVL+IEGDSAT+V KR YETAK++VE++L L K+  TE++   T   
Sbjct: 181 VQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTNPA 240

Query: 233 AGANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETMMQNPNVRQMAEK 292
           AG                                           ++MMQNP ++QMAE+
Sbjct: 241 AGGG---FPDFSSLMSGGLEGLMNNPQMMQAAQSMMSNPGAMEKIQSMMQNPAIQQMAEQ 297

Query: 293 FAGGNGTPNLNDIMNNPALRDM 314
           F GGN TP+ +++MNNPA+R+M
Sbjct: 298 FKGGN-TPDFSEMMNNPAVRNM 318

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  311 bits (798), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 177/329 (53%), Positives = 209/329 (63%), Gaps = 21/329 (6%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSS----AAFG 56
           MA SNK+I++LIVDYL +VVDKK VS D+ DSLNVA++CI EAF  E+ S      +AF 
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60

Query: 57  GKNLAELLSAGAGAPSSQGENVKVNIP--AEDAELKSKAESLKLEGNKAMAGKDYELAIK 114
           G  L   LS  A        +++VNI   A D E K+ AE LKLEGNKAMA KDYE AIK
Sbjct: 61  GNGLTSFLSGSAT------NDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIK 114

Query: 115 KYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQ 174
           KYSEAI V+PTNAVYYANRAAA+SSLK YD+A+ DAESA+KV+ +YSKGYSRLG+AKFAQ
Sbjct: 115 KYSEAIEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQ 174

Query: 175 GKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEPAG 234
           GK E+AL+AYKKVLDIEGD ATD+MKRDYETAK+KVEQ+L L K    E       +   
Sbjct: 175 GKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNADAGT 234

Query: 235 AN---------PXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETMMQNPN 285
                      P                                        E+MMQNP 
Sbjct: 235 GAAGMGGMGGFPDLSSMLGGGLGGGLGDLLKNPQIMQAAQQMMQNPNAMQQMESMMQNPA 294

Query: 286 VRQMAEKFAGGNGTPNLNDIMNNPALRDM 314
           VRQMAE FA G GTP+L+ +MNNP L+DM
Sbjct: 295 VRQMAENFASGEGTPDLSAMMNNPDLKDM 323

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  297 bits (760), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 167/324 (51%), Positives = 217/324 (66%), Gaps = 16/324 (4%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEK----GSSSAAFG 56
           M+ SNKDI++L+VD+L+  ++KK+VS D+ DSLNVAI+CITEAF  EK     + ++ FG
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60

Query: 57  GKNLAELLSAGAGAP--SSQGENVKVNIP----AEDAELKSKAESLKLEGNKAMAGKDYE 110
           GK+L ELL A   A   SS  E++KV+I      ED EL +KAE+LKLEGNKAMA KDY 
Sbjct: 61  GKSLTELLDAATNAKGRSSSPEDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAKDYN 120

Query: 111 LAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYA 170
           LA++KY+ AI +VPT AVYYANRAAA+SS + YDEAIKDAESA+KV+ ++SKGYSRLG+A
Sbjct: 121 LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA 180

Query: 171 KFAQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTG 230
           KFAQGKS+EALEAYKK L+++GD ATD+MKRDYETAK+KVEQ+L + K+     S   + 
Sbjct: 181 KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKSATPSASASASA 240

Query: 231 EPAGANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETMMQNPNVRQMA 290
              G                                           E+MMQNP++RQMA
Sbjct: 241 SAGG-----MPDMASMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIRQMA 295

Query: 291 EKFAGGNGTPNLNDIMNNPALRDM 314
           E  + G+ +  + D MNNPA+R+M
Sbjct: 296 ENLSSGS-SEGMGDFMNNPAIREM 318

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  295 bits (756), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 165/325 (50%), Positives = 222/325 (68%), Gaps = 19/325 (5%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSA----AFG 56
           M P+ K+++SLI+DYL    + K + ED IDSLNVAI+C+TEAF +EK S+S+    +FG
Sbjct: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60

Query: 57  GKNLAELLSAGAGAPS-SQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKK 115
           G++L +++ A +  P+ +Q E VKVNIP EDAE+K+KAE+LKLEGNKAMA KD+E AI K
Sbjct: 61  GQSLEQIVGASSKGPTATQQEPVKVNIPVEDAEIKAKAEALKLEGNKAMATKDFEHAISK 120

Query: 116 YSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQG 175
           YSEAI  +P+NAVY+ANRAAA+SSLK Y EA++DAE+A+KV+ SYSKGYSRLG+A++A G
Sbjct: 121 YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALG 180

Query: 176 KSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKT------DETETSDRGT 229
           + EEAL+AYKKVLDIEG +ATD MKRDY+TA +KVEQ+L + ++       E+  +  G+
Sbjct: 181 RPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDAAGGS 240

Query: 230 GEPAGANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETMMQNPNVRQM 289
           G P  A+                                         + MM NP ++QM
Sbjct: 241 GFPDIAS--------MLGGGLGGGLGGLLKNPQVMQAAQQMMQNPNAMQEMMSNPAIKQM 292

Query: 290 AEKFAGGNGTPNLNDIMNNPALRDM 314
           A+KF  G GTP++ D+MNNPAL DM
Sbjct: 293 ADKFQSGGGTPSMADLMNNPALMDM 317

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  295 bits (755), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 164/322 (50%), Positives = 210/322 (65%), Gaps = 11/322 (3%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSS----AAFG 56
           M  SNK+IS+LIVDYL  V +K  VSED  DSLNVAI+CIT++F  E+ S+S    + F 
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60

Query: 57  GKNLAELLSAGAGAPSSQGENVKVNIPAE----DAELKSKAESLKLEGNKAMAGKDYELA 112
             +L ELL       +S  ENV VN+P +    D E K KAE LKLEGNKAMA KD++LA
Sbjct: 61  NLSLPELLEVAME--NSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLA 118

Query: 113 IKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKF 172
           I KYSEAIS+ P NA+YYANRAAA+SSLK++++A +DAESA++VD +YSKGYSRLG+AK+
Sbjct: 119 IAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKY 178

Query: 173 AQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEP 232
           A  K EEALEAYKKVLD+EGD AT++MKRDYETAK++VEQ+L L K + T   +  T   
Sbjct: 179 ALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESA 238

Query: 233 AGANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETMMQNPNVRQMAEK 292
           A A                                          ++MMQNP++RQMAE 
Sbjct: 239 ANAAAGGFPDMSSMLGGGLNGLLNNPQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQMAEN 298

Query: 293 FAGGNGTPNLNDIMNNPALRDM 314
           F  GN TP+ + +MN+P ++DM
Sbjct: 299 FQNGN-TPDFSQLMNDPNIKDM 319

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  290 bits (741), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 161/328 (49%), Positives = 209/328 (63%), Gaps = 16/328 (4%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAA----FG 56
           M+ SNK++ SLIVD+L+ V+  K +SEDS DSLNVAI+CITE+F  E+ + +      F 
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60

Query: 57  GKNLAELLSAGAGAPSS--QGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIK 114
           GK L E+LS+ +   +   + E+VKVNIP EDAE+K+ AES KLEGNKAMA KDY LAI+
Sbjct: 61  GKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIE 120

Query: 115 KYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQ 174
           KYSEAI  +PTN +YYANRAAA+SS+K YD AIKDAE A+++D +YSKGYSRL +AK+A 
Sbjct: 121 KYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYAL 180

Query: 175 GKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDET--ETSDRGTGEP 232
            K EEALE YKKVLD+EGD AT  MKRD+E AK +VE ++ L K+  T  E S     +P
Sbjct: 181 NKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQQP 240

Query: 233 A------GANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETMMQNPNV 286
           A      G                                           + MMQNPN+
Sbjct: 241 ANPFAGSGMPDMSSLFGNGGGMGGLSSFLNNPQVMQAAQQMMSDPNSMQKMQEMMQNPNL 300

Query: 287 RQMAEKFAGGNGTPNLNDIMNNPALRDM 314
           R+MA+  A G+   NL+D+MNNP+++DM
Sbjct: 301 REMAQNLASGDA--NLDDLMNNPSVKDM 326

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  281 bits (720), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 156/337 (46%), Positives = 219/337 (64%), Gaps = 28/337 (8%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKG----SSSAAFG 56
           M+ +NKDI +LIVD+L+ +++K  VSED+ DSLNVA++CI+EA   ++     +    F 
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60

Query: 57  GKNLAELLSAGAGAPSS----QGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELA 112
           GK L ++L+  + A ++    + E+V+VNIP EDAE+K+ AE+ KLEGNKAMA KD+ LA
Sbjct: 61  GKTLVDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120

Query: 113 IKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKF 172
           ++KY+EAI ++PTNA+YYANRAAAHSSLK ++EAIKDAESA+K+D SYSKGYSRL +AK+
Sbjct: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180

Query: 173 AQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEP 232
             GK EEALE+YKKVLDIEGD+AT  MKRDYETAK++VE+++ + K   ++T ++G G+ 
Sbjct: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEK---SKTPEQGQGQQ 237

Query: 233 --------------AGANPXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXX 277
                         AG  P                                         
Sbjct: 238 QTNESAQGNAPNPFAGGMPDMSSLFGGAGMGGGLGSLLSNPDFMSTAQKLMSDPNAMQQV 297

Query: 278 ETMMQNPNVRQMAEKFAGGNGTPNLNDIMNNPALRDM 314
           ++MM +P++R +A  F  GN   ++NDIMNNPA+R+M
Sbjct: 298 QSMMSDPSMRDLANNFKNGNT--DMNDIMNNPAIRNM 332

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  274 bits (701), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 151/319 (47%), Positives = 201/319 (63%), Gaps = 14/319 (4%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSS----SAAFG 56
           M  SNK+I++LIV +L+     K V E+ +DSLNVAI+CI EAF IE+  S    S A+ 
Sbjct: 1   MPGSNKEIAALIVQFLS--TSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58

Query: 57  GKNLAELLSAGAGAPS-SQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKK 115
           G+ L +L+ +GA  P+ S  E    N  A   E+  +AE+LKLEGNKA A KD+E A+KK
Sbjct: 59  GRGLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKK 118

Query: 116 YSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQG 175
           Y+EAI ++P NAV+Y NRAAA+SS K ++EA++DAESAV+++ SYS+GYSRLG AK+A G
Sbjct: 119 YTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALG 178

Query: 176 KSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEPAGA 235
           K EEA+EAYKKVLDIEGD+AT+ MKRDYE+AK+KVE++L L    + E      G  AG 
Sbjct: 179 KPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEALPKGEEQQTSEGSSAGG 238

Query: 236 NPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETMMQNPNVRQMAEKFAG 295
            P                                        + MM NP ++QMA+ FA 
Sbjct: 239 FP-------DLSSMLGGGLGGLLNNPQVMQAAQKMMQNPSAMQEMMNNPAIKQMAQNFAS 291

Query: 296 GNGTPNLNDIMNNPALRDM 314
           G GTPNL D+M +P ++DM
Sbjct: 292 GGGTPNLGDMMKDPNIKDM 310

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  271 bits (692), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 156/328 (47%), Positives = 209/328 (63%), Gaps = 23/328 (7%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSS----SAAFG 56
           M+PSNKDI++LIVD+L      K+V ED  DSL VAI+CITEAF +  G +    S   G
Sbjct: 1   MSPSNKDIAALIVDFL--TTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58

Query: 57  GKNLAELLSAGAGAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKY 116
           G++L++LL+ G    S  GE     + AE  ELK +AE+LKLEGN+AMA KDYE AI+KY
Sbjct: 59  GRSLSQLLTTGMAHTSDAGEP---KVAAE--ELKKEAEALKLEGNRAMAAKDYETAIQKY 113

Query: 117 SEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGK 176
           + AI V+PT+AVYYANRAAA+SSL+ Y++A++DAE A KVDSSYSKG+SRLGYAK+A G+
Sbjct: 114 TAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGR 173

Query: 177 SEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEPAGAN 236
            EEALEAYK+VLDIEGD+AT+ M+RDYE+AKRKVE+++ +++    E ++ G      A 
Sbjct: 174 HEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRN--AEVTESGDSAAGSAG 231

Query: 237 PXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETMMQNPN----------V 286
                                                    + MMQNP+          +
Sbjct: 232 GSGLPDLASMFGGGGLGGGLGGGLGGGLGGLLNNPQVMQAAQKMMQNPSAIQEMMSNPAI 291

Query: 287 RQMAEKFAGGNGTPNLNDIMNNPALRDM 314
           ++MAE FA GNG+  L D+M +PA+R+M
Sbjct: 292 KKMAENFASGNGSSGLGDLMADPAVRNM 319

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  263 bits (671), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 157/328 (47%), Positives = 211/328 (64%), Gaps = 20/328 (6%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSS----SAAFG 56
           M+ SNK+I++LIVD+L+      SV+ED +DSLNVAI+CITEAF  E+  +    S  F 
Sbjct: 1   MSLSNKEIAALIVDFLSSS--SSSVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58

Query: 57  GKNLAELLSAGAGAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKY 116
           GK L ELL++   +    GE VKV+IP EDA  K+KAE LKL+GNKAMA K ++ AI+KY
Sbjct: 59  GKKLPELLASAPSSGGVSGEPVKVHIPVEDAAAKAKAEELKLQGNKAMAAKKFDEAIEKY 118

Query: 117 SEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGK 176
           + AI V P+NAVYY+NRAAA+SSLK Y++A+KDAE A++VD +YSKG+SRLG+AK+A  K
Sbjct: 119 TAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNK 178

Query: 177 SEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEPAGAN 236
            EEAL+AYKKVLDIEG+ ATDVMKRDYETAK+KVE ++ L K+  + +S+  + + A   
Sbjct: 179 PEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEKSSTSASSEDVSDKSA--- 235

Query: 237 PXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETMMQNPNV---------- 286
                                                    E MMQNP +          
Sbjct: 236 -TEGPGAGAGGLPDLSSLLGGGGLGGGLGALLNNPQVMQAAEKMMQNPGLMQDMMSNPAM 294

Query: 287 RQMAEKFAGGNGTPNLNDIMNNPALRDM 314
           +QMA +F+ G G P+L+ +MN+P++RDM
Sbjct: 295 KQMANQFSSGGGMPDLSQMMNDPSIRDM 322

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  211 bits (536), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 125/328 (38%), Positives = 187/328 (57%), Gaps = 26/328 (7%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSS----SAAFG 56
           M+ +NKD  +LIV+YL  ++D K VSED+ +SLNVAI+CI++ F ++  S     +  F 
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60

Query: 57  GKNLAELLSAGAGAPSSQGENVKVNIPAEDAEL----KSKAESLKLEGNKAMAGKDYELA 112
             +L  +   G G    Q  +  V +  ++ E+    K +AE+LKLEGNK M+ K+Y+ A
Sbjct: 61  KSDLKTITLKGLGL---QNVSDVVELEVKNEEISEDKKKEAEALKLEGNKQMSLKNYKSA 117

Query: 113 IKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKF 172
           I KYS+AI + P+N  YY+NRAAA+  ++++  A+ DA +A+K+D +YSK YSRLG AK 
Sbjct: 118 IDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKL 177

Query: 173 AQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEP 232
           A+G +E+A+ A+KKVL++EGD +T+VMK DYE AK+ V+  + LNK            +P
Sbjct: 178 AEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNK---------NVPDP 228

Query: 233 AGANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETM------MQNPNV 286
           +G  P                                        E M      MQNP V
Sbjct: 229 SGPPPLNTTDVLTDIATVLGSSFGSLMNNTQMMQRAQQMMQTQNPEMMQQVEGLMQNPVV 288

Query: 287 RQMAEKFAGGNGTPNLNDIMNNPALRDM 314
           RQ AE  A GNG   L+D++NNP+++++
Sbjct: 289 RQFAENVANGNGPGGLSDVLNNPSVKEV 316

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  146 bits (369), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 132/216 (61%), Gaps = 14/216 (6%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAAFGGKNL 60
           M+ SNK+I+S IV YL+ ++    V+ED  +S++VAIECI ++F +++  S+ +     L
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADSDLATVL 60

Query: 61  AELLSAGAGAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAI 120
              L+       S+ E   VN          +A  LKLEGNKA+  ++Y+ AI KY+ AI
Sbjct: 61  LANLNLEPEPKLSEKERELVN---------EQAIKLKLEGNKAVERENYKDAIDKYTRAI 111

Query: 121 SVVPTNAV-----YYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQG 175
            ++  N +     Y +N++ A +    Y+EA  DA + +K+D ++SKGYSRL  AK  Q 
Sbjct: 112 DLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQN 171

Query: 176 KSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVE 211
           K E+A+ AYK+VLD+EG+ ATD MKRD+E  K+K E
Sbjct: 172 KYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE 207

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  144 bits (363), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 129/223 (57%), Gaps = 15/223 (6%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAAFGGKNL 60
           M+ + +  +SLI+ YL+ + +   + ED  +SL VAI CI E+F ++      +   + L
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKERTL 60

Query: 61  AELLSAGAGAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAI 120
             +L           EN+   + A       +AE+LK EGN+AM    YE AIKKY+EAI
Sbjct: 61  KTILQ----------ENLNT-LEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAI 109

Query: 121 SVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEA 180
                N  YY+NR+ A+S L  Y++A+ DA  A+ +D S+SK YSRLGYAK  Q K E+ 
Sbjct: 110 QF-SKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDG 168

Query: 181 LEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETE 223
           + AYK+ +D+EG +A+  +  DYE A+ K EQ   L K D++E
Sbjct: 169 MTAYKRAIDLEGTNASKTLYDDYEDARFKYEQ---LKKNDDSE 208

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  135 bits (341), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 138/254 (54%), Gaps = 41/254 (16%)

Query: 4   SNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAA----FGGKN 59
           ++KD++ LIV++L +V+ KK +S+D+IDSLNVAI+CI + + + +   S++    F   +
Sbjct: 7   NDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLILKFSKSD 66

Query: 60  LAELLSAGAG-----------------APSSQGENVK---VNIPAEDAEL---------- 89
           L  +L+  A                   PSS  E+VK    NI  ++ E           
Sbjct: 67  LTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSK 126

Query: 90  -------KSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKN 142
                  K  A++ K EGN+ M  +DY+ AI+ Y+ AIS  P + +YY+NR+ A+  + +
Sbjct: 127 NNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVND 186

Query: 143 YDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSATDVMKRD 202
           Y+ AI DA   + +D+++SK Y RL   K  Q +  +AL+ YKK +++  DS  + + R+
Sbjct: 187 YESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITRE 246

Query: 203 YETAKRKVEQALEL 216
           +E  K KV+  + L
Sbjct: 247 FEDLKLKVQTDISL 260

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  125 bits (315), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 102/366 (27%), Positives = 156/366 (42%), Gaps = 77/366 (21%)

Query: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSS----AAFG 56
           M  ++++I+S+IVDY    +    +++D++DSLNVAI+CI + F ++K   S     A+ 
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60

Query: 57  GKNLAELLSAGA-GAPSSQGENVKVNIPA------------------------------E 85
             +L   L  G   A +   +N  +N+                                E
Sbjct: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120

Query: 86  DAELK------SKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSS 139
             E K       KAE LK +GN+ M  K Y  AI  YS+AI + PTN  YY NRA A+  
Sbjct: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180

Query: 140 LKNYDEAIKDAESAVKVDSSYS----KGYSRLGYAKFAQGKSEEALEAYKKVLDI----- 190
             N+D AI DA  ++++DS       K Y RLG AK+  G  E +L A+K++++I     
Sbjct: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240

Query: 191 EGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEPAGANPXXXXXXXXXXXXX 250
           +GD  T  M  DYE AK KV++   +  T    T   G+G      P             
Sbjct: 241 KGDEITKQMDADYEKAKEKVQELFFMQIT--KSTGKEGSGNSVNDGP------------- 285

Query: 251 XXXXXXXXXXXXXXXXXXXXXXXXXXXETMMQNPNVRQMAEKFAGGN--GTPNLNDIMNN 308
                                        +M NP  +++ E+    N       +++MN+
Sbjct: 286 ----------KRKVTLNDILNMAGNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMND 335

Query: 309 PALRDM 314
           P +R M
Sbjct: 336 PRVRQM 341

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 93.6 bits (231), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/103 (46%), Positives = 70/103 (67%), Gaps = 1/103 (0%)

Query: 91  SKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPT-NAVYYANRAAAHSSLKNYDEAIKD 149
           + A+  K +GN A   KDYE AI  +S+AI V  T N V+Y+NR+A ++SLK + EA+ D
Sbjct: 2   TTADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALND 61

Query: 150 AESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEG 192
           AE  VK++ ++SKGY+RLG A    G  +EA  +YKK L+++G
Sbjct: 62  AEECVKINPTWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDG 104

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 75/145 (51%), Gaps = 5/145 (3%)

Query: 92  KAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAE 151
           KAE  +LEG       D+  A+K Y+E I   P +A  Y+NRAAA S L ++ EAI+D  
Sbjct: 389 KAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCN 448

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYK--KVLDIEGDSATDVMKRD--YETAK 207
            A++ D ++ + Y R   A+ A  +   A+E     +  D E +++ +V + D  Y  A 
Sbjct: 449 KAIEKDPNFIRAYIRKATAQIAVKEFAAAIETLDAARTKDAEVNNSANVREIDQLYVKAS 508

Query: 208 RKVEQALELNKTDETETSDRGTGEP 232
           ++  Q    N+T E +  +R   +P
Sbjct: 509 QQRFQPASSNETPE-QVYERAMKDP 532

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 45/96 (46%), Gaps = 8/96 (8%)

Query: 100 GNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAA-------AHSSLKNYDEAIKDAES 152
           GNKA   + ++ AI  Y  A ++   +  Y  NR+A       A ++LK  DEA++    
Sbjct: 263 GNKAYKARQFDEAIAHYDAAWNLH-QDITYLNNRSAAEFEKGDAETALKTLDEAVEKGRE 321

Query: 153 AVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVL 188
                   +K ++R+G         ++A+E Y+K L
Sbjct: 322 MRTDYKLIAKSFARMGNVHHKTNNLKKAIEFYQKSL 357

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 70/103 (67%), Gaps = 1/103 (0%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPT-NAVYYANRAAAHSSLKNYDEAIKDAE 151
           A+  K +GN A   KD+  AI+ +++AI V PT N V Y+NR+AA++S K + EA+ DA 
Sbjct: 5   ADEYKQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDAT 64

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDS 194
             VK++ ++SKGY+RLG A+F  G  EEA + YK+ L ++ ++
Sbjct: 65  ECVKINPTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNNN 107

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 78/146 (53%), Gaps = 7/146 (4%)

Query: 92  KAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAE 151
           KAE  +LEG +     D+  A+K YSE I   P +A  Y+NRAAA S L ++ EAIKD +
Sbjct: 388 KAEEARLEGKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCD 447

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIE-----GDSATDVMKRDYETA 206
           +A+K D ++ + Y R   A+ A  +   AL+  ++    +     G ++ ++M+   +  
Sbjct: 448 NAIKKDPNFVRAYIRKATAQIAIKEYANALDTLEEAKSKDSSVNNGANSNEIMRLQMKAT 507

Query: 207 KRKVEQALELNKTDETETSDRGTGEP 232
           + +  QA   N+T E ET  R   +P
Sbjct: 508 QERF-QAPTGNETPE-ETYKRAMQDP 531

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 74/141 (52%), Gaps = 10/141 (7%)

Query: 90  KSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKD 149
           K +A+  K+EGNK      ++ AI++Y++A + +  +  Y  NR+AA     +++ AI  
Sbjct: 252 KLEADEAKVEGNKLYKAHKFDEAIEQYNKAWA-LNKDITYLNNRSAAEFEKGDFETAIAT 310

Query: 150 AESAV----KVDSSY---SKGYSRLGYAKFAQGKSEEALEAYKKVL--DIEGDSATDVMK 200
              AV    ++ + Y   +K ++R+G A   +G  +++++ Y+K L      D  T +  
Sbjct: 311 LNEAVDQGRELRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQKSLTEHRTADILTKLRN 370

Query: 201 RDYETAKRKVEQALELNKTDE 221
            + E  K++ EQ ++  K +E
Sbjct: 371 CEKELKKQEAEQYIDPEKAEE 391

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/101 (45%), Positives = 66/101 (65%), Gaps = 1/101 (0%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPT-NAVYYANRAAAHSSLKNYDEAIKDAE 151
           A+  K +GN A   KDY+ AI  +S+AI V    N V Y+NR+A ++SLK +  A+KDAE
Sbjct: 5   ADEYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAE 64

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEG 192
             VK++ S+SKGY+R+G A F  G  +EA   YKK L+++ 
Sbjct: 65  ECVKINPSWSKGYNRVGAAHFGMGDLDEAEAGYKKALELDA 105

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 52/99 (52%)

Query: 84  AEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNY 143
           AED     KAE  +LEG       D+  A+K Y+E I   P +A  Y+NRAA  S L ++
Sbjct: 388 AEDYINPEKAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSF 447

Query: 144 DEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALE 182
            EAI D   A++ D ++ + Y R   A+ A  +   ALE
Sbjct: 448 PEAIDDCNKAIEKDPNFVRAYIRKATAQIAVREFSSALE 486

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 50/98 (51%), Gaps = 8/98 (8%)

Query: 98  LEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAV--- 154
            EGNK    + ++ A+ KY+EA      +  Y  NR+AA     +Y+ +IK  E AV   
Sbjct: 268 AEGNKLYKARQFDEAVAKYNEAWE-AHNDITYLNNRSAAEFEKGDYETSIKTLEEAVEKG 326

Query: 155 -KVDSSY---SKGYSRLGYAKFAQGKSEEALEAYKKVL 188
            ++ + Y   +K ++R+G         ++A++ YKK L
Sbjct: 327 REMRADYKVIAKSFARMGNCYTKLNDLKKAIDFYKKSL 364

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 86.7 bits (213), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 76/120 (63%), Gaps = 3/120 (2%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVP-TNAVYYANRAAAHSSLKNYDEAIKDAE 151
           A+  K +GN A + K+YE A+  +S+AI V P  N V Y+NR+A ++SLK + +A+ DA 
Sbjct: 5   ADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDAN 64

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVE 211
              K++ ++SKGY+R+G A +  G  +EA ++YKK L++  D++  V +   E  KR  E
Sbjct: 65  ECTKINPTWSKGYNRVGAAHYGLGDLDEAEKSYKKALEL--DASNKVAQEGLEQVKRTQE 122

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 76/150 (50%), Gaps = 10/150 (6%)

Query: 52  SAAFGGKNLAELLSAGAGAPSSQGENVKVNIPAEDAEL---KSKAESLKLEGNKAMAGKD 108
           +A F  K+L E  +    A  ++  +++  I  ++AE      KAE  +++G        
Sbjct: 351 AAEFFNKSLTEFRTP---ATLTKLRSLEKKIKVQEAEAYINPEKAEEARIQGKDFFNKGQ 407

Query: 109 YELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLG 168
           +  A+K Y+E I+  P +A  Y+NRAAA S L ++ EAI D E A++ D ++ K Y R  
Sbjct: 408 WPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDPNFVKAYIRKA 467

Query: 169 YAKFAQGKSEEALEAYKKVLDIEGDSATDV 198
            A+ A  +   ALE     LDI     T++
Sbjct: 468 TAQIAIKEYSSALE----TLDIARSKDTEL 493

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 86.7 bits (213), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 47/101 (46%), Positives = 68/101 (67%), Gaps = 3/101 (2%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAI--SVVPTNAVYYANRAAAHSSLKNYDEAIKDA 150
           AE  K +GN A   KDYE A + +++AI  S  P N V Y+NR+A  +SLK ++EA+ DA
Sbjct: 3   AEEFKKQGNAAFVAKDYEKASELFTKAIEASEAP-NHVLYSNRSACFTSLKKFNEALNDA 61

Query: 151 ESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIE 191
              VK++ ++SKGY+R+G A F  GK +EA + YKK L+I+
Sbjct: 62  NECVKINPAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEID 102

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 51/91 (56%)

Query: 92  KAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAE 151
           KAE  +L+G +     D+  A+K Y+E     P +A  Y+NRAAA + L ++ EAIKD +
Sbjct: 400 KAEEARLQGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCD 459

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALE 182
            A+  D ++ + Y R   A+ A  +   A+E
Sbjct: 460 MAISKDPNFIRAYIRKATAQIAVREFASAIE 490

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 64/118 (54%), Gaps = 8/118 (6%)

Query: 78  VKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAH 137
           ++V+ P  + + K  A++ K EGNK    + ++ AI+ Y++A  +   +  Y  NR+AA 
Sbjct: 252 MEVDEPQPEQDSKKNADAEKAEGNKFYKARKFDEAIEHYNKAWDLH-KDVTYLNNRSAAE 310

Query: 138 SSLKNYDEAIKDAESAV----KVDSSY---SKGYSRLGYAKFAQGKSEEALEAYKKVL 188
               +Y++AIK    AV    ++ + Y   SK ++R+G A       ++A+E Y+K L
Sbjct: 311 YEKGDYEQAIKTLTEAVEQGREMRADYKLISKSFARIGNAYLKLEDFKKAIEFYQKSL 368

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 85.9 bits (211), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 80/125 (64%), Gaps = 3/125 (2%)

Query: 91  SKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPT-NAVYYANRAAAHSSLKNYDEAIKD 149
           + AE  K EGN A A KD+E AI+ + +AI V    N V Y+NR+A ++S++ + EA+ D
Sbjct: 2   TTAEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALAD 61

Query: 150 AESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGD--SATDVMKRDYETAK 207
           A+  V++   +SKG++RLG A +  G  +EA E+YKK L+++    +A D + +   T +
Sbjct: 62  AQECVRIKPDWSKGHNRLGAAHYGLGDLDEAEESYKKALELDSSNKAAQDGLAQVQATQQ 121

Query: 208 RKVEQ 212
           +++EQ
Sbjct: 122 QRMEQ 126

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 76/145 (52%), Gaps = 5/145 (3%)

Query: 92  KAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAE 151
           KAE  +L+G +     D+  A+K Y+E I   P +A  Y+NRAAA + L ++ +AIKD +
Sbjct: 387 KAEEARLQGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCD 446

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALE----AYKKVLDIEGDSATDVMKRDYETAK 207
            A++ D ++ + Y R   A+ A  +   A+E    A +K  ++   S T  + + Y  A 
Sbjct: 447 MAIQKDPNFVRAYIRKATAQIAVQEYAAAIETLDTAREKDAEVNNGSNTREIDQLYIKAT 506

Query: 208 RKVEQALELNKTDETETSDRGTGEP 232
           ++  Q    N++ E ET  R   +P
Sbjct: 507 QQRFQPANANESPE-ETYARAVKDP 530

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 57/106 (53%), Gaps = 8/106 (7%)

Query: 90  KSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKD 149
           +SKAE  K +GN+    + ++ AI  Y +A  +   +  Y  NRAAA     +Y+ AIK 
Sbjct: 251 RSKAEEAKAKGNELYKKRQFDEAIANYEKAWDL-HKDITYLNNRAAAEYEKGDYESAIKT 309

Query: 150 AESAV----KVDSSY---SKGYSRLGYAKFAQGKSEEALEAYKKVL 188
            E AV    ++ + Y   +K ++RLG A +     ++A+E Y+K L
Sbjct: 310 LEKAVEEGRELRADYKVIAKSFARLGNAHYKLADLKKAIEYYEKSL 355

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 85.9 bits (211), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 69/101 (68%), Gaps = 1/101 (0%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPT-NAVYYANRAAAHSSLKNYDEAIKDAE 151
           A+  K +GN A   KDY  AI  +++AI V  T N V Y+NR+A ++S K ++EA+KDAE
Sbjct: 3   ADEFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAE 62

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEG 192
             VK+  S+SKGY+R+G A+F   + +EA ++YK+ L+++ 
Sbjct: 63  ECVKISPSWSKGYNRVGAAQFGLSQLDEAEKSYKRALELDS 103

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 48/82 (58%)

Query: 92  KAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAE 151
           KAE  +L+G +     D+  A+K Y+E +   P +A  ++NRAAA + L ++ EAI+D  
Sbjct: 379 KAEEARLQGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCN 438

Query: 152 SAVKVDSSYSKGYSRLGYAKFA 173
            AV +D ++ + Y R   A+ A
Sbjct: 439 KAVSIDPNFVRAYIRKATAQIA 460

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 53/103 (51%), Gaps = 8/103 (7%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAES 152
           AE+ K EGNK    + +E AI+ Y++A  +   +  Y  NR+AA     +YD AIK    
Sbjct: 246 AEAEKAEGNKLYKARQFEEAIEHYNKAWEL-HKDITYLNNRSAAEFEKGDYDTAIKTLND 304

Query: 153 AV------KVD-SSYSKGYSRLGYAKFAQGKSEEALEAYKKVL 188
           AV      + D  + +K ++R+G A +      +A+E Y + L
Sbjct: 305 AVEQGRELRADYKTIAKSFARIGNAYYKLKDLRKAIEHYNRSL 347

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 85.9 bits (211), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 69/101 (68%), Gaps = 1/101 (0%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPT-NAVYYANRAAAHSSLKNYDEAIKDAE 151
           AE  K +GN A   KD+E A + +S+AI    T N V Y+NR+A ++SLK + EA++DAE
Sbjct: 3   AEEFKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAE 62

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEG 192
             VK++ ++SKGY+R+G A++  G  ++A + YKK L+I+ 
Sbjct: 63  ECVKINPTWSKGYNRVGAAQYGLGNLDDAEKEYKKALEIDS 103

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 50/91 (54%)

Query: 92  KAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAE 151
           KAE  +L+G +     D+  A+  Y+E I   P +A  Y+NRAA  + L ++ +AIKD +
Sbjct: 400 KAEEARLQGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCD 459

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALE 182
            A+  D ++ + Y R   A+ A  +   A+E
Sbjct: 460 VAISKDPNFVRAYIRKASAQIAVREFAPAME 490

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 69/124 (55%), Gaps = 8/124 (6%)

Query: 72  SSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYA 131
           S+  + ++V+ P  + + K+KA++ K EGNK    + ++ AI+ Y++A  +   +  Y  
Sbjct: 246 SADADKMEVDEPEPEQDSKAKADAEKAEGNKYYKARKFDEAIEHYNKAWDLH-RDVTYLN 304

Query: 132 NRAAAHSSLKNYDEAIKDAESAV----KVDSSY---SKGYSRLGYAKFAQGKSEEALEAY 184
           NR+AA     +Y++AIK    AV    ++ + Y   SK ++R+G A       ++A+E Y
Sbjct: 305 NRSAAEYEKGDYEQAIKTLTEAVDQGREMRADYKLISKSFARIGNAYLKMDDLKKAIEFY 364

Query: 185 KKVL 188
           ++ L
Sbjct: 365 QRSL 368

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 85.9 bits (211), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 70/105 (66%), Gaps = 1/105 (0%)

Query: 91  SKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPT-NAVYYANRAAAHSSLKNYDEAIKD 149
           S A+ LK +GN A A KD+  AI+ ++EAI+   T N V Y+NR+A ++SLK + EA+ D
Sbjct: 2   STADELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALND 61

Query: 150 AESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDS 194
           A+  VK++  +SKGY+R+G A    G  ++A   YKK L+++ ++
Sbjct: 62  AQQCVKINPDWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSNN 106

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 78/146 (53%), Gaps = 7/146 (4%)

Query: 92  KAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAE 151
           KAE  +LEG +     D+  A+K Y+E I   P +A  Y+NRAAA + L ++ EAIKD E
Sbjct: 389 KAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCE 448

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQG---KSEEALEAYKKVLDI--EGDSATDVMKRDYETA 206
            A++ D ++ + Y R   A+ A     K+ E LE  KK  D    G S+ ++MK   +  
Sbjct: 449 KAIEKDPNFVRAYLRKATAQIAIKDFVKALETLEEAKKKDDEVNNGASSNEIMKLQMKAT 508

Query: 207 KRKVEQALELNKTDETETSDRGTGEP 232
           + +  QA   N+T E ET  R   +P
Sbjct: 509 QERF-QAPTGNETPE-ETYKRAMQDP 532

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 65/132 (49%), Gaps = 10/132 (7%)

Query: 99  EGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVK--- 155
           EGNK      ++ AI +Y++A  +   +  Y  NR+AA     +++ A+     AV+   
Sbjct: 262 EGNKLYKSHKFDEAIAEYNKAWDL-HKDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGR 320

Query: 156 -VDSSY---SKGYSRLGYAKFAQGKSEEALEAYKKVL--DIEGDSATDVMKRDYETAKRK 209
            + + Y   +K ++R+G A   Q   ++A+E Y+K L      D  T +   + E  K++
Sbjct: 321 ELRADYKLIAKSFARMGNAYSKQKNLKKAIEYYQKSLTEHRTADILTKLRTCEKELKKQE 380

Query: 210 VEQALELNKTDE 221
           +E+ +   K +E
Sbjct: 381 IEEYINPEKAEE 392

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 69/104 (66%), Gaps = 3/104 (2%)

Query: 91  SKAESLKLEGNKAMAGKDYELAIKKYSEAI--SVVPTNAVYYANRAAAHSSLKNYDEAIK 148
           + AE  K EGN A   KD++ A++ ++ AI  S  P N V Y+NR+ A++SLK +DEA+ 
Sbjct: 2   TSAEEYKKEGNAAFVAKDFKRAVELFTNAIQESEEP-NHVLYSNRSGAYASLKKFDEALS 60

Query: 149 DAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEG 192
           DA   VK+ + +SKG++RLG A F  G  +EA E+YKK L+++ 
Sbjct: 61  DATECVKIKADWSKGHNRLGAAHFGLGNLDEAEESYKKALELDA 104

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 77/145 (53%), Gaps = 5/145 (3%)

Query: 92  KAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAE 151
           KAE  +L+G +     D+  A+K YSE I   P +A  Y+NRAAA S L ++ +AIKD +
Sbjct: 391 KAEKARLDGKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCD 450

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYK--KVLDIEGDSATDVMKRD--YETAK 207
            A+++D S+ + Y R   A+ A  +   A+E     +  D E ++ + + + D  Y  A 
Sbjct: 451 KAIEIDPSFVRAYIRKATAQIAVQEYSAAIETLDVARTKDAEVNNGSSIREIDQLYVKAT 510

Query: 208 RKVEQALELNKTDETETSDRGTGEP 232
           ++  Q    N++ E ET  R   +P
Sbjct: 511 QQRFQPANTNESPE-ETYARAVKDP 534

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 62/120 (51%), Gaps = 11/120 (9%)

Query: 79  KVNIPAEDAEL---KSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAA 135
           K   P E  E+   +  AE  K EGN+    + ++ AI KY EA ++   +  Y  NRAA
Sbjct: 241 KTQTPPEPMEVDLDRENAEKAKAEGNQLYKQRKFDEAIAKYEEAWNL-QKDITYLNNRAA 299

Query: 136 AHSSLKNYDEAIKDAESAV----KVDSSY---SKGYSRLGYAKFAQGKSEEALEAYKKVL 188
           A     +Y+ AIK    AV    ++ + Y   +K ++RLG A +   + ++A+E Y+K L
Sbjct: 300 AEYEKGDYNSAIKTLNEAVEQGRELRADYKVIAKSFARLGNAYYKLDEVKKAVEYYEKSL 359

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 82/123 (66%), Gaps = 3/123 (2%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVV-PTNAVYYANRAAAHSSLKNYDEAIKDAE 151
           A+  K +GN A A KD+E AI+ +++AI V    N V Y+NR+A ++S K +++A++DA+
Sbjct: 3   ADEYKQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAK 62

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEG--DSATDVMKRDYETAKRK 209
             V ++ ++SKGY+R+G A F  G  +EA + YKK L+++    +A D +++ ++T + +
Sbjct: 63  QCVNINPAWSKGYNRVGAAHFGLGDLDEAEQGYKKALELDSANKAAQDGLEQVHKTQQSR 122

Query: 210 VEQ 212
            +Q
Sbjct: 123 QQQ 125

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%)

Query: 92  KAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAE 151
           KAE  +L+G +     D+  A+K Y+E I   P +A  Y+NRAAA S L ++ EAIKD  
Sbjct: 392 KAEEARLQGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCN 451

Query: 152 SAVKVDSSYSKGYSRLGYAKFA 173
            A+  D ++ + Y R   A+ A
Sbjct: 452 VAISKDPNFIRAYIRKATAQIA 473

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 58/106 (54%), Gaps = 8/106 (7%)

Query: 90  KSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKD 149
           K+KA++ K EGNK    + ++ AI+ YS+A  +   +  Y  NRAAA      Y+ AIK 
Sbjct: 256 KAKADAEKAEGNKFYKARKFDEAIEHYSKAWELH-KDITYLNNRAAAEYEKGEYETAIKT 314

Query: 150 AESAV----KVDSSY---SKGYSRLGYAKFAQGKSEEALEAYKKVL 188
              AV    ++ + Y   SK ++R+G +     + ++A+E Y+K L
Sbjct: 315 LTEAVEQGRELRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSL 360

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 66/101 (65%), Gaps = 1/101 (0%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPT-NAVYYANRAAAHSSLKNYDEAIKDAE 151
           A+  K +GN A   KDY+ AI+ +++AI V  T N V Y+NR+A ++SLK + +A+ DA 
Sbjct: 5   ADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDAN 64

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEG 192
             VK++ S+SKGY+RLG A    G  +EA   YKK L+++ 
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDA 105

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 76/146 (52%), Gaps = 7/146 (4%)

Query: 92  KAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAE 151
           KAE  +LEG +     D+  A+K Y+E I   P +A  Y+NRAAA + L ++ EAI D  
Sbjct: 395 KAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCN 454

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYK--KVLDIE---GDSATDVMKRDYETA 206
            A++ D ++ + Y R   A+ A  +   ALE     +  D E   G SA ++ +  Y+ +
Sbjct: 455 KAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKAS 514

Query: 207 KRKVEQALELNKTDETETSDRGTGEP 232
           +++ +     N+T E ET  R   +P
Sbjct: 515 QQRFQPGTS-NETPE-ETYQRAMKDP 538

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 61/124 (49%), Gaps = 10/124 (8%)

Query: 74  QGENVKVNIPAEDAELKSK--AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYA 131
           Q E  K + P E  E  SK  A+  K EGNK    + ++ AI+ Y++A   +  +  Y  
Sbjct: 241 QKEESKESEPMEVDEDDSKIEADKEKAEGNKFYKARQFDEAIEHYNKAWE-LHKDITYLN 299

Query: 132 NRAAAHSSLKNYDEAIKDAESAV----KVDSSY---SKGYSRLGYAKFAQGKSEEALEAY 184
           NRAAA      Y+ AI     AV    ++ + Y   SK ++R+G A    G  ++ +E Y
Sbjct: 300 NRAAAEYEKGEYETAISTLNDAVEQGREMRADYKVISKSFARIGNAYHKLGDLKKTIEYY 359

Query: 185 KKVL 188
           +K L
Sbjct: 360 QKSL 363

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 82.8 bits (203), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 69/101 (68%), Gaps = 1/101 (0%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPT-NAVYYANRAAAHSSLKNYDEAIKDAE 151
           A+  K +GN A   K+Y+ AI+K+++AI V  T N V Y+NR+A ++S K + + ++DA 
Sbjct: 5   AQEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDAN 64

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEG 192
             VK++ ++SKGY+R+G A F  G  +EA +AYKK L+++ 
Sbjct: 65  ECVKINPTWSKGYNRVGAAHFGMGDLDEAEKAYKKALELDS 105

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 50/82 (60%)

Query: 92  KAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAE 151
           KAE  +LEG +     D+  A+K Y+E I+  P++A  Y+NRAAA S L ++ EAI D  
Sbjct: 388 KAEEARLEGKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCN 447

Query: 152 SAVKVDSSYSKGYSRLGYAKFA 173
           +A++ D ++ + Y R   A+ A
Sbjct: 448 TAIEKDPNFIRAYIRKATAQIA 469

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 66/101 (65%), Gaps = 1/101 (0%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPT-NAVYYANRAAAHSSLKNYDEAIKDAE 151
           A+  K +GN A   KDY+ AI+ +++AI V  T N V Y+NR+A ++SLK + +A+ DA+
Sbjct: 5   ADEYKQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAK 64

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEG 192
             + ++ S+SKGY+RLG A    G  +EA   YKK L+++ 
Sbjct: 65  ECININPSWSKGYNRLGAAHLGLGDLDEAENNYKKALELDA 105

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 73/145 (50%), Gaps = 5/145 (3%)

Query: 92  KAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAE 151
           KAE  +LEG       D+  A+K Y+E I   P +A  Y+NRAAA + L ++ EAI D  
Sbjct: 395 KAEEARLEGKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCN 454

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALE----AYKKVLDIEGDSATDVMKRDYETAK 207
            A++ D ++ + Y R   A+ A  +   ALE    A  K  D+   +++  + + Y  A 
Sbjct: 455 KAIEKDPNFVRAYIRKATAQIAVQEYAAALETLDAARTKDADVNNGASSREIDQLYYKAS 514

Query: 208 RKVEQALELNKTDETETSDRGTGEP 232
           ++  Q    N+T E ET  R   +P
Sbjct: 515 QQRFQPGTGNETPE-ETYQRAMKDP 538

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 62/126 (49%), Gaps = 10/126 (7%)

Query: 72  SSQGENVKVNIPAEDAELKSKAES--LKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVY 129
           + Q E  K + P E  E  SKAE+   K EGNK    + ++ AI+ Y++A  +   +  Y
Sbjct: 239 TPQREENKESDPMEVDEDDSKAEADKEKAEGNKFYKARQFDEAIEHYNKAWEL-HRDITY 297

Query: 130 YANRAAAHSSLKNYDEAIKDAESAVK----VDSSY---SKGYSRLGYAKFAQGKSEEALE 182
             NRAAA      Y  AI     AV+    + + Y   S+ ++R+G A    G  ++ +E
Sbjct: 298 LNNRAAAEYEKGEYKTAIATLNDAVEQGREMRADYKVISRSFARIGNAYHKLGDLKKTIE 357

Query: 183 AYKKVL 188
            Y+K L
Sbjct: 358 YYQKSL 363

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 85/142 (59%), Gaps = 11/142 (7%)

Query: 91  SKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPT-NAVYYANRAAAHSSLKNYDEAIKD 149
           + A+  K +GN A   KDYE A + + +AI V    N V Y+NR+A ++SLK + E +KD
Sbjct: 2   TSADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKD 61

Query: 150 AESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRK 209
           AE  VK++  +SKGY+R+G A+F     E+A ++Y+K L++  DSA        + AK  
Sbjct: 62  AEECVKINPGWSKGYNRVGAAQFGLNNLEDAEKSYQKALEL--DSAN-------KAAKEG 112

Query: 210 VEQALELNKTDETETSDRGTGE 231
           ++Q L+  ++ + +  D G G+
Sbjct: 113 LDQVLKTRESRQ-QMPDLGLGQ 133

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 49/82 (59%)

Query: 92  KAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAE 151
           KAE  +LEG +  +  D+  A+K Y+E I   P +A  Y+NRAAA + L ++ EAI D +
Sbjct: 381 KAEEARLEGKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCD 440

Query: 152 SAVKVDSSYSKGYSRLGYAKFA 173
            A++ D ++ + Y R   A+ A
Sbjct: 441 RAIEKDPNFIRAYIRKASAQIA 462

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 81.3 bits (199), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 69/100 (69%), Gaps = 1/100 (1%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPT-NAVYYANRAAAHSSLKNYDEAIKDAE 151
           A+  K EGN+A A KDY  AI+ +++AI V    N V ++NR+A ++S K++ +A+ DA 
Sbjct: 3   ADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDAN 62

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIE 191
             VK++ S++KGY+RLG A +  G  +EA ++YKK L+++
Sbjct: 63  ECVKINPSWAKGYNRLGAAHYGLGDLDEAEQSYKKALELD 102

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (58%)

Query: 92  KAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAE 151
           KAE  +L+G +     D+  A++ Y+E I   P +A  Y+NRAAA S L ++ +AI+D +
Sbjct: 388 KAEEARLQGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCD 447

Query: 152 SAVKVDSSYSKGYSRLGYAKFA 173
            A++ D ++ + Y R    + A
Sbjct: 448 KAIEKDPNFVRAYIRKATGQIA 469

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 62/113 (54%), Gaps = 8/113 (7%)

Query: 83  PAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKN 142
           P E  + KSKAE+ K EGNK    + ++ AI+KY+EA      +  Y  NRAAA     +
Sbjct: 245 PMEVDDDKSKAEAAKAEGNKLYKQRKFDEAIEKYNEAWETH-NDITYLNNRAAAEYEKGD 303

Query: 143 YDEAIKDAESAV----KVDSSY---SKGYSRLGYAKFAQGKSEEALEAYKKVL 188
           Y+ AI+    AV    ++ + Y   SK ++R+G +    G  ++A++ Y+K L
Sbjct: 304 YEAAIETLTKAVEQGRELRADYKVISKSFARMGNSYHKLGDLKKAIDYYEKSL 356

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 81.3 bits (199), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 68/104 (65%), Gaps = 1/104 (0%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPT-NAVYYANRAAAHSSLKNYDEAIKDAE 151
           A+  K EGN A   KDY+ AI  +++AI V  T N V Y+NR+AA++S K Y++A+ DA+
Sbjct: 5   ADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDAD 64

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSA 195
             +K++ S++KGY+R G A     K EEA + Y + L I+ ++A
Sbjct: 65  ECIKINPSWAKGYTRKGAALQGLHKYEEAEQCYNETLKIDPNNA 108

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 46/82 (56%)

Query: 92  KAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAE 151
           KAE  +LEG +     D+  A+K Y+E I   P +A  Y+NRAAA + L ++ +AI D  
Sbjct: 384 KAEEARLEGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCN 443

Query: 152 SAVKVDSSYSKGYSRLGYAKFA 173
            A++ D S+ + Y R    + A
Sbjct: 444 KAIEKDPSFIRAYLRKATCQIA 465

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 55/105 (52%), Gaps = 12/105 (11%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKD--- 149
           A+  K EGNKA   + ++ AI  Y++A      +  Y  NR+AA     +Y+  IK    
Sbjct: 251 ADKAKAEGNKAYKARQFDEAISHYNQAWETF-KDITYLNNRSAAEYEKGDYETCIKTLTE 309

Query: 150 -AESAVKVDSSY---SKGYSRLG--YAKFAQGKSEEALEAYKKVL 188
             E+A ++ + Y   +K ++R+G  YAK    K  +A+E Y+K L
Sbjct: 310 AVENARELRTDYKIVAKSFARMGNAYAKLDDLK--KAIEYYQKSL 352

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 78/123 (63%), Gaps = 3/123 (2%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPT-NAVYYANRAAAHSSLKNYDEAIKDAE 151
           A+  K +GN A   K+Y+ AI+ +++AI V  T + V ++NR+A ++SLK + +A+ DA 
Sbjct: 5   ADEYKQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDAN 64

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGD--SATDVMKRDYETAKRK 209
             VK++ S+SKGY+RLG A    G  +EA   YKK L+++ +  +A D +++ + T + +
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDEAESDYKKALELDANNKAAKDGLEQVHRTQQAR 124

Query: 210 VEQ 212
             Q
Sbjct: 125 QAQ 127

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 52/91 (57%)

Query: 92  KAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAE 151
           KAE  +LEG +     D+  A+K Y+E I   P +A  Y+NRAAA + L ++ EAI D  
Sbjct: 395 KAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCN 454

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALE 182
            A++ D ++ + Y R+  A+ A  +   ALE
Sbjct: 455 KAIEKDPNFVRAYIRMAAAQIAVKEFAAALE 485

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 66/130 (50%), Gaps = 10/130 (7%)

Query: 90  KSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKD 149
           K++A++ K EGNK      ++ AI+ Y+ A   +  +  Y  NRAAA     +Y+  I  
Sbjct: 259 KAEADNEKAEGNKFYKAHQFDEAIEHYNRAWE-LHKDITYLNNRAAAEYEKGDYETVIAT 317

Query: 150 AESAVK----VDSSY---SKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSATDVMK-R 201
              AV+    + + Y   SK ++R+G A    G  ++ +E Y+K L  E  +A  + K R
Sbjct: 318 LNDAVEKGRDMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSL-TEHRTADILAKLR 376

Query: 202 DYETAKRKVE 211
           + E  ++K E
Sbjct: 377 NVEKEQKKAE 386

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 69/103 (66%), Gaps = 1/103 (0%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPT-NAVYYANRAAAHSSLKNYDEAIKDAE 151
           A+  K +GN A A K Y+ A+  +++AI V  T N V Y+NR+A+++S + ++EA+KDA 
Sbjct: 5   ADEYKQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDAL 64

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDS 194
              K++ S++KGY+R G A F  G  ++A  +YKK L+++ ++
Sbjct: 65  ECTKINPSWAKGYTREGAAHFGMGNLDDAEASYKKALELDANN 107

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 47/82 (57%)

Query: 92  KAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAE 151
           KAE  +LEG +     D+  A+K Y+E I   P +A  Y+NRAAA S L ++ +AI D  
Sbjct: 384 KAEEARLEGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCN 443

Query: 152 SAVKVDSSYSKGYSRLGYAKFA 173
            A++ D ++ + Y R   A+ A
Sbjct: 444 KAIEKDPNFVRAYIRKATAQIA 465

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 56/108 (51%), Gaps = 8/108 (7%)

Query: 88  ELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAI 147
           E K  AE  K+EGNKA   ++++ AI  Y++A   +  N  Y  NR+AA      YD AI
Sbjct: 246 ESKVAAEEAKVEGNKAYKARNFDEAIACYNKAWE-LDNNITYLNNRSAAEFEKGEYDTAI 304

Query: 148 KDAESAV----KVDSSY---SKGYSRLGYAKFAQGKSEEALEAYKKVL 188
                A+    ++ + Y   +K ++R+G A    G  +EA+  Y+K L
Sbjct: 305 NTLNEAIEKGREMRADYKIIAKSFARIGNAYVKMGNLKEAINHYQKSL 352

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 63/101 (62%), Gaps = 1/101 (0%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPT-NAVYYANRAAAHSSLKNYDEAIKDAE 151
           A+  K +GN A   KDY  AI  +++AI V    N V Y+NR+A ++SLK + +A+ DA 
Sbjct: 5   ADEYKQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDAT 64

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEG 192
             VK++ S+SKGY+RLG A    G  ++A   YKK L+++ 
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDDAESNYKKALELDA 105

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 51/91 (56%)

Query: 92  KAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAE 151
           KAE  +LEG +     D+  A+K Y+E I   P +A  Y+NRAAA + L ++ EAI D  
Sbjct: 392 KAEEARLEGKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCN 451

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALE 182
            A++ D ++ + Y R   A+ A  +   ALE
Sbjct: 452 KAIEKDPNFVRAYIRKATAQIAVQEFAGALE 482

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 61/124 (49%), Gaps = 10/124 (8%)

Query: 74  QGENVKVNIPAEDAELKSKAES--LKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYA 131
           Q E  K   P E  E  SK E+   K EGNK    + +E AI+ Y++A   +  +  Y  
Sbjct: 238 QQEETKEAEPMEVDEDDSKVEADKEKAEGNKFYKARQFEEAIEHYNKAWE-LHRDITYLN 296

Query: 132 NRAAAHSSLKNYDEAIKDAESAV----KVDSSY---SKGYSRLGYAKFAQGKSEEALEAY 184
           NRAAA     +Y+ AI     AV    ++ + Y   SK ++R+G A    G  ++ ++ Y
Sbjct: 297 NRAAAEYEKGDYETAIATLTDAVEQGREMRADYKVISKSFARIGNAYHKLGDLKKTIDNY 356

Query: 185 KKVL 188
           +K L
Sbjct: 357 QKSL 360

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 62/99 (62%), Gaps = 1/99 (1%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTN-AVYYANRAAAHSSLKNYDEAIKDAE 151
           ++ LK  GNK    K YE A+  ++ A+S   TN  + Y+NRAAAH  LK+Y EA++D +
Sbjct: 8   SQELKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGK 67

Query: 152 SAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDI 190
           + V++  ++ KGYSR+G A     K +EA E +KK L +
Sbjct: 68  NCVELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKALQL 106

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 51/94 (54%)

Query: 91  SKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDA 150
            K E  ++EG +    ++Y  A+K Y+E I   PT+ V + NRAA    L    + I D 
Sbjct: 427 QKFEEARIEGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDC 486

Query: 151 ESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAY 184
           + A+ VD SY K Y R G+A+  +   +EALE +
Sbjct: 487 DKAISVDPSYIKAYVRKGFAQITERDLDEALETW 520

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 56/129 (43%), Gaps = 8/129 (6%)

Query: 72  SSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYA 131
           S   E  +  +  E+ E K +A+  K  GN     ++++ AI  Y++A +    +  Y  
Sbjct: 274 SQMKEKSQQKLSPEETEKKRRADEEKRIGNDLYKKRNFKEAIIHYTKAWNTF-QDITYLN 332

Query: 132 NRAAAH-------SSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAY 184
           N  AA        + LK+  +A+  AE         +K Y R+G A       E A+ AY
Sbjct: 333 NIGAAQFERGDYGNVLKSLGQAVFFAEHTNPEPQVLAKSYIRMGNAYHRIWDHEHAITAY 392

Query: 185 KKVLDIEGD 193
           +  L + G+
Sbjct: 393 EYGLMLNGN 401

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 49/78 (62%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAES 152
           A   K EGN  +  +DY+ AI+ Y++AI +  T++++Y+NRA AH  L N+  A+ D   
Sbjct: 12  ALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCND 71

Query: 153 AVKVDSSYSKGYSRLGYA 170
           A+K+D++  K Y R G A
Sbjct: 72  AIKLDNNNIKAYHRRGLA 89

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 69/127 (54%), Gaps = 5/127 (3%)

Query: 86  DAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDE 145
           D EL   A S K EGNK +  +D++ A + Y++AI   PT +++Y+NRA A+  L N+  
Sbjct: 5   DTEL---ATSYKDEGNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMN 61

Query: 146 AIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSATDVMKRDYET 205
           A+ D  +A++++SS  K Y R G A       + A   +  VL  + +    + K  ++T
Sbjct: 62  ALNDCTNAIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIVLKYKPNDI--IAKNGFDT 119

Query: 206 AKRKVEQ 212
            ++ + +
Sbjct: 120 CEKVIRE 126

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 64/116 (55%), Gaps = 7/116 (6%)

Query: 93  AESLKL--EGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDA 150
           AE+LKL  EGN  +  +D+  AI  Y++AI +  T ++Y++NRA AH  L N+  ++ D 
Sbjct: 10  AEALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDC 69

Query: 151 ESAVKVDSSYSKGYSR-----LGYAKFAQGKSEEALEAYKKVLDIEGDSATDVMKR 201
           + A+K+D   +K Y R     +G  +F + K++  +    K  D     A DV ++
Sbjct: 70  DEALKLDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIVLKAKPGDATASRALDVCEK 125

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 60/110 (54%)

Query: 87  AELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEA 146
           A+ K +A + K EGN  +  ++Y  AI+ YS+AI + PT +++++NRA A   L N+   
Sbjct: 6   ADAKEQAVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSC 65

Query: 147 IKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSAT 196
           + D + A+++D    K Y R G +     + ++A    + VL  +   AT
Sbjct: 66  MNDCDVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVVLKAKPTDAT 115

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 47/77 (61%)

Query: 90  KSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKD 149
           ++KA   K EGN  +  K +  AI+KY+EAI +  T ++Y++NRA AH  + N+  A+ D
Sbjct: 9   RAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALND 68

Query: 150 AESAVKVDSSYSKGYSR 166
            + A+K+D    K Y R
Sbjct: 69  CDEAIKLDPKNIKAYHR 85

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 48/72 (66%)

Query: 99  EGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDS 158
           +GNK +A KDY  AI+ Y++AI +    +++++NRA A+  L  +  A++D+  A+++DS
Sbjct: 15  QGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIELDS 74

Query: 159 SYSKGYSRLGYA 170
           S  KGY R G A
Sbjct: 75  SNVKGYHRRGMA 86

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 45/77 (58%)

Query: 90  KSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKD 149
           + KA   K EGN  +  K +  AI+KY+EAI +  T  +Y++NRA +H  + N+  A+ D
Sbjct: 9   RVKAHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALND 68

Query: 150 AESAVKVDSSYSKGYSR 166
            + A+K+D    K Y R
Sbjct: 69  CDEAIKLDPKNIKAYHR 85

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (60%)

Query: 91  SKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDA 150
           +KA   K EGN  +  K +  AI+KY+EAI +  T ++Y++NRA AH  + N+  A+ D 
Sbjct: 10  AKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDC 69

Query: 151 ESAVKVDSSYSKGYSR 166
           + A+K+D    K Y R
Sbjct: 70  DEAIKLDPKNIKAYHR 85

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 64/122 (52%), Gaps = 2/122 (1%)

Query: 91  SKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDA 150
           +KA   K  GN A+  +DY  AI+ Y+EAI +  T ++Y++NRA  H  + N+   I D 
Sbjct: 10  AKALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDC 69

Query: 151 ESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKV 210
           + A+++D    K Y R G +     + + A +  K VL  + + AT   KR  +  ++ +
Sbjct: 70  DKALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIVLASKPNDAT--AKRGLDVCEKFI 127

Query: 211 EQ 212
            +
Sbjct: 128 RE 129

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 67/129 (51%), Gaps = 7/129 (5%)

Query: 91  SKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDA 150
           +KA   K +GN  + GK++  A + YS+AI +  T ++Y++NRA AH  L N+  A+ D 
Sbjct: 10  NKALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDC 69

Query: 151 ESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGD-----SATDVMKRDYET 205
             A+++D    K Y R G +     +  +A +  K VL  + +      A DV +R    
Sbjct: 70  NKAIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIVLRAKPNEPVATRALDVCER--VI 127

Query: 206 AKRKVEQAL 214
            K K E+A+
Sbjct: 128 RKEKFEKAI 136

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 45/79 (56%)

Query: 92  KAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAE 151
           KA   K EGN  +  +DY  AI+KY +AI +  T +VY++NRA  H  L N+  A +D +
Sbjct: 8   KALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCD 67

Query: 152 SAVKVDSSYSKGYSRLGYA 170
            A+ +D    K Y R G A
Sbjct: 68  KALALDPKNVKAYHRRGLA 86

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 64/120 (53%), Gaps = 5/120 (4%)

Query: 87  AELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEA 146
            E   +A  LK EGNK +  K Y  A++ Y++AI +  T +++++NRA A   L N+   
Sbjct: 7   TEAAQQAIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSC 66

Query: 147 IKDAESAVKVD-----SSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSATDVMKR 201
           + D  SA+++D     + + +G S+LG   F + K++ ++    K  D     A D+ ++
Sbjct: 67  LDDCNSALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIVLKAKPSDATAKRALDMCEK 126

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 47/84 (55%)

Query: 87  AELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEA 146
           AE  +KA   K EGN  +  ++Y  AI+ Y++AI + P  +++Y+NRA A   L N+  A
Sbjct: 6   AEDIAKAVEFKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSA 65

Query: 147 IKDAESAVKVDSSYSKGYSRLGYA 170
             D   A+ +DS   K Y R G A
Sbjct: 66  YNDCNEALTLDSKNVKAYHRRGLA 89

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 9/106 (8%)

Query: 66  AGAGAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPT 125
           AG+G PS          P  D+   + A   K EGN+ +  KDY  A++ Y+ AI    T
Sbjct: 20  AGSGHPSP---------PRRDSMTAATALDYKNEGNEWVKAKDYARAVEAYTRAIEADGT 70

Query: 126 NAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAK 171
            +++++NRA A+  L  +  A++D+  A+++D+   K Y R G A 
Sbjct: 71  QSIFFSNRALANLKLDRFQSALEDSARAIELDAGNVKAYHRRGLAH 116

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 46/77 (59%)

Query: 90  KSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKD 149
           ++ A   K EGN  +  K +  AI+KY++AI +  T ++Y++NRA AH  + N+  A+ D
Sbjct: 9   RANALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALND 68

Query: 150 AESAVKVDSSYSKGYSR 166
            + A+K+D    K Y R
Sbjct: 69  CDEALKLDPKNIKAYHR 85

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 69/121 (57%), Gaps = 4/121 (3%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAES 152
           A +LK +GN+    KD+E AI+ Y+ AIS+   + V+Y+NR+AA+ S+ N+++ ++D  +
Sbjct: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTA 162

Query: 153 AVKVDSSYSKGYSRLGYAKFAQGKSEEA---LEAYKKVLDIEGDSATDVMKRDYETAKRK 209
           A+K+   YSK + R   A    G+  +A   L A   + +  G S   +++R+      K
Sbjct: 163 ALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVSLLGEYSGQSVEQLLERNMNKQATK 222

Query: 210 V 210
           V
Sbjct: 223 V 223

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 47/76 (61%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAES 152
           A   K +GN+ +   DY+ AI+ YS+AI++  T ++Y++NRA AH    N+  A+ D ++
Sbjct: 12  ALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDN 71

Query: 153 AVKVDSSYSKGYSRLG 168
           A+K+D    K Y R G
Sbjct: 72  ALKLDPKNIKAYHRRG 87

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 63/128 (49%), Gaps = 7/128 (5%)

Query: 75  GENV---KVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVV----PTNA 127
           GENV    +   A D E    AE+ K +GN+    K Y+ A + Y++ I +       N 
Sbjct: 57  GENVGLEALKALAYDGEPHEVAENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINE 116

Query: 128 VYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKV 187
             ++NRAA    LKNY   + D   A++ + +  K + R+  A F   K E+A EA +  
Sbjct: 117 SLFSNRAACELELKNYRRCVNDCRQALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIEFG 176

Query: 188 LDIEGDSA 195
           L ++ +SA
Sbjct: 177 LKLDSESA 184

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 45/75 (60%)

Query: 92  KAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAE 151
           KA  LK EGNK +  K Y  A + Y++AI   P N + Y+NRA  +  L N+  ++ DA+
Sbjct: 12  KALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAK 71

Query: 152 SAVKVDSSYSKGYSR 166
            A+++D++  K Y R
Sbjct: 72  RAIELDNNNLKAYHR 86

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 58/121 (47%), Gaps = 12/121 (9%)

Query: 67  GAGAPSSQGENVKV---NIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISV- 122
           GAG     GENV++      A + E    AE+ K +GN+    K ++ A + YS+ ++V 
Sbjct: 59  GAG-----GENVELEALKALAYEGEPHEIAENFKKQGNELYKAKRFKDARELYSKGLAVE 113

Query: 123 ---VPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEE 179
                 N   YANRAA    LKNY   I+D   A+ ++    K Y R   A F   K EE
Sbjct: 114 CEDKSINESLYANRAACELELKNYRRCIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEE 173

Query: 180 A 180
           A
Sbjct: 174 A 174

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 63/128 (49%), Gaps = 7/128 (5%)

Query: 75  GENVKV---NIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVV----PTNA 127
           GEN+K+      A + E    AE+ K +GN     + Y+ A + Y++ + V       N 
Sbjct: 59  GENLKLEALKALAYEGEPHEIAENFKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINE 118

Query: 128 VYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKV 187
             + NRAA    LKN+   I D + A++ +    K + R+G A F+  K EEA EA +  
Sbjct: 119 SLFLNRAACELELKNHRRCINDCKEALRYNPKNVKCFYRMGRAFFSLNKLEEAKEAIEFG 178

Query: 188 LDIEGDSA 195
           L  + ++A
Sbjct: 179 LRFDSNNA 186

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 61/116 (52%), Gaps = 5/116 (4%)

Query: 91  SKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDA 150
           +KA   K +GN  +  +D+  A + Y++AI +  T +++++NRA AH    N+  ++ D 
Sbjct: 10  AKALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDC 69

Query: 151 ESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVL-----DIEGDSATDVMKR 201
           + A+++DS   K Y R G +     + ++A    K VL     D+  D A  + ++
Sbjct: 70  DKALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTVLKSKPGDVAADRALQICEK 125

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 49/83 (59%), Gaps = 8/83 (9%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAES 152
           A +LK +GN     KD+E AIK Y+ A+S+   + VYY+N +A +SSL NY++ I+ A  
Sbjct: 95  AGALKEKGNALFKKKDFENAIKYYTFALSL-KEDPVYYSNISACYSSLLNYEKVIEMATK 153

Query: 153 AVKVDSSYSK-------GYSRLG 168
           A+ +   YSK        Y +LG
Sbjct: 154 ALALRPDYSKVLVRRANAYEKLG 176

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 56/113 (49%), Gaps = 7/113 (6%)

Query: 75  GENVKV---NIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISV----VPTNA 127
           GENV++      A + E    AE+ K +GN+    K ++ A + Y++ I+V       N 
Sbjct: 62  GENVELEALKALAYEGEPHEIAENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINE 121

Query: 128 VYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEA 180
             +ANRAA    LKNY   I+D   A+ ++    K Y R   A F+  K EEA
Sbjct: 122 SLFANRAACELELKNYRRCIEDCSKALTINPKNIKCYYRTSKAFFSLSKLEEA 174

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 68/144 (47%), Gaps = 13/144 (9%)

Query: 75  GENVKV---NIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISV---VPT-NA 127
           GENV++      A + E    AE+ K +GN     K +  A + YS+ I V   V T N 
Sbjct: 60  GENVELEALKALAYEGEPHEIAENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINE 119

Query: 128 VYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKV 187
             YANRAA    +KNY   I D + A++++    K Y R+  A  A  + +EALE+    
Sbjct: 120 SLYANRAACELEIKNYRRCINDCKQALQLNPKNIKCYYRIAKAFTALERLDEALES---- 175

Query: 188 LDIEGDSATDVMKRDYETAKRKVE 211
             IE     D   +  +T K  +E
Sbjct: 176 --IEFGEKIDNTNKSLKTLKLHIE 197

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 64/120 (53%), Gaps = 5/120 (4%)

Query: 87  AELKSK-AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDE 145
           AE K K A  LK +GN+    K +E A+K YS AI V   + V+Y+NR+A + SL   ++
Sbjct: 89  AEEKDKFAMGLKDKGNEFFKNKQFEDALKYYSLAIEV-KEDPVFYSNRSACYVSLGQQEK 147

Query: 146 AIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEA---LEAYKKVLDIEGDSATDVMKRD 202
            ++D  +A+K+   YSK   R   A  + GK  +A   L A     D  G S   +++R+
Sbjct: 148 VVEDTTAALKLKPDYSKCLLRRASANESLGKFADAMFDLSAVSLYGDFNGSSIEPLLERN 207

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 64/138 (46%), Gaps = 15/138 (10%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAIS----VVPTNAVYYANRAAAHSSLKNYDEAIK 148
           AE+ K +GN     K +  A + Y++ I     V   N   YANRAA    LKN+   I 
Sbjct: 78  AENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCIS 137

Query: 149 DAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSAT-----DVMK--- 200
           D ++A+  +    K Y R+G A  A  K E A E+ +    I+ D+ +     +++K   
Sbjct: 138 DCKTALTYNPKNIKCYFRMGKAFTAINKFESARESIEFGQKIDNDNKSFENLLNIIKNKE 197

Query: 201 ---RDYETAKRKVEQALE 215
              R YE  K K +Q  E
Sbjct: 198 EEIRKYEEKKLKAQQDRE 215

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 72/155 (46%), Gaps = 11/155 (7%)

Query: 72  SSQGENVKV---NIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNA- 127
           ++ GENV++      A D E    AE+ K +GN     K +  A   Y++ I V   +A 
Sbjct: 53  AASGENVELEALKALAYDGEPHEVAENFKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAG 112

Query: 128 ---VYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEA- 183
              +   NRAA    LKNY   I D   A+K++    K + R+G A     K EEA EA 
Sbjct: 113 ISELLLLNRAACELELKNYRRCINDCREALKLNPKNPKAFFRIGKAFLQLDKLEEAAEAV 172

Query: 184 -YKKVLDIEGDSATDVMK--RDYETAKRKVEQALE 215
            +   +D E ++   ++      + A+ + EQ LE
Sbjct: 173 DFGLRVDTENEALLSLLSAISKKQKARHEHEQKLE 207

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 57/116 (49%), Gaps = 7/116 (6%)

Query: 75  GENVKV---NIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVV----PTNA 127
           GENV++      A + E    AE+ K + N     K +  A + Y++ I V       N 
Sbjct: 64  GENVELEALKALAYEGEPHEIAENFKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINE 123

Query: 128 VYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEA 183
             +ANRAA    LKNY   + D + A++++    K + R+G A  A GK +EA +A
Sbjct: 124 SLFANRAACELELKNYRSCVADCQKAMEINPMNLKCFYRMGKAFLALGKFKEAHDA 179

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 63/133 (47%), Gaps = 13/133 (9%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISV----VPTNAVYYANRAAAHSSLKNYDEAIK 148
           A + K +GN    GK ++ A   Y +A+ V    +  N   Y N AA    +KNY   I 
Sbjct: 70  ATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCIN 129

Query: 149 DAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDS---------ATDVM 199
               A+K+++   K + R+G A    G+ E++LEA +  L ++ ++         AT+ +
Sbjct: 130 YCREALKLNAKNVKAFFRIGKAYLELGRFEDSLEAVQVGLAVDPENGALKSIQSKATEKL 189

Query: 200 KRDYETAKRKVEQ 212
           KR  E   R + Q
Sbjct: 190 KRKKELENRTLAQ 202

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 66/126 (52%), Gaps = 15/126 (11%)

Query: 75  GENVKVNIPAEDAELK-SKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANR 133
           GE +  NI     EL+ + A +LK  GN+    KDY+ A+K Y+ A+ VV  + V+Y+N 
Sbjct: 82  GEPLLENIEELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYAL-VVKKDPVFYSNI 140

Query: 134 AAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYK------KV 187
           +A + SL   D+ ++++  A+++   YSK   R       +  + E+LE Y        V
Sbjct: 141 SACYVSLGQLDKVVENSTKALELKPDYSKALLR-------RASANESLENYADAMFDLSV 193

Query: 188 LDIEGD 193
           L + GD
Sbjct: 194 LSLNGD 199

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 60/121 (49%), Gaps = 12/121 (9%)

Query: 67  GAGAPSSQGENVKV---NIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISV- 122
           GAG     GENV++      A + E    AE+ K +GN+    K ++ A + Y++ ++V 
Sbjct: 59  GAG-----GENVELEALKALAYEGEPHEIAENFKKQGNELYKAKRFKDARELYTKGVAVE 113

Query: 123 ---VPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEE 179
                 N   +ANRAA    LKNY + ++D   A+ ++    K Y R+  + F   K EE
Sbjct: 114 CEDKSINESLFANRAACELELKNYRKCVEDCGKALTINPKNIKCYYRISKSFFQLRKLEE 173

Query: 180 A 180
           A
Sbjct: 174 A 174

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 54/96 (56%), Gaps = 5/96 (5%)

Query: 88  ELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAI 147
           E   KA   K +GN  +  K Y  A++ YS+AI +  T +++++NRA +   L N+  A+
Sbjct: 7   EAAQKALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTAL 66

Query: 148 KDAESAVKVD-----SSYSKGYSRLGYAKFAQGKSE 178
           +D   ++++D     + + +G S +G  +F++ + +
Sbjct: 67  EDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKD 102

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 45/95 (47%), Gaps = 4/95 (4%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVV----PTNAVYYANRAAAHSSLKNYDEAIK 148
           AE+ K +GN     K +  A   Y++ I +       N   +ANRAA    LKNY   I 
Sbjct: 80  AENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCIN 139

Query: 149 DAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEA 183
           D + A+ ++    K Y R+G A +     EEA E+
Sbjct: 140 DCKHALTLNPKNIKCYYRMGKAFYLLNNIEEAKES 174

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAES 152
           A  LK +GN+    K Y+ AI+ YS AI V   + V+Y+NR+A + SL   ++ ++D  +
Sbjct: 95  AMGLKDKGNEFFKNKKYDEAIQYYSWAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDTTA 153

Query: 153 AVKVDSSYSKGYSR 166
           A+K+   YSK   R
Sbjct: 154 ALKLKPDYSKCLLR 167

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 53/96 (55%), Gaps = 5/96 (5%)

Query: 88  ELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAI 147
           E   +A   K +GN  +  K Y+ A++ YS+AI +  T ++Y++NRA +   L N+  A 
Sbjct: 5   EAAQQALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQ 64

Query: 148 KDAESAVKVD-----SSYSKGYSRLGYAKFAQGKSE 178
           +D + A+ +D     + + +G S +G  +F + + +
Sbjct: 65  EDCDKAIALDPKNIKAIHRRGLSYVGLLEFFKARKD 100

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 67/137 (48%), Gaps = 11/137 (8%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVV----PTNAVYYANRAAAHSSLKNYDEAIK 148
           A + K  GN+    K Y  A + Y++ I V       N   YANRAA    LKN+ + I+
Sbjct: 74  AGNFKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIE 133

Query: 149 DAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEA--YKKVLDIEGDSATDVM----KRD 202
           D + A+  +    K Y R+G A  +  + +E+ E+  +   +D E  S  +++    KR 
Sbjct: 134 DCKKALSFNVKNIKCYYRMGKAFLSVDRFDESKESIEFGLKIDSENKSLKNLLQAIEKRQ 193

Query: 203 YETAKRK-VEQALELNK 218
            E  +RK +E  ++L K
Sbjct: 194 LEIQRRKDMEMKIKLEK 210

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 5/96 (5%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISV-----VPTNAVYYANRAAAHSSLKNYDEAI 147
           AE+ K +GN     K ++ A   Y + I +     V      +AN+AA    LKN+   I
Sbjct: 76  AENFKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACELELKNFRRCI 135

Query: 148 KDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEA 183
            D ++A++++    K Y R+  A FA  K EEA E+
Sbjct: 136 NDCKNALQLNPKNVKCYFRMTRAFFALDKLEEAKES 171

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 8/96 (8%)

Query: 71  PSSQGENVKVNIPAEDAELKSKA----ESLKLEGNKAMAGKDYELAIKKYSEAISVVPTN 126
           P  Q  N + N+   +  L+ K     +  K  GN+     +Y+LAI++Y + IS+ PTN
Sbjct: 9   PGHQDVNRQRNLKHWNNGLQDKLTMSFQHFKDIGNEHFKKGEYDLAIEQYRKCISLEPTN 68

Query: 127 AVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSK 162
           AV Y+N A A+  LKN      +A++A ++  SY K
Sbjct: 69  AVGYSNLAMAY--LKN--RCPDEAKTACEMGLSYCK 100

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 46/101 (45%), Gaps = 4/101 (3%)

Query: 84  AEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVV----PTNAVYYANRAAAHSS 139
           A + E    A + K +GN     K Y+ A   YS+ I V       N   Y NRAA    
Sbjct: 70  AYEGEPHEVAANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELE 129

Query: 140 LKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEA 180
           L+N+   I D + A+  ++   K + R+G A F   K EEA
Sbjct: 130 LRNFRSCINDCKKALNFNAKCVKAFYRMGQAYFKLKKLEEA 170

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 62/111 (55%), Gaps = 3/111 (2%)

Query: 84  AEDAELKSK-AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKN 142
           A +  LKSK A+ LK +GN+    KD E AIK Y  A+ +   + V+Y+N +A + ++  
Sbjct: 148 ANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALRL-DQDPVFYSNISACYFAMNQ 206

Query: 143 YDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGD 193
            D+ I+ +  A+++   YSK   R   A  A G ++EAL  +  +L + G+
Sbjct: 207 LDKVIESSNKALELKPDYSKALLRRANAYEALGNNKEALYDF-SILSLFGE 256

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 61/118 (51%), Gaps = 16/118 (13%)

Query: 82  IPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLK 141
           +P E  E K  +  LK +GNK    KDY  AIK Y+ A+ +   + ++Y+N +A + SL 
Sbjct: 113 LPLE--EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDL-NKDPIFYSNISACYVSLG 169

Query: 142 NYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYK------KVLDIEGD 193
             D+ I+ +  A++++ +YSK   R       +  + E+LE Y        VL + GD
Sbjct: 170 QLDKVIESSTKALELNPNYSKALLR-------RASANESLENYSDALFDLSVLSLNGD 220

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 84  AEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNY 143
           AE AE    A  LK  GN     KDYE AI  Y  A+ +   + V+Y+N AA + SL++ 
Sbjct: 77  AETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHN 135

Query: 144 DEAIKDAESAVKVDSSYSK 162
            EAI+    A++++  YSK
Sbjct: 136 KEAIEACSKALELNPDYSK 154

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 46/90 (51%), Gaps = 10/90 (11%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAES 152
           AE LK++GN      DYE AI  Y +A ++  +N +Y++N A A   L+ + EA+   + 
Sbjct: 41  AEDLKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACD- 99

Query: 153 AVKVDSSYSKGYSRLGYAKFAQGKSEEALE 182
                    KG +++ +      K+++ LE
Sbjct: 100 ---------KGLNKVSFKTGMDSKTKQKLE 120

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 67/141 (47%), Gaps = 10/141 (7%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAES 152
           A  LK +GN     K+++ AIK Y  AI + P + V+Y+N +A + S  + ++ ++    
Sbjct: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184

Query: 153 AVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGD----SATDVMKRDYETAKR 208
           A+++   +SK   R   A  + G   +A+     VL + GD    S   +++R+      
Sbjct: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGDFDGASIEPMLERNLNKQAM 243

Query: 209 KVEQALELNKTDETETSDRGT 229
           KV     LN      + DRG+
Sbjct: 244 KV-----LNANLSKNSGDRGS 259

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 64/139 (46%), Gaps = 6/139 (4%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISV----VPTNAVYYANRAAAHSSLKNYDEAIK 148
           A + K +GN     K ++ A + Y++ I +       N   YANRAA    +KNY   + 
Sbjct: 78  AGNFKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLN 137

Query: 149 DAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKR 208
           D ++A++ +    K Y R+G A  A    EEA ++ +    ++ DS+   ++   +   +
Sbjct: 138 DCKTALQYNPKNLKCYYRMGKAFLALELLEEAQKSVE--FGLQVDSSNKPLQSLLDIVLK 195

Query: 209 KVEQALELNKTDETETSDR 227
           K E   E N   E E   R
Sbjct: 196 KQEAKKEQNSKKEQEKQIR 214

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%)

Query: 94  ESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESA 153
           E LK +GN +     Y  AI  Y+  IS+ P+N + Y+N+A A      +DEAI   E  
Sbjct: 4   EELKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKG 63

Query: 154 VKVDS 158
           +++ S
Sbjct: 64  LQLIS 68

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 54/113 (47%), Gaps = 6/113 (5%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVV----PTNAVYYANRAAAHSSLKNYDEAIK 148
           A + K +GN     K +  A + Y++AI V       N   YANRAA    LKNY   I 
Sbjct: 74  AGNFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCIN 133

Query: 149 DAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVL--DIEGDSATDVM 199
           D + A+ ++    K Y R+  A  A  K ++  EA +  L  D+E  S  +++
Sbjct: 134 DCKMALSLNPKNIKCYFRMAKAFLAIEKFDDCKEAIQFGLKFDLENKSLLNLL 186

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAES 152
           A +LK +GN+    + YE AIK Y  A+ +   + V+Y+NR+A +  L   ++ ++D  +
Sbjct: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKL-KEDPVFYSNRSACYVPLNKLEKVVEDTTA 153

Query: 153 AVKVDSSYSKGYSR 166
           A+K+   YSK   R
Sbjct: 154 ALKLKPDYSKCLLR 167

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 56/121 (46%), Gaps = 12/121 (9%)

Query: 67  GAGAPSSQGENVKV---NIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVV 123
           GAG     GENV++      A + E    A   K +GN+    K ++ A + Y + ++V 
Sbjct: 59  GAG-----GENVELEALKALAYEGEPHEIAGGFKKQGNELYKAKRFKDARELYIKGLNVE 113

Query: 124 P----TNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEE 179
                 N   +AN+AA    LKNY   I+D   A+ ++   +K Y R   A F   K EE
Sbjct: 114 CEDKFINESLFANKAACELELKNYRRCIEDCSKALSINPKNTKCYYRTSKAFFQLNKLEE 173

Query: 180 A 180
           A
Sbjct: 174 A 174

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 96  LKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVK 155
           LK +GN+    KDYE A+K Y  A+ ++  + V+Y+N +A + SL   D+ I+ +  A++
Sbjct: 111 LKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALE 169

Query: 156 VDSSYSKGYSR 166
           +   YSK   R
Sbjct: 170 LKPDYSKALLR 180

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 45/74 (60%), Gaps = 1/74 (1%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAES 152
           A  LK +GN+    K ++ AIK Y+ A+ +   + V+Y+NR+A + S+   ++ ++D  +
Sbjct: 102 AMGLKDKGNEFFKEKKFDDAIKYYNLALEL-KKDPVFYSNRSACYVSMGQLEKVVEDTTA 160

Query: 153 AVKVDSSYSKGYSR 166
           A+K+ S YSK   R
Sbjct: 161 ALKLKSDYSKCLLR 174

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 79/173 (45%), Gaps = 9/173 (5%)

Query: 63  LLSAGAGAPSSQGENVKV---NIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEA 119
            +S   G     G+NV++      A + E    AE+ K +GN     K Y+ A + Y+  
Sbjct: 45  FMSKLDGTDGEGGQNVELEALKALAYEGEPHEVAENFKNQGNDLYRAKRYKDAREIYNRG 104

Query: 120 ISV----VPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQG 175
           I +       N   ++NRAA    LKNY   + D + A++ +    K Y R+  A     
Sbjct: 105 IDIKCDDSKVNESLFSNRAACELELKNYRRCVNDCKRALQYNVKNIKCYYRIAKAFLLLN 164

Query: 176 KSEEALEAYKKVLDIEGDS-ATDVMKRDYETAKRKVEQALELNKTDETETSDR 227
           K E+A +A +  L ++ ++ A + ++++ +  K+  + A E  K  E    +R
Sbjct: 165 KLEDAKQAAEFGLKLDPENQALNALRQNVDKKKQDAD-AFEAKKLKEQTERER 216

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 50/89 (56%), Gaps = 1/89 (1%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAES 152
           A +LK +GN+      +E AIK Y  A+ +   + +YY+N +A ++SL  Y++ I+ A  
Sbjct: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKL-KDDPIYYSNISACYASLLQYEKVIEYATK 168

Query: 153 AVKVDSSYSKGYSRLGYAKFAQGKSEEAL 181
           A+K+  ++SK   R   A  A G   +A+
Sbjct: 169 ALKLRPTFSKVLMRRALAYEAMGNFGDAM 197

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 42/72 (58%), Gaps = 1/72 (1%)

Query: 95  SLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAV 154
           ++K +GN+    K YE AIK YS A+ +   + V+Y+NR+A    L   ++ ++D  +A+
Sbjct: 100 AMKDKGNECFKEKKYEEAIKYYSCALRL-KKDPVFYSNRSACWVPLNKLEKVVEDTTAAL 158

Query: 155 KVDSSYSKGYSR 166
           ++   YSK   R
Sbjct: 159 ELKPDYSKCLLR 170

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 50/101 (49%), Gaps = 1/101 (0%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAES 152
           A  LK +GN     K +  AIK Y  AI + P + V+Y+N +A + S  + D+ ++    
Sbjct: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190

Query: 153 AVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGD 193
           A+++   +SK   R   A  + G   +A+     VL + GD
Sbjct: 191 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 48/80 (60%), Gaps = 2/80 (2%)

Query: 88  ELKSK-AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEA 146
           ELK K A +LK +GN     +D+E A+K Y+ A+++   + V+Y+N +A + SL   ++ 
Sbjct: 99  ELKEKYAMALKDKGNDYFKKQDFENALKYYNYALTL-KQDPVFYSNISACYVSLGQLEKV 157

Query: 147 IKDAESAVKVDSSYSKGYSR 166
           ++ +  A+K+   YSK   R
Sbjct: 158 VESSTEALKLKHDYSKALLR 177

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 58/109 (53%), Gaps = 14/109 (12%)

Query: 91  SKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDA 150
           S + +LK +GN+    KDY+ A+K Y  A+++   + V+Y+N +A + S+   D+ ++++
Sbjct: 104 SWSTALKDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMNQLDKVVENS 162

Query: 151 ESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYK------KVLDIEGD 193
             A+++   YSK   R       +  + E+LE Y        VL + GD
Sbjct: 163 TKALELKPDYSKALLR-------RASANESLENYPDAMFDLSVLSLNGD 204

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 51/104 (49%), Gaps = 1/104 (0%)

Query: 90  KSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKD 149
           ++ A  LK  GN     K++  AIK Y  AI + P   V+Y+N +A + S  + ++ I+ 
Sbjct: 124 QAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEF 183

Query: 150 AESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGD 193
              A+++   +SK   R   A  + G   +A+     VL + GD
Sbjct: 184 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 34/71 (47%)

Query: 124 PTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEA 183
           P   V   NRAA    L   D A+ DA   + VD+   KGY R G      G+ EEAL+ 
Sbjct: 67  PRFFVLLDNRAATFEKLNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRYEEALQV 126

Query: 184 YKKVLDIEGDS 194
           Y+  L   G++
Sbjct: 127 YENGLKQAGEA 137

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 72/149 (48%), Gaps = 7/149 (4%)

Query: 48  KGSSSAAFGGKNLAELLSAGAGAPSSQGE---NVKVNIPAEDAELKSKAESLKLEGNKAM 104
           KGS   A G K  A    A     SS GE   + K N  AE+ +    A +LK +GN+  
Sbjct: 53  KGSQKKAEGSKKTASESKAPVYPVSSNGEPDFSKKANFTAEEKD--KYALALKDKGNQYF 110

Query: 105 AGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGY 164
             K Y+ AIK Y+ A+ +   + V+Y+N +A + S+ +  + ++ +  A+++   YSK  
Sbjct: 111 RNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVL 169

Query: 165 SRLGYAKFAQGKSEEALEAYKKVLDIEGD 193
            R   A    G   +A+     VL + GD
Sbjct: 170 LRRASANEGLGNFADAMFDL-SVLSLNGD 197

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 59/116 (50%), Gaps = 13/116 (11%)

Query: 116 YSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQG 175
           + +A+ + P N+  Y +R   +  L+NYD+A KD + A ++D      Y +L    + + 
Sbjct: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445

Query: 176 KSE--EAL--EAYKK------VLDIEGDSATDVMKRDYETAKRKVEQALEL-NKTD 220
           K +  E L  EA +K      V +   +  TD  K D++ A ++ + A+EL NK D
Sbjct: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTD--KNDFDKALKQYDLAIELENKLD 499

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 50/105 (47%), Gaps = 14/105 (13%)

Query: 95  SLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAV 154
           +LK +GN       +E AIK Y+ AI +   N ++Y+N +A + SL   +E IK    A+
Sbjct: 113 ALKDKGNSLFKADKFEEAIKYYNWAIEL-KENPIFYSNLSACYVSLNKLEEIIKYCNKAL 171

Query: 155 KVDSSYSKGYSRLGYAKFAQGKSEEALEAYK------KVLDIEGD 193
           ++   YSK   R       +  + E LE Y        VL + GD
Sbjct: 172 ELKPDYSKVLLR-------RANANEKLENYADAMFDLSVLSLNGD 209

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%)

Query: 94  ESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESA 153
           ++LK +GN      DYE A+  Y +AI+  P+N + Y+N A     L+ + EA+      
Sbjct: 5   DTLKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKG 64

Query: 154 VKV 156
           +K+
Sbjct: 65  LKM 67

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 44/95 (46%), Gaps = 4/95 (4%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVV----PTNAVYYANRAAAHSSLKNYDEAIK 148
           AE+ K +GN+A   K Y  A   Y   I V       N + + N+AA    +KNY   I 
Sbjct: 74  AENFKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRSCIN 133

Query: 149 DAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEA 183
           D + A+  +    K Y R+  A  A  K +E+ E+
Sbjct: 134 DCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRES 168

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 41/85 (48%), Gaps = 4/85 (4%)

Query: 107 KDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSR 166
           K+Y   I    +A+S  P N   Y   A A S+++ YDE+ +  E  +KVDS  S   S 
Sbjct: 126 KNYRSCINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRESIEFGLKVDSRNS---SL 182

Query: 167 LGYAKFAQGKSEEALEAYKKVLDIE 191
           L   K    K EE   AY+  L+ E
Sbjct: 183 LNLLKTIIKKQEEK-TAYRLKLERE 206

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 53/104 (50%), Gaps = 1/104 (0%)

Query: 90  KSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKD 149
           ++ A  LK +GN     K++  AIK Y  AI + P + V+Y+N +A + S  + ++ ++ 
Sbjct: 121 QTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEY 180

Query: 150 AESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGD 193
              A+++   +SK   R   A  + G   +A+     VL + GD
Sbjct: 181 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223

 Score = 36.6 bits (83), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 39/77 (50%)

Query: 125 TNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAY 184
           T AV   N+     + KN+ EAIK  + A+++D +    YS +     + G   + LE  
Sbjct: 122 TYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYT 181

Query: 185 KKVLDIEGDSATDVMKR 201
            K L+I+ D +  +++R
Sbjct: 182 TKALEIKPDHSKALLRR 198

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 47/102 (46%)

Query: 89  LKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIK 148
           + +K E+    GN     KD++ AIK + +A  + P  A  Y  +   HSS  + D A  
Sbjct: 547 MPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKT 606

Query: 149 DAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDI 190
               A+  DS +   Y  LG +    G+ EEAL  ++K   I
Sbjct: 607 CYRKALACDSQHYNAYYGLGTSSMKLGQYEEALLYFEKARSI 648

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 54/119 (45%), Gaps = 2/119 (1%)

Query: 100 GNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSS 159
           G  +M    YE A+  + +A S+ P N V       +   L   ++A++  E A  +  +
Sbjct: 626 GTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPT 685

Query: 160 YSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSATD--VMKRDYETAKRKVEQALEL 216
            S    ++G   ++  +   AL+ +++++ +  D AT   ++ + Y    RK +   EL
Sbjct: 686 SSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDATAHYLLGQTYRIVGRKKDAIKEL 744

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%)

Query: 94  ESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEA 146
           E  K++GN A    ++  A+  Y +AI+  PTN V Y+N A A   L NY +A
Sbjct: 5   EEFKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNYADA 57

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 42/91 (46%)

Query: 100 GNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSS 159
           GN     KD+E AIK + +A  V P  A  Y  +   HSS  ++D A      A+  D  
Sbjct: 542 GNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQ 601

Query: 160 YSKGYSRLGYAKFAQGKSEEALEAYKKVLDI 190
           +   Y  LG +    G+ +EAL  ++K   I
Sbjct: 602 HYNAYYGLGMSCMKLGQYDEALLHFEKARSI 632

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 34/67 (50%)

Query: 96  LKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVK 155
           LK EGN      DY  A   Y + I + PTN + Y+N+A +     N+  A++  +  +K
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLK 65

Query: 156 VDSSYSK 162
             SS +K
Sbjct: 66  YTSSSTK 72

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 53/117 (45%), Gaps = 4/117 (3%)

Query: 84  AEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVV----PTNAVYYANRAAAHSS 139
           A D E    AE+ K + N     K ++ A + Y + I +       N   +AN AA    
Sbjct: 69  AYDGEPHEVAENFKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELE 128

Query: 140 LKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSAT 196
           +KN+   I   + A++ +    K Y R+  A +   K +EA E+ K  L I+ ++ +
Sbjct: 129 IKNFRRCINLCQKALQFNPKNMKCYYRIAKAFYQLNKLDEAKESVKFGLTIDSENKS 185

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%)

Query: 94  ESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESA 153
           E++K +GN A    ++  A + Y + I + P N + Y+NRA A   L+ + E I   +  
Sbjct: 5   ETVKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRG 64

Query: 154 V 154
           +
Sbjct: 65  L 65

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 46/102 (45%)

Query: 89  LKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIK 148
           + +K E+    GN     KD++ AIK + +A  + P  A  Y  +   HSS  + D A  
Sbjct: 541 MPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKT 600

Query: 149 DAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDI 190
               A+  D  +   Y  LG +    G+ EEAL  ++K   I
Sbjct: 601 CYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSI 642

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 54/119 (45%), Gaps = 2/119 (1%)

Query: 100 GNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSS 159
           G  +M    YE A+  + +A S+ P N V       +   L   ++ ++  E A ++  +
Sbjct: 620 GTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKVLQYYELACQLQPT 679

Query: 160 YSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSATD--VMKRDYETAKRKVEQALEL 216
            S    ++G   ++  +   AL+ +++++ +  D AT   ++ + Y    RK +   EL
Sbjct: 680 SSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDATAHYLLGQTYRIVGRKKDAVKEL 738

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 46/102 (45%)

Query: 89  LKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIK 148
           + +K E+    GN     KD++ AIK + +A  + P  A  Y  +   HSS  + D A  
Sbjct: 529 MPNKPETWCCVGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKT 588

Query: 149 DAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDI 190
               A+  D  +   Y  LG +    G+ EEAL  ++K   I
Sbjct: 589 CYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSI 630

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 54/119 (45%), Gaps = 2/119 (1%)

Query: 100 GNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSS 159
           G  +M    YE A+  + +A S+ P N V       +   L   ++A++  E A  +  +
Sbjct: 608 GTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPT 667

Query: 160 YSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSATD--VMKRDYETAKRKVEQALEL 216
            S    ++G   ++  +   AL+ +++++ +  D AT   ++ + Y    RK +   EL
Sbjct: 668 SSLSKYKMGQLLYSMTRYSVALQTFEELVKLVPDDATAHYLLGQTYRIVGRKKDAIKEL 726

>CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa]
           {ON} similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032w Peptidyl-prolyl cis-trans isomerase CYP7
          Length = 387

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 66/148 (44%), Gaps = 30/148 (20%)

Query: 72  SSQGENVKVNIPAEDAELKSK--------AESLKLEGNKAMAGKDYELAIKKYSEAI--- 120
           S+ G ++    P +D    S+        +  +K  G+     KDY+ +  KY +A+   
Sbjct: 205 STIGGDIYEEYPDDDTHFDSEDFAAAYNASNIIKDSGSALFKIKDYQNSYYKYMKALKYV 264

Query: 121 -SVVPTNAV--------------YYANRAAAHSSLKNYDEAIKDAESAVKVDS----SYS 161
            + +P   V               Y N   A  +LK+YDE++K     +++DS      +
Sbjct: 265 NTYIPEQDVDEKHCLLFIELKKKLYLNICLALFNLKDYDESMKYGHYLLELDSVDDKDKA 324

Query: 162 KGYSRLGYAKFAQGKSEEALEAYKKVLD 189
           K Y R+G + FA+ + +EAL+ Y+   D
Sbjct: 325 KAYYRIGNSLFAKKRYDEALKNYRLCRD 352

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 46/102 (45%)

Query: 89  LKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIK 148
           + +K E+    GN     KD++ AIK + +A  + P  A  Y  +   HSS  + D A  
Sbjct: 536 MPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKT 595

Query: 149 DAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDI 190
               A+  D  +   Y  LG +    G+ EEAL  ++K   I
Sbjct: 596 CYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSI 637

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 54/119 (45%), Gaps = 2/119 (1%)

Query: 100 GNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSS 159
           G  AM    YE A+  + +A S+ P N V       +   L   ++A++  E A  +  +
Sbjct: 615 GTSAMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPT 674

Query: 160 YSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSATD--VMKRDYETAKRKVEQALEL 216
            S    ++G   ++  +   AL+ +++++ +  D AT   ++ + Y    RK +   EL
Sbjct: 675 SSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDATAHYLLGQTYRIVGRKKDAIKEL 733

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%)

Query: 97  KLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAV 154
           K EGN+     DY  A K Y   I   PTN + Y+N+A +    +++D+AI+   + +
Sbjct: 7   KTEGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGL 64

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 65/125 (52%), Gaps = 7/125 (5%)

Query: 72  SSQGE---NVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAV 128
           SS GE   + K N  AE+ +    A +LK +GN+    K Y+ AIK Y+ A+ +   + V
Sbjct: 77  SSNGEPDFSNKANFTAEEKD--KYALALKDKGNQFFRNKKYDDAIKYYNWALEL-KEDPV 133

Query: 129 YYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVL 188
           +Y+N +A + S+ +  + ++ +  A+++   YSK   R   A    GK  +A+     VL
Sbjct: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDL-SVL 192

Query: 189 DIEGD 193
            + GD
Sbjct: 193 SLNGD 197

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 58/116 (50%), Gaps = 13/116 (11%)

Query: 116 YSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQG 175
           + +A+ +   N+  Y +R   +  L+NYD+A KD + A ++D      Y +L    + + 
Sbjct: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445

Query: 176 KSE--EAL--EAYKK------VLDIEGDSATDVMKRDYETAKRKVEQALEL-NKTD 220
           K +  E L  EA +K      V +   +  TD  K D++ A ++ + A+EL NK D
Sbjct: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTD--KNDFDKALKQYDLAIELENKLD 499

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 124 PTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLG--YAKFAQGKSEEAL 181
           P   +   NRAA+   + N  +A+ DA+  +KVD+   KGY R G    K AQ K  EAL
Sbjct: 67  PRYLILLDNRAASWERINNLGKALIDADRMIKVDAYNLKGYIRKGKILQKMAQDK--EAL 124

Query: 182 EAYK 185
             Y+
Sbjct: 125 YVYR 128

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 43/72 (59%), Gaps = 1/72 (1%)

Query: 95  SLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAV 154
           +LK +GN+    + YE A+K Y+ A+ +   + V+Y+N +A + SL N ++ ++ +  A+
Sbjct: 101 ALKDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNLEKVVESSTKAL 159

Query: 155 KVDSSYSKGYSR 166
           ++   YSK   R
Sbjct: 160 ELKPDYSKALLR 171

 Score = 33.9 bits (76), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 53/117 (45%), Gaps = 20/117 (17%)

Query: 116 YSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQG 175
           + +A+ V P +A  Y +R   H   + Y++A  D E A + DSS    Y +L    + +G
Sbjct: 366 FDKALDVDPNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHEG 425

Query: 176 KSE-----------------EALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALE 215
           K +                 E    Y +VL  +GD   D   + Y+ AKR +E++L+
Sbjct: 426 KFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGD--FDAASKQYDIAKR-LEESLD 479

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 42/74 (56%), Gaps = 1/74 (1%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAES 152
           A +LK +GN+    K  E AIK Y  A+     + V+YAN +A + SL ++++ +++   
Sbjct: 106 ALALKDKGNELFKEKAVEEAIKYYQWALEF-KKDPVFYANISACYVSLNDFEKVLENCNK 164

Query: 153 AVKVDSSYSKGYSR 166
           A+++   YSK   R
Sbjct: 165 ALELKPDYSKVLLR 178

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 50/109 (45%), Gaps = 2/109 (1%)

Query: 88  ELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVY-YANRAAAHSSLKNYDEA 146
           E + K E+    GN     KD++ AI+ + +A  + P N VY Y  +   + S+ +YD A
Sbjct: 585 EFRDKPETWCAVGNLFSLQKDHDEAIRAFDKATKLDP-NFVYAYTLQGHEYLSMDSYDTA 643

Query: 147 IKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSA 195
                 A+  D  +   Y  +G      G+ E+AL  ++K   I   +A
Sbjct: 644 KTFYRKAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNA 692

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 56/112 (50%), Gaps = 2/112 (1%)

Query: 100 GNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSS 159
           G  +M   +YE A+  + +A S+ P+NA+           L N ++A+   E A ++  +
Sbjct: 665 GMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQPT 724

Query: 160 YSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSAT--DVMKRDYETAKRK 209
            S    +  +  ++  K  +AL+A+++++ I  + AT   ++ + Y+   RK
Sbjct: 725 SSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQFILGQLYQIMGRK 776

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 46/103 (44%)

Query: 88  ELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAI 147
           E K++ ++    GN     KD++ AIK + +   + PT    Y  +A  + S  ++D A 
Sbjct: 560 EFKNEPQTWCCLGNLFSLQKDHKEAIKAFEKVTKLDPTFTYGYTLQAHEYLSDDSFDLAK 619

Query: 148 KDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDI 190
                AV  DS +   Y  +G      G+ E AL  ++K   I
Sbjct: 620 NYFRKAVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFEKARSI 662

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 35.8 bits (81), Expect = 0.028,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 34/69 (49%)

Query: 91  SKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDA 150
           S+ E  K +GN       Y  A+  Y + I+  P N V Y+N+A A   L  Y +AI+  
Sbjct: 2   SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMC 61

Query: 151 ESAVKVDSS 159
           +  ++  S+
Sbjct: 62  QQGLRYTST 70

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 36.2 bits (82), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 31/62 (50%)

Query: 94  ESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESA 153
           +  K EGN+     +Y  AIK Y + I + P N + Y+N+A A        EA++  +  
Sbjct: 4   DHFKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDG 63

Query: 154 VK 155
           +K
Sbjct: 64  LK 65

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%)

Query: 130 YANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKK 186
           Y N +A +  L+  D+A + +   + ++    KGY R+G     QGK  EA + YKK
Sbjct: 74  YDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKCYKK 130

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 35.4 bits (80), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 94  ESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESA 153
           E  K  GN      +Y  A++ Y + I V P N + Y+N A +   L  Y EA++   + 
Sbjct: 4   EEYKTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTG 63

Query: 154 VK-VDSSYSKGYSRLGY 169
           +K V+ + S+ Y +L Y
Sbjct: 64  LKYVNDADSQVYKKLQY 80

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 35.4 bits (80), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 5/82 (6%)

Query: 94  ESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESA 153
           E  K EGN+      Y++A + Y + + + P N + Y+N+A A   L  Y E ++     
Sbjct: 4   EQYKEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKG 63

Query: 154 VKV-----DSSYSKGYSRLGYA 170
           +       D+ Y K   RL  A
Sbjct: 64  LTFTPNTTDTVYKKLNYRLEMA 85

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 35.4 bits (80), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 31/63 (49%)

Query: 94  ESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESA 153
           E LK +GN     +DY  A++ Y + +    TN + ++NRA     L    EA K  ++ 
Sbjct: 5   ERLKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLIKLNRSQEAQKACQAG 64

Query: 154 VKV 156
           + +
Sbjct: 65  LAL 67

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 37.0 bits (84), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 51/112 (45%), Gaps = 2/112 (1%)

Query: 108 DYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRL 167
            YE  +  + +A S+ P N +       A   L + + A+++ + A ++    S    + 
Sbjct: 493 QYEECLLHFEKARSINPVNVILICCCGVALEKLSHQERALQNYDLACELQPMSSLALFKR 552

Query: 168 GYAKFAQGKSEEALEAYKKVLDIEGDSAT--DVMKRDYETAKRKVEQALELN 217
                A GK   ALE+++K++ I  D AT   ++ + Y+   RK +   EL 
Sbjct: 553 AQLLLAMGKYNYALESFEKLVKIAPDEATIHFLLGQLYQIVGRKQDAVKELT 604

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 36.6 bits (83), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 59/115 (51%), Gaps = 4/115 (3%)

Query: 79  KVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHS 138
           K N  AE+ +    A +LK +GN+    K Y+ AIK Y+ A+ +   + V+Y+N +A + 
Sbjct: 87  KANFTAEEKD--RYALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDPVFYSNLSACYV 143

Query: 139 SLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGD 193
           S+ +  + ++ +  A+++   YSK   R   A    G   +A+     VL + GD
Sbjct: 144 SVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 58/116 (50%), Gaps = 13/116 (11%)

Query: 116 YSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQG 175
           + +A+ +   N+  Y +R   +  L+NYD+A KD + A ++D      Y +L    + + 
Sbjct: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445

Query: 176 KSE--EAL--EAYKK------VLDIEGDSATDVMKRDYETAKRKVEQALEL-NKTD 220
           K +  E L  EA +K      V +   +  TD  K D+E A ++ + A+EL NK D
Sbjct: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTD--KNDFEKALKQYDLAIELENKLD 499

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 57/108 (52%), Gaps = 3/108 (2%)

Query: 87  AELKSK-AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDE 145
           AE K K A +LK +GN+    K Y+ AIK Y+ A+ +   + V+Y+N +A + S+ +  +
Sbjct: 92  AEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKK 150

Query: 146 AIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGD 193
            ++ +  A+++   YSK   R   A    G   +A+     VL + GD
Sbjct: 151 VVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 54/113 (47%)

Query: 76  ENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAA 135
           + V  N+   D  ++S A++     + A    D    I+ Y   ++  P +     + A 
Sbjct: 18  QQVPPNVKNIDPIVQSTADTWLSIASLAETLNDTTTLIRAYHSVLAHDPLSVTALVSLAN 77

Query: 136 AHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVL 188
            + S   +D+A+   E AV +DS+ ++ +S LG++     + ++A  AY++ L
Sbjct: 78  FYRSTDAFDKAVHYYEKAVALDSTLAEVWSLLGHSYLMLDELQKAYNAYQQAL 130

>SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} similar
           to uniprot|P47103 Saccharomyces cerevisiae YJR032W CPR7
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 432

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 67/163 (41%), Gaps = 31/163 (19%)

Query: 83  PAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVV----PTNAV---------- 128
           P   +E    A  +K  G +    KD++ A  KY +A+  V    P   V          
Sbjct: 269 PESFSESYKAANKIKESGTQLFKKKDFQDAFFKYRKALRYVNEYIPDMDVDEELSVKFAE 328

Query: 129 ----YYANRAAAHSSLKNYDEAIKDAESAVKVDS----SYSKGYSRLGYAKFAQGKSEEA 180
                Y N +    +LK YD AI  A   ++++       +K Y R G    A+ + EEA
Sbjct: 329 LKMKLYLNISLVLFNLKKYDSAITHATYLLEMEKVPTLDKAKAYYRRGNCYLAKNRLEEA 388

Query: 181 LEAYK---------KVLDIEGDSATDVMKRDYETAKRKVEQAL 214
           L+ YK         KV+D + +S  ++++   E  ++ + +  
Sbjct: 389 LKDYKNCKENNPDDKVIDQKIESVENLLEERKEKTRKNIAKFF 431

>Kpol_1067.25 s1067 (57301..58476) [1176 bp, 391 aa] {ON}
           (57301..58476) [1176 nt, 392 aa]
          Length = 391

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 56/131 (42%), Gaps = 27/131 (20%)

Query: 80  VNIPAEDAELKSKA-ESLKLEGNKAMAGKDYELAIKKYSEAISVV----------PTNAV 128
           +N   ED+    +A  ++K  G      KDY+ A+ KY +++  V            N +
Sbjct: 224 INFDPEDSSKAYEATNTIKESGTLLFKQKDYQNALLKYKKSLKYVNEFIPEMEVNKDNCI 283

Query: 129 Y--------YANRAAAHSSLKNYDEAIK------DAESAVKVDSSYSKGYSRLGYAKFAQ 174
                    Y N +  + +LK+ D  I       D E+   +D +  K Y R G A FA+
Sbjct: 284 LFTVLKMKLYLNISLVYFNLKDNDNCITYTTYLLDMENVPDLDQA--KAYYRRGNAYFAK 341

Query: 175 GKSEEALEAYK 185
            + EEAL  YK
Sbjct: 342 KRLEEALNDYK 352

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 32/50 (64%)

Query: 142 NYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIE 191
           ++D+ I   ESA+KV+ +    ++RLG +     +SEEA++AY + L ++
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 32/50 (64%)

Query: 142 NYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIE 191
           ++D+ I   ESA+KV+ +    ++RLG +     +SEEA++AY + L ++
Sbjct: 473 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 522

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 57/136 (41%), Gaps = 8/136 (5%)

Query: 89  LKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIK 148
           L +K ++    GN     +D+E AIK + +A  +    A  Y  +   HSS  + D A  
Sbjct: 478 LPNKPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDSIDTAKN 537

Query: 149 DAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSATDVM-------KR 201
               A+  D  +   Y  LG      G+ ++AL  ++K  +I   +   +        K 
Sbjct: 538 CYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNVILICCCGVALEKL 597

Query: 202 DY-ETAKRKVEQALEL 216
            Y E A +  EQA EL
Sbjct: 598 SYQEKALQYYEQACEL 613

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 32/50 (64%)

Query: 142 NYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIE 191
           ++D+ I   ESA+KV+ +    ++RLG +     +SEEA++AY + L ++
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 52/120 (43%), Gaps = 2/120 (1%)

Query: 100 GNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSS 159
           G   +    YE  +  + +A S+ P N +       A   L + ++A++  + A ++   
Sbjct: 484 GMCCLKLGQYEECLLHFEKARSINPVNVILICCCGVALEKLSHQEKALQYYDLACELQPV 543

Query: 160 YSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSAT--DVMKRDYETAKRKVEQALELN 217
            S    +      A GK   ALE ++K++ I  D AT   ++ + Y+   RK +   EL 
Sbjct: 544 SSLALFKRAQLLLAMGKYNFALENFEKLVTIAPDEATIHFLLGQLYQIVGRKQDAVKELT 603

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 44/85 (51%)

Query: 107 KDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSR 166
           ++YELA+K Y  A  + P +A+    +A    SL  Y  A++  E  +K+DS     +  
Sbjct: 610 RNYELALKYYDFASKLQPNSALAKYRKAELLFSLGRYSLAVELFEDLIKLDSENPNLHYM 669

Query: 167 LGYAKFAQGKSEEALEAYKKVLDIE 191
           LG      G+ ++A++ Y   ++++
Sbjct: 670 LGKIYQTMGRKKDAVKEYTVAMNLD 694

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 45/94 (47%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAES 152
           A++  + GN     KD++ AIK +++A  + P  A  Y  +   ++S +++D A      
Sbjct: 494 AQTWCVLGNHFSLQKDHDEAIKAFNKATELDPRFAYAYTLQGHEYASNESFDTARTFYRK 553

Query: 153 AVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKK 186
           A+  DS +   Y  LG      G  + +L  ++K
Sbjct: 554 ALACDSQHYNAYYGLGTCDSQNGNHDRSLLFFEK 587

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 36/55 (65%)

Query: 137 HSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIE 191
           H S  ++D+ ++  ++A+K++ +    ++RLG +     +SEEA++AY K ++++
Sbjct: 451 HYSNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLK 505

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 59/136 (43%), Gaps = 13/136 (9%)

Query: 79  KVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHS 138
           ++N  A DAE +     L L G    +  D++  ++ +  A+ + P + + +    A+ +
Sbjct: 433 QINNNANDAEFQ-----LCL-GLLHYSNDDFDKTLECFQNALKINPNDELMWNRLGASLA 486

Query: 139 SLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEA---LEAYKKVLDIEGDSA 195
           +    +EAIK    A+ +  S+ +    L  A    G  +EA   L    K+  + G   
Sbjct: 487 NSNRSEEAIKAYHKAINLKPSFVRARYNLAVASMNIGCYQEAAGHLLTVLKMHQVHGQDN 546

Query: 196 TDVMKRD---YETAKR 208
           T V K D    ET KR
Sbjct: 547 TSV-KTDTAVLETLKR 561

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 32.7 bits (73), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 36/64 (56%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAES 152
           ++ L+ +GN   +  +YE A+  Y  A    P+N V+ AN + A   L+ +++A+   + 
Sbjct: 8   SDHLRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDR 67

Query: 153 AVKV 156
           A+++
Sbjct: 68  ALEI 71

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 32.3 bits (72), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 26/56 (46%)

Query: 100 GNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVK 155
           GN       Y  A+  Y + I+  P N V Y+N+A A   L  Y  AI+  +  ++
Sbjct: 15  GNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLR 70

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 31/49 (63%)

Query: 142 NYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDI 190
           ++D+ I   ESA++V+ +    ++RLG +     +SEEA++AY + L +
Sbjct: 472 DFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQL 520

>Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR080W
           (DIA2) - may be involved in regulation of invasive
           growth and budding pattern [contig 126] FULL
          Length = 690

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 45/105 (42%), Gaps = 10/105 (9%)

Query: 132 NRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIE 191
           NRAA    L +  +A+KDA  AVK +    K Y R G         + AL+ Y+     E
Sbjct: 76  NRAATWEKLGDLTKALKDANRAVKYEPYNLKCYLRKGKILQKLQLDDMALKNYE-----E 130

Query: 192 GDSATDVMKRDY-----ETAKRKVEQALELNKTDETETSDRGTGE 231
           G    D M+  Y     +   R VE    L K+  TET D  + E
Sbjct: 131 GLQKADEMRSRYGLEPPQKLSRIVEHQKSLIKSRITETRDTVSSE 175

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 57/129 (44%), Gaps = 23/129 (17%)

Query: 82  IPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPT----NAVYYANRAAAH 137
           +P    EL    E  K  G++     DY  A+++Y ++++ +P       + Y+N  A  
Sbjct: 404 VPISHIELSGHIE-FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQ 462

Query: 138 SSLKNYDEAIKDAESAVKV---------------DSSYSKGYSRLGYAKFA--QGKSEEA 180
             +  Y ++I+D + A+ +               DS+  + +  + ++K    Q +S E 
Sbjct: 463 LKIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDI-WSKLIMRQAESYEH 521

Query: 181 LEAYKKVLD 189
           LE YK  LD
Sbjct: 522 LENYKLALD 530

>ZYRO0E03300g Chr5 complement(259634..260827) [1194 bp, 397 aa] {ON}
           similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032W CPR7 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 397

 Score = 33.1 bits (74), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 52/115 (45%), Gaps = 22/115 (19%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVV----PTNAV--------------YYANRA 134
           A ++K  G      KD++ A  KY +++  V    P  +V               Y N +
Sbjct: 239 ANTIKESGTLLYKKKDFQNAYYKYIKSLRYVNEFIPEESVDKANRINFINLKSKLYLNLS 298

Query: 135 AAHSSLKNYDEAIKDAESAVKV----DSSYSKGYSRLGYAKFAQGKSEEALEAYK 185
                L+NYDE+IK A   +++    D+  +K   R G +  A+ K EEAL+ YK
Sbjct: 299 LVLYYLQNYDESIKYATYLLEMENIPDADQAKALYRRGNSYSAKRKWEEALKDYK 353

>AEL062C Chr5 complement(519416..520567) [1152 bp, 383 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR032W
           (CPR7)
          Length = 383

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 52/125 (41%), Gaps = 22/125 (17%)

Query: 96  LKLEGNKAMAGKDYELAIKKYSEAISVV---------------PTNAV---YYANRAAAH 137
           +K  G + +  KD++ A  KY ++++ V                 N +    Y N   A 
Sbjct: 234 IKESGTQLLKRKDFQNAFFKYRKSLNYVNEYIPDVDIDAEQFEKFNVLKQKLYLNMTLAL 293

Query: 138 SSLKNYDEAIKDAESAVKVDS----SYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGD 193
            ++ +YD AI      +++D       +K Y R G    A+   EEAL  YK+  +   D
Sbjct: 294 FNMGSYDSAISYTNYVLEMDRVPSMDLAKAYYRRGNCYLAKNLLEEALSNYKRCKEHNSD 353

Query: 194 SATDV 198
            A D+
Sbjct: 354 EAVDM 358

>TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}
           Anc_5.689 YOR080W
          Length = 728

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%)

Query: 130 YANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYK 185
           Y N +A +  L+N D+A   ++  + VD    KGY  +G     Q K + A +AYK
Sbjct: 75  YGNLSATYDKLQNLDKASDCSQRMINVDPYNLKGYIMMGKILQKQNKDKLAYKAYK 130

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query: 128 VYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKV 187
           ++YAN          +D  I   ++A+KV+ +    ++RLG +     +SEEA++AY + 
Sbjct: 433 LFYAN--------DEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRA 484

Query: 188 LDIE 191
           L ++
Sbjct: 485 LQLK 488

>CAGL0J09570g Chr10 complement(941571..943220) [1650 bp, 549 aa]
           {ON} some similarities with uniprot|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor
          Length = 549

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/122 (21%), Positives = 56/122 (45%), Gaps = 10/122 (8%)

Query: 76  ENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYEL-----AIKKYSEAISVVPTNAVYY 130
           ENV ++IP+    +    + L +     +A  +Y L     AIK + + +   P + + +
Sbjct: 374 ENVLLDIPSTAINITRDKDILTV-----LALFNYLLGRSDNAIKCFEKLLEQDPKDEITW 428

Query: 131 ANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDI 190
            +  A  ++ K YD AI+   + +++  S+ +    LG      G+ +  +E+    L +
Sbjct: 429 NHLGATLANSKRYDTAIQVYMNTIELKPSFVRARYNLGSTLVKNGELQRGIESLLTALVM 488

Query: 191 EG 192
           +G
Sbjct: 489 QG 490

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%)

Query: 132 NRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAY 184
           NRAA+   L   D+A+KDA++ ++V+    K Y R G       K +EA   Y
Sbjct: 76  NRAASWEKLGKLDKALKDAKNMIRVEPHNLKCYIRCGKILQKLNKDKEAYSNY 128

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 44/92 (47%), Gaps = 5/92 (5%)

Query: 80  VNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPT----NAVYYANRAA 135
           V +P    EL    E  +  G +     DY+ A+ +Y ++++ +P       + Y+N  A
Sbjct: 534 VKVPISTIELSGYTE-FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILA 592

Query: 136 AHSSLKNYDEAIKDAESAVKVDSSYSKGYSRL 167
           A   +  Y +++KD + A+++     K +++ 
Sbjct: 593 AQLKVGEYSQSVKDCDVALELFPKNDKQWTQF 624

>Kwal_34.16092 s34 complement(198730..199917) [1188 bp, 395 aa] {ON}
           YJR032W (CPR7) - peptidyl-prolyl cis/trans isomerase
           [contig 270] FULL
          Length = 395

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 54/129 (41%), Gaps = 23/129 (17%)

Query: 80  VNIPAEDAELKSKAESL-KLEGNKAMAGKDYELAIKKYSEAI------------------ 120
           VN   E AE   +  ++ K  G+     KD++ A+ KY +A+                  
Sbjct: 228 VNFDKESAEDAYRVTTIIKNSGSLLFKQKDFQNALFKYKKALRYVNEFIPEIEVDEAYNK 287

Query: 121 SVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYS----KGYSRLGYAKFAQGK 176
             +   A  Y N +    +LK Y+EAI      +++  + S    K Y R G   FA+ +
Sbjct: 288 KFIELKAKLYLNLSLVMFNLKRYEEAITYTTYLLEIPEASSIDKAKAYYRSGNCHFAKKR 347

Query: 177 SEEALEAYK 185
            ++AL  +K
Sbjct: 348 YDKALSDFK 356

>ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 577

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 30/48 (62%)

Query: 143 YDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDI 190
           +D+ I   ++A+ V+S+    ++RLG +     +SEEA++AY + L +
Sbjct: 442 FDKTIDCFKAALSVNSNDELMWNRLGASLANSSRSEEAIQAYHRALQL 489

>ZYRO0C02970g Chr3 (230414..233104) [2691 bp, 896 aa] {ON} similar
           to uniprot|P42842 Saccharomyces cerevisiae YNL313C
           Protein required for cell viability
          Length = 896

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 31/65 (47%)

Query: 94  ESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESA 153
           E+    G   +     ELA + +S  +S+ PT+   ++N +AA+  L    EA    + A
Sbjct: 632 ETWYFYGCVGLESGKMELAAEAFSRCVSLDPTHGAAWSNLSAAYVELDKLKEAFSCLKQA 691

Query: 154 VKVDS 158
           V  D+
Sbjct: 692 VSTDA 696

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 30.0 bits (66), Expect = 2.9,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 33/66 (50%)

Query: 94  ESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESA 153
           E  K EGN+      Y  AI  Y   I+  P N V ++N+A A   L  + +AI+  +  
Sbjct: 5   ERDKEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQG 64

Query: 154 VKVDSS 159
           +++ +S
Sbjct: 65  LQLAAS 70

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%)

Query: 143 YDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDI 190
           +D+ I   ++A+KV  +    ++RLG +     +SEEA++AY K L++
Sbjct: 466 FDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNL 513

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 68/156 (43%), Gaps = 22/156 (14%)

Query: 82  IPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPT----NAVYYANRAAAH 137
           IP    E+    E  K  G       DY  A+++Y ++++ +P       + Y+N  A+ 
Sbjct: 352 IPISHIEISGYNE-FKARGTDYFKNGDYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASR 410

Query: 138 SSLKNYDEAIKDAESAVKV-------------DSSYSKGYSRLGYAK--FAQGKSEEALE 182
             +  + +++ DA+ A+K+             +S   + Y+ + + K    Q +S EA+E
Sbjct: 411 IKIGQHSQSVVDAQEAMKLLPEEKSLWTAAIQNSDPVRSYNDI-WPKIILRQAESYEAIE 469

Query: 183 AYKKVLD-IEGDSATDVMKRDYETAKRKVEQALELN 217
            YK  LD  +     ++        KR+ + AL L+
Sbjct: 470 KYKLALDAYQTLLEKNLFSEKVIAGKRRCQHALGLD 505

>KLLA0F14102g Chr6 (1302743..1304893) [2151 bp, 716 aa] {ON} similar
           to uniprot|P36122 Saccharomyces cerevisiae YKR027W FMP50
           The authentic non-tagged protein was localized to the
           mitochondria and uniprot|P40955 Saccharomyces cerevisiae
           YJL099w CHS6 chitin biosynthesis protein
          Length = 716

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 45/103 (43%), Gaps = 12/103 (11%)

Query: 87  AELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVP--TNAVYYANRAAAHSSLKNYD 144
           ++L    + L L+    M  +DYELA+     A  +VP    + YY      H   K YD
Sbjct: 319 SQLIMLTDLLNLQIEFLMKKEDYELALPVALYATQLVPDSFQSWYYLADCYIHK--KEYD 376

Query: 145 EAIKDAESAVKV-------DSSYSKGYSRLGYAKFAQGKSEEA 180
            A+    S  K+       D+ +S G  +L Y K  QG+  E+
Sbjct: 377 SALLAINSIPKLMILDPSKDAYWSIGLDKLYYKK-PQGQGAES 418

>TPHA0B03970 Chr2 (938053..939243) [1191 bp, 396 aa] {ON} Anc_1.456
           YJR032W
          Length = 396

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 6/90 (6%)

Query: 130 YANRAAAHSSLKNYDEAIKDAESAVKVDS----SYSKGYSRLGYAKFAQGKSEEALEAYK 185
           Y N +  + +LK YDE +  A   + +D+      +K Y R G +   + + E+AL +YK
Sbjct: 295 YLNMSLNYYNLKMYDECMTYANYLLDLDNIPDIDQAKAYYRRGNSYLMKKRYEDALASYK 354

Query: 186 KVLDIEGDSATDVMKRDYETAKRKVEQALE 215
             L  E +    V+ +  E+ K  +E  +E
Sbjct: 355 --LCKEKNPEDKVIDQKIESVKSLIEANIE 382

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 46/101 (45%), Gaps = 8/101 (7%)

Query: 61  AELLSAGAGAPSSQGENVKVNIPAEDAELK-SKAESLKLEGNKAMAGKDYELAIKKYSEA 119
           A LL    G P    E +K   P   + L+ S  +  K  G +     DY  A ++Y ++
Sbjct: 243 ATLLDFDNGTPP---ERIKTITPVPISHLEISGYKEYKDRGTEFFKAGDYVSASQEYEKS 299

Query: 120 ISVVPTNA----VYYANRAAAHSSLKNYDEAIKDAESAVKV 156
           ++ +P N     V Y+N  AA   +  Y   + D ESA+++
Sbjct: 300 LNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALEM 340

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 39/91 (42%)

Query: 100 GNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSS 159
           GN     KD++ AIK + +A  + P     Y  +   +SS   +D A      A+  +S 
Sbjct: 421 GNMFSLNKDHDEAIKSFQKATQLDPRFTYAYTLQGHEYSSNDAFDTAKTCYRKALATNSQ 480

Query: 160 YSKGYSRLGYAKFAQGKSEEALEAYKKVLDI 190
           +      LG      G+ EE+L  ++K   I
Sbjct: 481 HYNASYGLGMCCLKLGQYEESLLHFQKAHSI 511

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 37/75 (49%)

Query: 117 SEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGK 176
           +E +++   N + + +    HS  K++DEAI     A+++D  ++  Y+  G+       
Sbjct: 482 AELLTLDKYNPIAWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDA 541

Query: 177 SEEALEAYKKVLDIE 191
            + A   ++K L IE
Sbjct: 542 FDNAKSCFRKALTIE 556

>KAFR0E04070 Chr5 complement(804691..815892) [11202 bp, 3733 aa] {ON}
            Anc_5.402 YHR099W
          Length = 3733

 Score = 31.6 bits (70), Expect = 4.1,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 9/54 (16%)

Query: 125  TNAVYYANRAAAH---------SSLKNYDEAIKDAESAVKVDSSYSKGYSRLGY 169
            TN VY+     A          S LK YDEA +   +AV++D + +K +++ GY
Sbjct: 2993 TNLVYFGTGQKAEFFTLKGMFLSKLKAYDEANQAFATAVQIDLNLAKAWAQWGY 3046

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 8/63 (12%)

Query: 128 VYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKV 187
           ++YAN        ++YD+ I   ++A+ V       ++RLG +     +SEEA++AY + 
Sbjct: 431 LFYAN--------EDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRA 482

Query: 188 LDI 190
           L +
Sbjct: 483 LQL 485

>AFR088W Chr6 (587441..589609) [2169 bp, 722 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL099W (CHS6) and
           YKR027W (FMP50)
          Length = 722

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 81  NIPA-EDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSS 139
           NI A  + +L++  + L ++    +  +DYE A+    +A S+V  N + +   A  +  
Sbjct: 318 NIAALHNRDLQNAIDLLNVQVGFLLQKEDYEFALPLAQKATSLVHDNFLSWEQLATCYIG 377

Query: 140 LKNYDEAI 147
           L  YDEA+
Sbjct: 378 LGQYDEAL 385

>KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 689

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 39/88 (44%), Gaps = 6/88 (6%)

Query: 132 NRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIE 191
           NRAA    + +  +A+KDA  A + +    K Y R G          +ALE Y+     E
Sbjct: 76  NRAATWEKIGDLKKALKDANRATRFEPYNLKCYLRRGKILQKLRMDGQALENYE-----E 130

Query: 192 GDSATDVMKRDYET-AKRKVEQALELNK 218
           G  A   M R Y     +K+ +ALE  K
Sbjct: 131 GVKAIRDMTRKYHLDPPKKLYEALEYQK 158

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 29.6 bits (65), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%)

Query: 97  KLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKV 156
           K +GN       Y  A+  Y   I+  P N V Y+N+A A   L  + +AI+  +  ++ 
Sbjct: 12  KQQGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAIQACQQGLQH 71

Query: 157 DSS 159
            S+
Sbjct: 72  AST 74

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 42/93 (45%)

Query: 94  ESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESA 153
           E+  + GN     KD+  AIK + +A S+    A  Y  +   H++ + YD A      A
Sbjct: 522 ETWCVVGNYFSLIKDHGEAIKAFEKATSLDRKFAYAYTLQGHEHAANETYDTAKIMYRKA 581

Query: 154 VKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKK 186
           +  D  +   Y  LG      GK ++AL  ++K
Sbjct: 582 IACDPQHYNAYYGLGDCASRLGKYDKALLYFEK 614

>Ecym_6348 Chr6 complement(674740..676932) [2193 bp, 730 aa] {ON}
           similar to Ashbya gossypii AFR088W
          Length = 730

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 1/80 (1%)

Query: 81  NIPAEDA-ELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSS 139
           N P+    E K+  + L LE    +  +DYELA+     A  ++  N   + N A  +  
Sbjct: 325 NFPSLSLLEFKNIIDLLNLEVEFLINKQDYELALPLAKRATELITDNFQAWYNLALCYIE 384

Query: 140 LKNYDEAIKDAESAVKVDSS 159
           L  Y+ A+    S  ++ S+
Sbjct: 385 LGQYESALYSINSMPRLSST 404

>TBLA0E01990 Chr5 (483675..484799) [1125 bp, 374 aa] {ON} Anc_7.313
           YLR216C
          Length = 374

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 68/156 (43%), Gaps = 25/156 (16%)

Query: 79  KVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVP-------------- 124
           KVN+   ++ +K+ AE +K+ G +     +Y +A++KY++   ++               
Sbjct: 208 KVNMSDVNSVIKA-AEDVKVIGTEQFKKANYPIALQKYTKCEKLLKEYFPDDLPDEDSAR 266

Query: 125 ----TNAVYYANRAAAHSSLKNYDEAIKDA-----ESAVKVDSSYSKGYSRLGYAKFAQG 175
                NA+   N       +K+Y  AI  A     E +   D   +K Y R G A   + 
Sbjct: 267 LRQLRNAIA-LNITLCCLKVKDYTRAIYTASEVLYEESGATDKDKTKAYYRRGLAYKGRN 325

Query: 176 KSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVE 211
            ++EAL+ +++ + +  +  T V       AKRK E
Sbjct: 326 DTDEALKDFQRAMVLNPNDTTVVAAMRETKAKRKQE 361

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 63/134 (47%), Gaps = 19/134 (14%)

Query: 74  QGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNA----VY 129
           +  N    IP  D EL    E  K +G       DY  ++++Y ++++ +P N     + 
Sbjct: 356 ENSNTDSTIPISDIELSGYNE-FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIA 414

Query: 130 YANRAAAHSSLKNYDEAIKDAESAVKV-DSSYSKGYSRLG-----------YAKFAQGKS 177
            +N  A+   +  Y ++I+++  A+++  SS +K  +++            + K    ++
Sbjct: 415 LSNIIASQLKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRA 474

Query: 178 E--EALEAYKKVLD 189
           E  E LE++KK L+
Sbjct: 475 ESFEHLESFKKALE 488

>ZYRO0C03564g Chr3 (281661..284951) [3291 bp, 1096 aa] {ON} similar
           to uniprot|P89105 Saccharomyces cerevisiae YOL145C CTR9
           Component of the Paf1p complex which is a large complex
           that binds to and modulates the activity of RNA
           polymerase II and is required for expression of a subset
           of genes including cyclin genes contains TPR repeats
          Length = 1096

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 47/105 (44%), Gaps = 12/105 (11%)

Query: 107 KDYELAIKKYSEAISVVPT--NAVYYANRAAAHSSL----------KNYDEAIKDAESAV 154
           KDY+LAI  +  A+ + P   NA         H+SL          +NY +A++D +  +
Sbjct: 231 KDYKLAIAAWKRALELNPVNNNAAVLVTLGNFHNSLTASENDESFRENYSKALQDLDGLL 290

Query: 155 KVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSATDVM 199
           + D      ++ L    + +G   + +E Y+  +   G + +D +
Sbjct: 291 RKDGQNPVLWTLLQSYFYFKGDFTKVIEVYENKISKFGFAISDTV 335

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%)

Query: 142 NYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDI 190
           +YD+ +    +A+ V       ++RLG +     +SEEA++AY+K L +
Sbjct: 441 DYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQL 489

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1403

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 38/65 (58%), Gaps = 2/65 (3%)

Query: 130 YANRAAAHSSLKNYDEA--IKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKV 187
           +  R    + L+N  E+  I+  +SA++VD +  + +  LG A  A G+ E +++ ++K 
Sbjct: 670 WPYRVLGIAYLQNQQESSSIEWFQSAIRVDPNDIESWVGLGQAYLACGRIEASMKVFEKA 729

Query: 188 LDIEG 192
           ++++G
Sbjct: 730 MELDG 734

>NCAS0A14770 Chr1 complement(2911657..2912559) [903 bp, 300 aa] {ON}
           Anc_7.458 YJR088C
          Length = 300

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 43/91 (47%), Gaps = 16/91 (17%)

Query: 94  ESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAV---------YYANRAAAHSS----- 139
           E   + G   M  KD++ AI  + E + ++P N V         YY  ++ +HSS     
Sbjct: 165 ELWWMLGEIYMNLKDFDRAIYCFEEILCIMPFNYVAFAQLAESLYYKAKSMSHSSKAKVE 224

Query: 140 LKN--YDEAIKDAESAVKVDSSYSKGYSRLG 168
           L+     +++ +A  ++++   Y KG+S + 
Sbjct: 225 LRKEIVQKSMNNALRSIELSGLYLKGWSMVA 255

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%)

Query: 142 NYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDI 190
           +YD+ +    +A+ V       ++RLG +     +SEEA++AY+K L +
Sbjct: 434 DYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQL 482

>Suva_12.114 Chr12 (164933..166042) [1110 bp, 370 aa] {ON} YJR032W
           (REAL)
          Length = 370

 Score = 30.0 bits (66), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 50/115 (43%), Gaps = 22/115 (19%)

Query: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVV-----------PTNAVY-------YANRA 134
           A ++K  G      KDYE A  KY ++++ +             N  +       Y N +
Sbjct: 240 ASTIKESGTLLFKKKDYENAFFKYRKSLNYINEYMPEPDLDKEKNEQFTDLKMKVYLNLS 299

Query: 135 AAHSSLKNYDEAIKDAESAVKVDS----SYSKGYSRLGYAKFAQGKSEEALEAYK 185
            A  +L+ YD AI  A   +++D+      +K Y R G +   + + +EAL  Y+
Sbjct: 300 LALFNLERYDSAITYATYLLEMDNVPNKDRAKAYYRRGNSYLRKKRLDEALRDYR 354

>KLLA0A05258g Chr1 (466776..468674) [1899 bp, 632 aa] {ON} similar
           to uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 632

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 48/100 (48%), Gaps = 13/100 (13%)

Query: 107 KDYELA-IKKYSEAISVV-PTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGY 164
           K Y+LA + +Y+  + +  P      AN     SS + ++++I     A+ +D SY+  +
Sbjct: 384 KPYKLAYLAQYAANVDIYRPETCCIIAN---YFSSKQQHEKSILYFRRALMLDKSYTHAW 440

Query: 165 SRLGYAKFAQGKSEEALEAYKKVLDIEGDSATDVMKRDYE 204
             +G+       S  A+E Y++        A+DV  RD++
Sbjct: 441 ILMGHEFIEMKNSHAAIECYRR--------ASDVNPRDFQ 472

>Kwal_YGOB_23.3805 s23 complement(441696..448757) [7062 bp, 2353 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 2353

 Score = 30.4 bits (67), Expect = 7.9,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 51/111 (45%), Gaps = 26/111 (23%)

Query: 73   SQGENVKVNIPAEDAELKSKAE-SLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYA 131
            +QGEN        D  +K  AE   K++ N  +  ++      KY+E + +        +
Sbjct: 1716 NQGEN--------DKAIKLVAEIHKKIQNNSKLTPRERAKVYLKYTEWLDL--------S 1759

Query: 132  NRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLG--YAKFAQGKSEEA 180
            N + +   +K Y+E IK       VDS++S+ Y  LG  +++  + +S E 
Sbjct: 1760 NNSISEQIIKQYNEVIK-------VDSAWSEPYYSLGLYFSRLLEKRSAEG 1803

>Ecym_2373 Chr2 complement(724722..726461) [1740 bp, 579 aa] {ON}
           similar to Ashbya gossypii AAL104C
          Length = 579

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 20/81 (24%)

Query: 65  SAGAGAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAM-----------------AGK 107
           +AG   P S G  + + IP E   ++SK   ++LE    +                 +G 
Sbjct: 501 AAGPAFPQSMGAPLVLQIPPE---VQSKLSPIQLELLNGLHQHTKLNAEYTYMLAEQSGW 557

Query: 108 DYELAIKKYSEAISVVPTNAV 128
           DY++A+K +  +++ +P NA 
Sbjct: 558 DYDVAVKSFQSSVNNLPRNAF 578

>Kwal_55.22039 s55 (1084478..1087192) [2715 bp, 904 aa] {ON} YNL313C
           - Protein required for cell viability [contig 124] FULL
          Length = 904

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 35/82 (42%)

Query: 107 KDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSR 166
           KDY   +K  +E++S+ P     +             + A +     V +DS++S  +S 
Sbjct: 616 KDYVACLKHLNESLSLYPLAFDTWYFYGCVGLECGKMELAAEAFTRCVSLDSTHSLSWSN 675

Query: 167 LGYAKFAQGKSEEALEAYKKVL 188
           L  A   QGK +EA     K +
Sbjct: 676 LSAAYIEQGKLKEAHSCLSKAI 697

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.123    0.327 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,257,936
Number of extensions: 1062833
Number of successful extensions: 3785
Number of sequences better than 10.0: 249
Number of HSP's gapped: 3662
Number of HSP's successfully gapped: 346
Length of query: 334
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 224
Effective length of database: 40,868,139
Effective search space: 9154463136
Effective search space used: 9154463136
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 66 (30.0 bits)