Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07744g6.22ON54754727430.0
TDEL0G044706.22ON54253821640.0
Kpol_1037.276.22ON54654521180.0
NCAS0D021606.22ON56354820980.0
CAGL0E02629g6.22ON54854620770.0
KAFR0A050706.22ON56454620670.0
Suva_15.1776.22ON54454020610.0
Smik_15.1716.22ON54454020540.0
YOR002W (ALG6)6.22ON54454020420.0
Skud_15.1636.22ON54454020320.0
KLLA0D01221g6.22ON56654120210.0
TBLA0G009706.22ON55954420180.0
KNAG0F028906.22ON56354820180.0
TPHA0J003506.22ON55954620130.0
SAKL0E01364g6.22ON54153520100.0
NDAI0C026306.22ON58055120010.0
KLTH0C11176g6.22ON53652919640.0
Kwal_56.224376.22ON53654219590.0
Ecym_30276.22ON54954919560.0
ACR004W6.22ON56354818660.0
YOR067C (ALG8)5.669ON5772603102e-29
Smik_15.2475.669ON5772603059e-29
TPHA0J013805.669ON5752603032e-28
Suva_8.1185.669ON5762603013e-28
Skud_15.2345.669ON5772602988e-28
KLTH0F17666g5.669ON5554152933e-27
Kwal_55.217425.669ON5554172916e-27
ADR210C5.669ON5722862881e-26
TBLA0A093105.669ON5464052853e-26
CAGL0L10450g5.669ON5502602853e-26
KLLA0F16621g5.669ON5612912854e-26
TDEL0B025405.669ON5692672854e-26
ZYRO0A11506g5.669ON5562662835e-26
SAKL0G00836g5.669ON5613072835e-26
Kpol_1018.735.669ON6212602792e-25
NCAS0G004505.669ON5702542773e-25
Ecym_40515.669ON6042602731e-24
NDAI0F005105.669ON5704312693e-24
KNAG0L019205.669ON5682632694e-24
KAFR0D024405.669ON5752742623e-23
KNAG0D035304.112ON46242714.3
AGL087C4.112ON46271689.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C07744g
         (547 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly...  1061   0.0  
TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.2...   838   0.0  
Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {O...   820   0.0  
NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {O...   812   0.0  
CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly...   804   0.0  
KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa] ...   800   0.0  
Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002...   798   0.0  
Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002...   795   0.0  
YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha...   791   0.0  
Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002...   787   0.0  
KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {...   783   0.0  
TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.2...   781   0.0  
KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {O...   781   0.0  
TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON...   780   0.0  
SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} simila...   778   0.0  
NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.2...   775   0.0  
KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} simila...   761   0.0  
Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {...   759   0.0  
Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON} s...   758   0.0  
ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic ho...   723   0.0  
YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON} ...   124   2e-29
Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {...   122   9e-29
TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {...   121   2e-28
Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON...   120   3e-28
Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {...   119   8e-28
KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]...   117   3e-27
Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {...   116   6e-27
ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}...   115   1e-26
TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON} Anc_5...   114   3e-26
CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa...   114   3e-26
KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]...   114   4e-26
TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.6...   114   4e-26
ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {...   113   5e-26
SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly s...   113   5e-26
Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa] ...   112   2e-25
NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669...   111   3e-25
Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar t...   109   1e-24
NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.6...   108   3e-24
KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {...   108   4e-24
KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.6...   105   3e-23
KNAG0D03530 Chr4 (646700..648088) [1389 bp, 462 aa] {ON} Anc_4.1...    32   4.3  
AGL087C Chr7 complement(541373..542761) [1389 bp, 462 aa] {ON} S...    31   9.0  

>ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 547

 Score = 1061 bits (2743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/547 (97%), Positives = 535/547 (97%)

Query: 1   MPSKTSKKVEKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGL 60
           MPSKTSKKVEKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGL
Sbjct: 1   MPSKTSKKVEKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGL 60

Query: 61  GPYSGQSVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLG 120
           GPYSGQSVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLG
Sbjct: 61  GPYSGQSVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLG 120

Query: 121 SLINPDWFALNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQF 180
           SLINPDWFALNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQF
Sbjct: 121 SLINPDWFALNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQF 180

Query: 181 IAAAAILFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMAL 240
           IAAAAILFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMAL
Sbjct: 181 IAAAAILFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMAL 240

Query: 241 YYSPIFFAYLLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRI 300
           YYSPIFFAYLLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRI
Sbjct: 241 YYSPIFFAYLLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRI 300

Query: 301 FPFARGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKH 360
           FPFARGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKH
Sbjct: 301 FPFARGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKH 360

Query: 361 LVPFALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTLWP 420
           LVPFALAACSMSFFLFSFQVHEK            YTSTNWDVLSLVSWINNVGLFTLWP
Sbjct: 361 LVPFALAACSMSFFLFSFQVHEKTILVPLLPITLLYTSTNWDVLSLVSWINNVGLFTLWP 420

Query: 421 LLKKDGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSI 480
           LLKKDGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSI
Sbjct: 421 LLKKDGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSI 480

Query: 481 IWKLIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLA 540
           IWKLIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLA
Sbjct: 481 IWKLIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLA 540

Query: 541 GQSLQQL 547
           GQSLQQL
Sbjct: 541 GQSLQQL 547

>TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.22
           YOR002W
          Length = 542

 Score =  838 bits (2164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/538 (72%), Positives = 452/538 (84%)

Query: 10  EKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSGQSVK 69
            K    NT EESFYASPLYDFLYPF+P GSQWL EY+I+LFA+II CA+G G YSGQ   
Sbjct: 5   NKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSGQFSP 64

Query: 70  PMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFA 129
           PM GDFEAQRHW+EITQHL  SQWY+FDLEYWGLDYPPLTAYHSY+LGK+GS I P+WF 
Sbjct: 65  PMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPEWFE 124

Query: 130 LNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQ 189
           LN SRG+E+ DLKT+MRFTV+LSE +FYIPAVVYFTKW+G+HR  SP+GQFI+AAAILFQ
Sbjct: 125 LNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQ 184

Query: 190 PALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAY 249
           P+LMLIDHGHFQYNCVMLG TVYAINSL +EFYA AA CFVLSICFKQMALYY+PIFFAY
Sbjct: 185 PSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAY 244

Query: 250 LLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIFPFARGIFE 309
           LL + +F     FPR  +IA+AT+ +F  MY PLYI G G  NV+QSVHRIFPFARGIFE
Sbjct: 245 LLSKSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPFARGIFE 304

Query: 310 DKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVPFALAAC 369
           DKVANFWCVTN+F KYK +F Q+QLQLYSL+AT LGFLPAV+++ LYPKKH++ +ALA C
Sbjct: 305 DKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYALATC 364

Query: 370 SMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTLWPLLKKDGLAL 429
           SMSF+LFSFQVHEK            YTS+NWDVLS+ +WINNVGLFTL+PLLKKDGL L
Sbjct: 365 SMSFYLFSFQVHEKTILVPLLPITLLYTSSNWDVLSMANWINNVGLFTLYPLLKKDGLTL 424

Query: 430 QYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWKLIIVGS 489
           QY VCF   NWL+GNFSFVTP FLPKFLTPGPSVSSVD NYRRRS LP ++IWK+IIV S
Sbjct: 425 QYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKIIIVSS 484

Query: 490 YISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQSLQQL 547
           Y +MG +HV+D  + PP++YPDLWV+LNC LGFGCF LFWLW+YY LF++  ++LQQL
Sbjct: 485 YTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTLQQL 542

>Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {ON}
           complement(65544..67184) [1641 nt, 547 aa]
          Length = 546

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/545 (71%), Positives = 455/545 (83%), Gaps = 3/545 (0%)

Query: 6   SKKVEKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSG 65
           + K + ++ +   EESF+ASPLYDFL PF+PV +QWL EYII++FA+I+RCAIGLG YSG
Sbjct: 2   ASKKKISRINKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYSG 61

Query: 66  QSVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINP 125
               PM GDFEAQRHW+EITQHLPIS+WY+FDLEYWGLDYPPLTAYHSY+LG +GS +N 
Sbjct: 62  MGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNK 121

Query: 126 DWFALNVSRGLES--NDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAA 183
            WFALN SRG ES  NDLKTYMR TVI+SE+IFYIP V+YFTKWVGRHR  S +GQ+IAA
Sbjct: 122 SWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAA 181

Query: 184 AAILFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYS 243
           AAILFQP+LMLIDHGHFQYN VMLG TVYAIN+L+DEFYAPAA CFVLSICFKQMALYY+
Sbjct: 182 AAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYA 241

Query: 244 PIFFAYLLGRCVF-KTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIFP 302
           PIFF YLLGR +F +      RFLSIA++T+  F  MY PLY+ G G +NV+QSVHRIFP
Sbjct: 242 PIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIFP 301

Query: 303 FARGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLV 362
           FARG+FEDKVANFWCVTNIF+KYK L+TQ++LQLYSL+AT +GFLPAVV +L YPKKHL+
Sbjct: 302 FARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHLL 361

Query: 363 PFALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTLWPLL 422
           P+ALAACSMSF+LFSFQVHEK            YTST+W+VLS VSW+NNVGLFTLWPLL
Sbjct: 362 PYALAACSMSFYLFSFQVHEKTILVPLLPITLLYTSTDWNVLSFVSWVNNVGLFTLWPLL 421

Query: 423 KKDGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIW 482
           KKDGL LQY VCF   NWLIGNFSF+TP FLPK LTPGP V + +  Y RRSLLP +I+W
Sbjct: 422 KKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNILW 481

Query: 483 KLIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQ 542
           K+IIV SYI M  IH+ ++FV+PP  YPD+WV++NC LGFGCF+LFWLWNYYK+F+LA +
Sbjct: 482 KIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLANK 541

Query: 543 SLQQL 547
           +LQ L
Sbjct: 542 TLQYL 546

>NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/548 (70%), Positives = 452/548 (82%), Gaps = 3/548 (0%)

Query: 3   SKTSKKVEKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGP 62
            K+ K  E ++  +  EESFYASPLYD LYPF+P GSQW+ EY I+LF++IIRCA+GLGP
Sbjct: 16  KKSGKTKETSKKHDIPEESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGP 75

Query: 63  YSGQSVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSL 122
           +SG  V PM GDFEAQRHW+EITQHLPI +WY+FDL+YWGLDYPPLTAYHSYI GK+GS 
Sbjct: 76  FSGYGVPPMFGDFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSF 135

Query: 123 INPDWFALNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIA 182
            NP+WFAL+ SRG E+ DLKT+MR TV++SE +FYIP VVYF KW+G+HR  SP+GQFIA
Sbjct: 136 FNPNWFALDSSRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIA 195

Query: 183 AAAILFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYY 242
           AAAIL QP+L+LIDHGHFQYN V LG TVYAIN+L+DEFYA AA CFVLSICFKQM LYY
Sbjct: 196 AAAILLQPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYY 255

Query: 243 SPIFFAYLLGRCVFKTGI-RFPRFLSIAMATIATFLVMYIPLYIMGS--GSQNVLQSVHR 299
           SPIFFAYLL + +F   +   PRFL+IA+AT+ +FL+MY PLY+ G   G  NVLQS+HR
Sbjct: 256 SPIFFAYLLSKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHR 315

Query: 300 IFPFARGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKK 359
           IFPFARGIFEDKVANFWCVTN+  KYK LFTQQ+LQLYSL+ T +GFLPA++++L YPKK
Sbjct: 316 IFPFARGIFEDKVANFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKK 375

Query: 360 HLVPFALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTLW 419
           +L+P+AL+ACSM+F+LFSFQVHEK            YTST+ +VLS VSW+NN+GLFTLW
Sbjct: 376 YLLPYALSACSMAFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLW 435

Query: 420 PLLKKDGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKS 479
           PLLKKDGL LQY VC    NWLIGNFSF+TP FLPK LTPGPSVS +  NY  RSLLP++
Sbjct: 436 PLLKKDGLTLQYWVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRN 495

Query: 480 IIWKLIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSL 539
           I WK+IIV SYI+MGAIHVLD FV PP+ YPDLWVILNCTLGFGCF LFW+WNYYKLFS+
Sbjct: 496 IFWKVIIVLSYIAMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSM 555

Query: 540 AGQSLQQL 547
             +SL  L
Sbjct: 556 IKKSLHHL 563

>CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002w ALG6 glucosyltransferase
          Length = 548

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/546 (69%), Positives = 449/546 (82%), Gaps = 3/546 (0%)

Query: 3   SKTSKKVEKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGP 62
            K  K V K +++   EESFYASPLYDFL+PF+P GSQWL E+III+FA+IIRCAIGLGP
Sbjct: 5   KKDKKAVSKFESEQ-GEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGP 63

Query: 63  YSGQSVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSL 122
           YSG    PMHGDFEAQRHW+EITQHLPIS+WYY+DL+YWGLDYPPLTA+HSY+LGKLG+ 
Sbjct: 64  YSGYKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTF 123

Query: 123 INPDWFALNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIA 182
            NPDWFAL+ SRG+E+  LK YMRFTV+LSE IFY+PAVVYFTKW+GR R  SP+GQFIA
Sbjct: 124 CNPDWFALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIA 183

Query: 183 AAAILFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYY 242
           AAAILFQP+LMLIDHGHFQYN +MLGFTVYAIN+L+DEFYAPAA CFVLSICFKQM+LYY
Sbjct: 184 AAAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYY 243

Query: 243 SPIFFAYLLGRCVFKTGI-RFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIF 301
           +PIFFAYLLGR +F   +   PRF+SI++AT+ TF  M+ P YI G G   + Q+V RIF
Sbjct: 244 APIFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFG-GLDGLAQTVRRIF 302

Query: 302 PFARGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHL 361
           PFARGIFEDKVANFWCV N  VK+K LFT  QL++YSL+ T +GF PA++L++LYP+KHL
Sbjct: 303 PFARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHL 362

Query: 362 VPFALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTLWPL 421
           +P+ALAACSMSF+LFSFQVHEK            +TS +W+VLS+VSWINNV LFTLWPL
Sbjct: 363 LPYALAACSMSFYLFSFQVHEKTILVPLLPITLLFTSRDWNVLSMVSWINNVALFTLWPL 422

Query: 422 LKKDGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSII 481
           LK++GL LQY VCF   NWLIGNFSF+TP FLPKF+TPGPS+SSV  NYRRRSLLP SI 
Sbjct: 423 LKREGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIF 482

Query: 482 WKLIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAG 541
           WKLIIV SYI M A H LD+F+  P  +PDLWVILNCT+GF  F LFWLW YYK  +L  
Sbjct: 483 WKLIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLK 542

Query: 542 QSLQQL 547
           +++Q L
Sbjct: 543 KNIQDL 548

>KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa]
           {ON} Anc_6.22 YOR002W
          Length = 564

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/546 (68%), Positives = 440/546 (80%), Gaps = 1/546 (0%)

Query: 3   SKTSKKVEKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGP 62
           SK++ K      +   EE FYASPLYDFLYPF+P G+QWL +YII+ FA+IIRCAIGLG 
Sbjct: 19  SKSNPKKASKLNNEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGS 78

Query: 63  YSGQSVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSL 122
           YSG    PM GDFEAQRHW+EITQHLPIS+WY+FDL+YWGLDYPPLTAYHSYILGK+GS 
Sbjct: 79  YSGMGHSPMFGDFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSF 138

Query: 123 INPDWFALNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIA 182
           I P WF LN SRG+E   +K+YMR TV++SE +FY PA++YF+KW G+HR  SP+GQ+IA
Sbjct: 139 IYPKWFTLNDSRGIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIA 198

Query: 183 AAAILFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYY 242
           A AILFQP+LMLIDHGHFQYN VMLG TVYAIN+L+D+FY+ A+ CFVLSICFKQM+LYY
Sbjct: 199 ATAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYY 258

Query: 243 SPIFFAYLLGRCVFKTGI-RFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIF 301
           +PIFF YLL + +F   +   PR + IA  TI TF+ MY PLYI G G +N++QSVHRIF
Sbjct: 259 APIFFGYLLSKSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIF 318

Query: 302 PFARGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHL 361
           PFARGIFEDKVANFWCVTNI +KYK  FTQ QLQLYSL AT LGFLPA+V+++LYPKKHL
Sbjct: 319 PFARGIFEDKVANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHL 378

Query: 362 VPFALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTLWPL 421
           +P+ALAACSMSFFLFSFQVHEK            YTST+W+VLS+V WINNV LFTLWPL
Sbjct: 379 LPYALAACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVCWINNVALFTLWPL 438

Query: 422 LKKDGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSII 481
           LKKDGL LQY VCFA  NWL+GNFSFVTP FLPK LTPGPS+S++  NY RRSLLP +I+
Sbjct: 439 LKKDGLILQYAVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNIL 498

Query: 482 WKLIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAG 541
           WK++IV SY+SM   H LD FV PP NYPD+W+ LNC +GFG F+ FW+W YY LF+L  
Sbjct: 499 WKVVIVSSYLSMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRN 558

Query: 542 QSLQQL 547
           ++L  L
Sbjct: 559 KTLMDL 564

>Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/540 (68%), Positives = 450/540 (83%), Gaps = 2/540 (0%)

Query: 10  EKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSGQSVK 69
           ++   +  AEESFYASP+YDFLYPF+PVG+QWLPEYII + AVI+RCAIGLGPYSG++  
Sbjct: 5   KRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKATP 64

Query: 70  PMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFA 129
           P+HGDFEAQRHW+EITQHLP+S+WY++DL+YWGLDYPPLTA+HSY+LG +G+  NP WFA
Sbjct: 65  PLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGTFFNPSWFA 124

Query: 130 LNVSRGLES--NDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAIL 187
           L+ SRG ES  N LKTYMR TVI+S+++FY PAV+YFTKW+GR+R  SP+GQ IAAAAIL
Sbjct: 125 LDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAIL 184

Query: 188 FQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFF 247
           FQP+LMLIDHGHFQYN VMLG T YAIN+L+DE+YA AA CFVLSICFKQMALYY+PIFF
Sbjct: 185 FQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFF 244

Query: 248 AYLLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIFPFARGI 307
           AYLL R +F       R   IA AT+ATF +M+ PLY +G G +N+ Q +HR+FPFARGI
Sbjct: 245 AYLLSRSLFFPKFNIARLTVIAFATLATFSLMFAPLYFLGGGLRNIYQCIHRMFPFARGI 304

Query: 308 FEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVPFALA 367
           FEDKVANFWCV+NIFVKYK+ F+ QQLQLYSL+AT LGFLPA+++ LL+PKKHL+P+ L 
Sbjct: 305 FEDKVANFWCVSNIFVKYKERFSIQQLQLYSLVATVLGFLPAMMMTLLHPKKHLLPYVLI 364

Query: 368 ACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTLWPLLKKDGL 427
           ACSMSFFLFSFQVHEK            Y+ST+W+VLSLVSWINNV LFTLWPLLKKDGL
Sbjct: 365 ACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGL 424

Query: 428 ALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWKLIIV 487
            LQY V F   NWLIGNFSF+TP FLPK LTPGPS+SS++S+YRRRSLLP +++WK  I+
Sbjct: 425 HLQYVVSFLLTNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFII 484

Query: 488 GSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQSLQQL 547
           G+YI+MG  H LD+FVAPP  YPDLWV+LNC +GF CF +FW+W+YYK+F+   +S++ L
Sbjct: 485 GTYIAMGLYHFLDLFVAPPKKYPDLWVLLNCAVGFICFSIFWIWSYYKIFTSGNKSMKDL 544

>Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/540 (68%), Positives = 447/540 (82%), Gaps = 2/540 (0%)

Query: 10  EKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSGQSVK 69
           ++   +  AEESFYASP+YDFLYPF+PVG+QWLPEYII + AVI+RC IGLGPYSG+   
Sbjct: 5   KRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCTIGLGPYSGKGSP 64

Query: 70  PMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFA 129
           P+HGDFEAQRHW+EITQHLP+S+WY++DL+YWGLDYPPLTA+HSY+LG +GS  NP WFA
Sbjct: 65  PLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFA 124

Query: 130 LNVSRGLES--NDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAIL 187
           L+ SRG ES  N LKTYMR TVI+S+++FY PAV+YFTKW+GR+R  SP+GQ IAA+AIL
Sbjct: 125 LDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAIL 184

Query: 188 FQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFF 247
           FQP+LMLIDHGHFQYN VMLG T YAIN+L+DE+YA AA CFVLSICFKQMALYY+PIFF
Sbjct: 185 FQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFF 244

Query: 248 AYLLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIFPFARGI 307
           AYLL R +        R   I+ AT+ATF +M  PLY +G G +N+ Q +HRIFPFARGI
Sbjct: 245 AYLLSRSLLFPKFNIARLTVISFATLATFALMLAPLYFLGGGLKNIYQCIHRIFPFARGI 304

Query: 308 FEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVPFALA 367
           FEDKVANFWCVTN+FVKYK+ F+ QQLQLYSL+AT +GFLPA+V+ LL+PKKHL+P+ L 
Sbjct: 305 FEDKVANFWCVTNVFVKYKERFSVQQLQLYSLVATVIGFLPAMVMTLLHPKKHLLPYVLI 364

Query: 368 ACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTLWPLLKKDGL 427
           ACSMSFFLFSFQVHEK            Y+ST+W+VLSLVSWINNV LFTLWPLLK+DGL
Sbjct: 365 ACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKRDGL 424

Query: 428 ALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWKLIIV 487
            LQY V F   NWLIGNFSF+TP FLPK LTPGPS+SS++S+YRRRSLLP +++WK  I+
Sbjct: 425 HLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFII 484

Query: 488 GSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQSLQQL 547
           G+YI+MG  H LD+FVAPP  YPDLWV+LNCT+GF CF +FW+W+YYK+F+   +S++ L
Sbjct: 485 GTYIAMGLYHFLDLFVAPPSKYPDLWVLLNCTVGFTCFSIFWVWSYYKIFTSGSKSMKDL 544

>YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha
           1,3 glucosyltransferase, involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation; mutations in human ortholog are
           associated with disease
          Length = 544

 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/540 (68%), Positives = 445/540 (82%), Gaps = 2/540 (0%)

Query: 10  EKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSGQSVK 69
           ++   +  AEESFYASP+YDFLYPF+PVG+QWLPEYII + AVI+RC IGLGPYSG+   
Sbjct: 5   KRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSP 64

Query: 70  PMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFA 129
           P++GDFEAQRHW+EITQHLP+S+WY++DL+YWGLDYPPLTA+HSY+LG +GS  NP WFA
Sbjct: 65  PLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFA 124

Query: 130 LNVSRGLES--NDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAIL 187
           L  SRG ES  N LKTYMR TVI+S+++FY PAV+YFTKW+GR+R  SP+GQ IAA+AIL
Sbjct: 125 LEKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAIL 184

Query: 188 FQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFF 247
           FQP+LMLIDHGHFQYN VMLG T YAIN+L+DE+YA AA CFVLSICFKQMALYY+PIFF
Sbjct: 185 FQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFF 244

Query: 248 AYLLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIFPFARGI 307
           AYLL R +        R   IA AT+ATF +++ PLY +G G +N+ Q +HRIFPFARGI
Sbjct: 245 AYLLSRSLLFPKFNIARLTVIAFATLATFAIIFAPLYFLGGGLKNIHQCIHRIFPFARGI 304

Query: 308 FEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVPFALA 367
           FEDKVANFWCVTN+FVKYK+ FT QQLQLYSL+AT +GFLPA+++ LL+PKKHL+P+ L 
Sbjct: 305 FEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLI 364

Query: 368 ACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTLWPLLKKDGL 427
           ACSMSFFLFSFQVHEK            Y+ST+W+VLSLVSWINNV LFTLWPLLKKDGL
Sbjct: 365 ACSMSFFLFSFQVHEKTILIPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGL 424

Query: 428 ALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWKLIIV 487
            LQY V F   NWLIGNFSF+TP FLPK LTPGPS+SS++S+YRRRSLLP +++WK  I+
Sbjct: 425 HLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFII 484

Query: 488 GSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQSLQQL 547
           G+YI+MG  H LD FVAPP  YPDLWV+LNC +GF CF +FWLW+YYK+F+   +S++ L
Sbjct: 485 GTYIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL 544

>Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/540 (67%), Positives = 444/540 (82%), Gaps = 2/540 (0%)

Query: 10  EKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSGQSVK 69
           ++   +  AEESFYASP+YDFLYPF+PVG+QWLPEYII + AVI+RCAIGLGPYSG+   
Sbjct: 5   KRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSP 64

Query: 70  PMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFA 129
           P+HGDFEAQRHW+EITQHLP+S+WY++DL+YWGLDYPPLTA+HS + G +G+  NP WFA
Sbjct: 65  PLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFA 124

Query: 130 LNVSRGLES--NDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAIL 187
           L+ SRG ES  N LKTYMR TVI+S+++FY PAV+YFTKW+GR+R  SP+GQ IAAAAIL
Sbjct: 125 LDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAIL 184

Query: 188 FQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFF 247
           FQP+LMLIDHGHFQYN VMLG T YAIN+L+DE+YA AA CFVLSICFKQMALYY+PIFF
Sbjct: 185 FQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFF 244

Query: 248 AYLLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIFPFARGI 307
           AYLL R +        R   IA AT+ATF V+  PLY +G G +N+ Q ++RIFPF+RGI
Sbjct: 245 AYLLSRSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPFSRGI 304

Query: 308 FEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVPFALA 367
           FEDKVANFWCVTNIFVKYK  FT QQLQLYSL+AT +GFLPA+++ LL+PKKHL+P+ L 
Sbjct: 305 FEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLI 364

Query: 368 ACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTLWPLLKKDGL 427
           ACSMSFFLFSFQVHEK            Y+ST+W+VLSLVSWINNV LFTLWPLLKKDGL
Sbjct: 365 ACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGL 424

Query: 428 ALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWKLIIV 487
            LQY V F   NWLIGNFSF+TP FLPK LTPGPS+SS++S+YRRRSLLP +++WK  I+
Sbjct: 425 HLQYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFII 484

Query: 488 GSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQSLQQL 547
           G+YI+MG  H+LD+FV PP  YPDLWV+LNC +GF CF +FW+W+YYK+F+   +S++ L
Sbjct: 485 GTYIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL 544

>KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {ON}
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease,
          Length = 566

 Score =  783 bits (2021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/541 (67%), Positives = 440/541 (81%), Gaps = 8/541 (1%)

Query: 7   KKVEKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSGQ 66
           KKVE         E+F+ASP+YDFL PF+PVG+QW  +Y+I++FA+IIRCA+GLG YSG 
Sbjct: 34  KKVESV-------EAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGM 86

Query: 67  SVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPD 126
           +  PM GDFEAQRHW+EITQHLP+ +WY++DL+YWGLDYPPLTAYHSY+LGKLGS     
Sbjct: 87  NTPPMFGDFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREG 146

Query: 127 WFALNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAI 186
           WF L  SRG ES +LK+YMRFTVI+SE++ YIPAV+YFTKWVG++R  SP+GQ+IAAAAI
Sbjct: 147 WFDLESSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAI 206

Query: 187 LFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIF 246
           LFQPAL+L+DHGHFQYNCVMLG TVY +N+L+D FYA  A CFVLS+CFKQMALYYSPIF
Sbjct: 207 LFQPALILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIF 266

Query: 247 FAYLLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIFPFARG 306
           FAYLL +  +  GI  PR  +I+++T   F+  + P+YI G G +N++QS+HRIFPFARG
Sbjct: 267 FAYLLSKSTYSPGINLPRLFAISVSTALAFIGSFGPIYIFG-GYKNLVQSMHRIFPFARG 325

Query: 307 IFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVPFAL 366
           IFEDKVANFWCV+NIF+KY+ LFTQ+ LQLYSLLAT +G LP+ ++  LYPK+HL+P+AL
Sbjct: 326 IFEDKVANFWCVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYAL 385

Query: 367 AACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTLWPLLKKDG 426
           AACSMSFFLFSFQVHEK            YTS +W+VLSLV WINNV LFTLWPLLKKD 
Sbjct: 386 AACSMSFFLFSFQVHEKTILLPLLPITLLYTSRDWNVLSLVCWINNVALFTLWPLLKKDN 445

Query: 427 LALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWKLII 486
           L LQY V F F NWLIGNFSFVTP FLPKFLTPGPS+S +D +YRR SLLPKS+IW+LII
Sbjct: 446 LVLQYGVMFMFSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLII 505

Query: 487 VGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQSLQQ 546
           VGSYI+MG IH LD +V+PP  YPDLWV+ NC+LGF CF+ FW+WN YKLF +   +LQ 
Sbjct: 506 VGSYIAMGIIHFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQD 565

Query: 547 L 547
           L
Sbjct: 566 L 566

>TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.22
           YOR002W
          Length = 559

 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/544 (68%), Positives = 446/544 (81%), Gaps = 14/544 (2%)

Query: 18  AEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSGQSVKPMHGDFEA 77
            EE+FYASPL+DFLYPF+PVGSQWL EY+II+FA+IIRCAI LG YSG+   PM GDFEA
Sbjct: 16  EEEAFYASPLFDFLYPFRPVGSQWLTEYVIIIFAIIIRCAISLGSYSGKGTPPMFGDFEA 75

Query: 78  QRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFALNVSRGLE 137
           QRHW+EITQHLPIS+WY+FDL+YWGLDYPP TAYHSY  GKLGS  NPDWFALN SRG E
Sbjct: 76  QRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYE 135

Query: 138 SND--LKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPALMLI 195
           S+D  LKTYMRFTVILSE +FYIPAVVYFTKW+G+HR  SP+GQFIAAAAILFQP+LMLI
Sbjct: 136 SDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLI 195

Query: 196 DHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLGRCV 255
           DHGHFQYN VMLG TVYAIN+L+DEFY PAA CFVLS+CFKQMALYYSPIFF YLL + +
Sbjct: 196 DHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSL 255

Query: 256 FKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGS------------QNVLQSVHRIFPF 303
                   RF+ +A++T+ +F+VM+ P+Y+ GS S             N++Q + RIFPF
Sbjct: 256 VHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPF 315

Query: 304 ARGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVP 363
           ARGIFEDKVANFWCVTN+ +KY++LFTQ+QLQ YSL+AT +GFLP+++ + LYP+K L+P
Sbjct: 316 ARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIP 375

Query: 364 FALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTLWPLLK 423
           +ALAACSMSFFLFSFQVHEK            YTST+W+VLSLV WINNV LFTLWPLL+
Sbjct: 376 YALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLR 435

Query: 424 KDGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWK 483
           KDGL LQY VC+   NWLIGNFSF+TP FLP FLTPGPS+S++D +YRR SLLP +I+WK
Sbjct: 436 KDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWK 495

Query: 484 LIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQS 543
           +II+ SYI MGA+ +LD+F  PP NYPDLW+ILNCT+GFGCFMLFWLWN YK+  +  ++
Sbjct: 496 IIIISSYIVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKT 555

Query: 544 LQQL 547
           L  L
Sbjct: 556 LNDL 559

>KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/548 (67%), Positives = 445/548 (81%), Gaps = 4/548 (0%)

Query: 3   SKTSKKVE--KAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGL 60
           +K+  K++  K +A    EE FYASP+YDFLYPF+  GSQW+ EYII++F +II+ AIGL
Sbjct: 17  TKSLSKLQRNKDEAAPEVEECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGL 76

Query: 61  GPYSGQSVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLG 120
           G YSG    PM GDFEAQRHW+EITQHLP+SQWY+FDL+YWGLDYPP TAYHSY+LGK+G
Sbjct: 77  GSYSGFQTPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIG 136

Query: 121 SLINPDWFALNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQF 180
           + I P WF L+ SRG+E++ +K+YMRFTV+LSE IFYIPA+VYFTKWVGR +  SP+GQF
Sbjct: 137 TFIYPPWFELDASRGMETDGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQF 196

Query: 181 IAAAAILFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMAL 240
           +AAAAILFQP LMLIDHGHFQYNCVMLG TVYAIN+L+D FYA AA CFVLSICFKQMAL
Sbjct: 197 VAAAAILFQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMAL 256

Query: 241 YYSPIFFAYLLGRCVFKTGI-RFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHR 299
           YY+PIFFA LL + +F   +   PRFLS+A AT+A+  VM+ PLYI G G  NVLQS+HR
Sbjct: 257 YYAPIFFAVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIFG-GVGNVLQSIHR 315

Query: 300 IFPFARGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKK 359
           IFPFARGIFEDKVANFWCVTN+F KYK +FTQ +LQ YSL+AT +GF PA ++++ YPKK
Sbjct: 316 IFPFARGIFEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKK 375

Query: 360 HLVPFALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTLW 419
            L+P+ LAACSM+FFLFSFQVHEK            +TSTNW+ LS+V W+NNV LFTLW
Sbjct: 376 FLIPYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLW 435

Query: 420 PLLKKDGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKS 479
           PLLKKDGL LQYCVC    NWL+GNFSF+TP FLPK LTPGPS+S++  NYRRRSLLP +
Sbjct: 436 PLLKKDGLWLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHN 495

Query: 480 IIWKLIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSL 539
           IIWK+II+ SY+ M  IHVL+  +A P  YPDLWV LNCT+GFGCF+LFW+W YYKL +L
Sbjct: 496 IIWKIIILVSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITL 555

Query: 540 AGQSLQQL 547
             +++Q+L
Sbjct: 556 RNKTIQEL 563

>TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON}
           Anc_6.22 YOR002W
          Length = 559

 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/546 (67%), Positives = 441/546 (80%), Gaps = 2/546 (0%)

Query: 4   KTSKKVEKAQADNTAE-ESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGP 62
           K + K + +  D T + E FYASPLY FL PFK   +QWL  YII+LFA+IIRCAIGLGP
Sbjct: 14  KQTHKNDISSLDETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGP 73

Query: 63  YSGQSVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSL 122
           YSG +  PM GDFEAQRHW+EITQHLPISQWY++DL+YWGLDYPPLTAYHSYI G +G  
Sbjct: 74  YSGMNEAPMFGDFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKF 133

Query: 123 INPDWFALNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIA 182
            NP WF L  SRG+E  +LKT+MR T I+SEVIFYIPA++YFT WVG+ R  SP+GQ+IA
Sbjct: 134 FNPAWFELETSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIA 193

Query: 183 AAAILFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYY 242
           AAAILFQP LMLIDHGHFQYN VMLG TVYAIN+L+D+ YAPAA  FV+SICFKQM+LYY
Sbjct: 194 AAAILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYY 253

Query: 243 SPIFFAYLLGRCVFKTGI-RFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIF 301
           +PIFFAYLLGR +FK       RFL+IA+AT+ +F  ++ PLY+ G G +N++QSVHRIF
Sbjct: 254 APIFFAYLLGRSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIF 313

Query: 302 PFARGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHL 361
           PFARGIFEDKVANFWCVTN+ +KYK  +TQ +LQLYSL+ T +GFLPA+V +L +PKKHL
Sbjct: 314 PFARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHL 373

Query: 362 VPFALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTLWPL 421
           +P++LAAC+MSFFLFSFQVHEK            YTST+W+VLSLVSWINNV LFTLWPL
Sbjct: 374 LPYSLAACAMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSLVSWINNVALFTLWPL 433

Query: 422 LKKDGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSII 481
           LKKDG+ LQY VCF   NWLIGNFSF TP FLPK LTPGP + +V+++YRRRSLLP +II
Sbjct: 434 LKKDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNII 493

Query: 482 WKLIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAG 541
           WK+IIV SYI M AI  L++FV PP  YPD++V+LNCTLGF CF  FWLWNYYKLF+L  
Sbjct: 494 WKIIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTS 553

Query: 542 QSLQQL 547
           ++LQ L
Sbjct: 554 KNLQYL 559

>SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 541

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/535 (68%), Positives = 439/535 (82%), Gaps = 1/535 (0%)

Query: 10  EKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSGQSVK 69
            K  +    +ESF+ASPL+DFL PF+PV +QW  +YII+LFA+IIRC +GLG +SG +V 
Sbjct: 5   RKPYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMNVP 64

Query: 70  PMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFA 129
           PMHGDFEAQRHW+E+T +LP+SQWY++DL YWGLDYPPLTAYHSYILGKLG + +P WF 
Sbjct: 65  PMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQ 124

Query: 130 LNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQ 189
           L VSRG ES DLK+YMRFTV+LSE++ YIP V+YF KW+G+HRG +P+GQ+IAAAAILFQ
Sbjct: 125 LGVSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQ 184

Query: 190 PALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAY 249
           P+L+LIDHGHFQYN VMLG TVYAIN+L+DE+YAPAA CFVLS+CFKQMALYY+PIFF+Y
Sbjct: 185 PSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIFFSY 244

Query: 250 LLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIFPFARGIFE 309
           LL + +F      PR L++A AT+ +F  M+ PLY+ G G +NVLQS+HRIFPF+RGIFE
Sbjct: 245 LLSKSLFSPLFNLPRLLAVAAATLISFAAMFFPLYMWG-GIRNVLQSIHRIFPFSRGIFE 303

Query: 310 DKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVPFALAAC 369
           DKVANFWC +NIF+KYK L+TQ QLQ+YSL ATALGFLPA +L+  YPKKHL+P+AL AC
Sbjct: 304 DKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYALTAC 363

Query: 370 SMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTLWPLLKKDGLAL 429
           SMSFFLFSFQVHEK            YTST+W+VLS+VSWINN+  FTLWPLLKKDGL L
Sbjct: 364 SMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVSWINNMAFFTLWPLLKKDGLVL 423

Query: 430 QYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWKLIIVGS 489
           QY       NWLIGNFSFVTP FLPKFLTPGPS S V  NYRRRSLLP +I WKLIIV S
Sbjct: 424 QYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLIIVAS 483

Query: 490 YISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQSL 544
           YISMG +H+LD +V PP  YPDLWV+LNC+LGF  F LFW+WNYYK+F+L  ++L
Sbjct: 484 YISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTL 538

>NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.22
           YOR002W
          Length = 580

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/551 (67%), Positives = 443/551 (80%), Gaps = 6/551 (1%)

Query: 3   SKTSKKVEKAQ--ADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGL 60
           +K SKK+   Q     T++ESFYASPLYDFLYPF+P GSQW+ EYII+LFA+IIRCA+GL
Sbjct: 30  TKKSKKMNNNQPLETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGL 89

Query: 61  GPYSGQSVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLG 120
           GPYSG +  PM GDFEAQRHW+EITQ+LPISQWY+FDL+YWGLDYPPLTA+HSY+ GK+G
Sbjct: 90  GPYSGFNTPPMFGDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIG 149

Query: 121 SLINPDWFALNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQF 180
           S   P+WF L  SRG E  DLKT+MR TV+ SE + YIPAVVYFTKW+G+ R  SP+GQF
Sbjct: 150 SFFQPNWFTLGDSRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQF 209

Query: 181 IAAAAILFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMAL 240
           IA AAILFQP+L+LIDHGHFQ+N VMLG TVY +N+L+DEFYA AA CFVLSICFKQMAL
Sbjct: 210 IAVAAILFQPSLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMAL 269

Query: 241 YYSPIFFAYLLGRCVFKTGI-RFPRFLSIAMATIATFLVMYIPLYIMG---SGSQNVLQS 296
           YYSPIFFAYLL + +F   +   PRF +I+ ATI TF  M+ P+Y  G    G  N+LQS
Sbjct: 270 YYSPIFFAYLLSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQS 329

Query: 297 VHRIFPFARGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLY 356
           + RIFPFARGIFEDKVANFWCVTN+  KYK  FTQ+QLQLYSL+ T + FLPA++++LLY
Sbjct: 330 IKRIFPFARGIFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLY 389

Query: 357 PKKHLVPFALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLF 416
           P+K+L+ +AL+ACSMSF+LFSFQVHEK            YTST+ +VLS VSW+NN+GLF
Sbjct: 390 PRKYLLLYALSACSMSFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLF 449

Query: 417 TLWPLLKKDGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLL 476
           TLWPLLKKDGL+LQY VC    NWLIGNFSF+TP FLPK LTPGPS+  +  NYRR +LL
Sbjct: 450 TLWPLLKKDGLSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLL 509

Query: 477 PKSIIWKLIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKL 536
           P + IWK+IIV SY+ MG IH +D F+ PP  YPDLWVILNCTLGFGCF+LFWLWNYYKL
Sbjct: 510 PSNWIWKVIIVLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKL 569

Query: 537 FSLAGQSLQQL 547
           FS+  +++ QL
Sbjct: 570 FSMTKKNIHQL 580

>KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 536

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/529 (66%), Positives = 431/529 (81%), Gaps = 1/529 (0%)

Query: 19  EESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSGQSVKPMHGDFEAQ 78
           +ESF+ASPLYDFL PF+PV +Q+  EY+I++FA++IRCA+GLG +SG++  PMHGDFEAQ
Sbjct: 9   KESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQ 68

Query: 79  RHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFALNVSRGLES 138
           RHW+E+T +LP+SQWY+FDL+YWGLDYPPLTAYHSY LGKLGS++NP+WFAL  SRG E+
Sbjct: 69  RHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRGNET 128

Query: 139 NDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPALMLIDHG 198
            +LK YMRFTVILSE   YIPAV+YFTKW G  R  SP+GQ+IAAAAILFQP+L+LIDHG
Sbjct: 129 PELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILIDHG 188

Query: 199 HFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLGRCVFKT 258
           HFQYN VMLG TVYAIN+L+D F+ PAA CF+LS+CFKQMAL+YSPIFFAYLL R +F  
Sbjct: 189 HFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLFSP 248

Query: 259 GIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIFPFARGIFEDKVANFWCV 318
             +F RF+S+A++T+ TF +M+ PLY+ G G +NVLQS+HRIFPF+RGIFEDKVANFWCV
Sbjct: 249 SFKFSRFMSVALSTVITFCLMFSPLYVFG-GMKNVLQSIHRIFPFSRGIFEDKVANFWCV 307

Query: 319 TNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVPFALAACSMSFFLFSF 378
           +N+ VKY   FTQ QLQ  S  ATA GFLP+  LV+LYPKKH++P+ LAACSM+FFLF F
Sbjct: 308 SNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFFLFGF 367

Query: 379 QVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTLWPLLKKDGLALQYCVCFAFC 438
           QVHEK            + ST+W+VL++VSWINNV LFTLWPLLKKD LALQY +     
Sbjct: 368 QVHEKSILVPLLPISLLFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIMMLLS 427

Query: 439 NWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWKLIIVGSYISMGAIHV 498
           NWLIGNFSFVTP FLP F+TPGPS+S+V   YRRRS LP +I+WK++I+ SYI M  IH+
Sbjct: 428 NWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMAVIHI 487

Query: 499 LDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQSLQQL 547
           LD+FV PP   PDLWV++NC LGF CF +FWLWN YKLF++  +S+  L
Sbjct: 488 LDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536

>Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {ON}
           YOR002W (ALG6) - glucosyltransferase [contig 185] FULL
          Length = 536

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/542 (65%), Positives = 434/542 (80%), Gaps = 8/542 (1%)

Query: 5   TSKKVEKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYS 64
             KKV K        E F+ASPLYDFL PF+PV +Q+  EY+I++FA++IRCA+GLG +S
Sbjct: 2   AGKKVSK-------NEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFS 54

Query: 65  GQSVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLIN 124
           G++  P+HGDFEAQRHW+E+T HLP+SQWY++DL+YWGLDYPPLTAYHSY+LGKLGSL+N
Sbjct: 55  GENSGPIHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLN 114

Query: 125 PDWFALNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAA 184
            +WFAL  SRG+E+ D+K YMRFTVILSE   YIPAV+YFTKW G  R  SP+GQ+IAAA
Sbjct: 115 SEWFALLSSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAA 174

Query: 185 AILFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSP 244
           AILFQP+L+LIDHGHFQYN VMLG TVY+IN+L+D +Y PAA CFVLS+CFKQMALYYSP
Sbjct: 175 AILFQPSLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSP 234

Query: 245 IFFAYLLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIFPFA 304
           +FFAYLL  C+    +  PRFLS+A +T+ +F +++ PLY+ G G++NVLQS+HRIFPF+
Sbjct: 235 VFFAYLLSECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFG-GTKNVLQSIHRIFPFS 293

Query: 305 RGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVPF 364
           RGIFEDKVANFWCV+N+  KY Q +TQQ+LQ +S++ATA GFLP+ ++VL YPKKH++PF
Sbjct: 294 RGIFEDKVANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPF 353

Query: 365 ALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTLWPLLKK 424
           ALAACSM+FFLFSFQVHEK            Y ST+W+VLS+VSWINNV LFTLWPLLKK
Sbjct: 354 ALAACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKK 413

Query: 425 DGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWKL 484
           D L LQY +     NWLIGNFSFVTP FLPKF+TPGPS+S V   YRRRS LP +  WKL
Sbjct: 414 DHLTLQYGILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKL 473

Query: 485 IIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQSL 544
           IIV SY+ M AIH+LD FV  P   PDLWV+LNC LGF CF +FWLW +YKLF++   +L
Sbjct: 474 IIVASYLIMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNL 533

Query: 545 QQ 546
           Q 
Sbjct: 534 QD 535

>Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON}
           similar to Ashbya gossypii ACR004W
          Length = 549

 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/549 (64%), Positives = 433/549 (78%), Gaps = 5/549 (0%)

Query: 3   SKTSKKVEKAQADNT----AEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAI 58
           S +S  V   +  +T     EESF+ASPLYDFLYP +PV +QW  +YII++FA+I+R A+
Sbjct: 2   SGSSGAVASEKGQDTRRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAV 61

Query: 59  GLGPYSGQSVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGK 118
           GLG YSG+   P+ GDFEAQRHW+EIT  LPIS+WY++DLEYWGLDYPPLTAYHSYILG+
Sbjct: 62  GLGGYSGKGKGPLFGDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGR 121

Query: 119 LGSLINPDWFALNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVG 178
           LGS +N  WF LN SRG ES DLK++MR TV+LSE++ YIPAV+YFT+W+GRHR  SP+G
Sbjct: 122 LGSFVNATWFKLNTSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIG 181

Query: 179 QFIAAAAILFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQM 238
           Q++A AAILFQP+L+LIDHGHFQYNCVMLG  VY IN+L+DEFY  AA CFVLS+ FKQM
Sbjct: 182 QYVACAAILFQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQM 241

Query: 239 ALYYSPIFFAYLLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVH 298
           ALYYSP+ FAYL  R  +     FPRF  IA+AT+ TF  +Y PL + G   +N++QSV+
Sbjct: 242 ALYYSPVIFAYLFSRSAYYPRFNFPRFAGIAIATLLTFGALYAPLCLFGD-FRNIIQSVY 300

Query: 299 RIFPFARGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPK 358
           R+FPF+RGIFEDKVANFWCVTN+ +KY++L+TQ+QLQ Y LL TA+   PA +++ LYPK
Sbjct: 301 RVFPFSRGIFEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTAIAQFPAFIIIFLYPK 360

Query: 359 KHLVPFALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTL 418
           K L+P+ALAACSM+FFLFSFQVHEK            + STNWDVLS+V+WINNV LFTL
Sbjct: 361 KFLLPYALAACSMAFFLFSFQVHEKTILVPLLPITLLHISTNWDVLSMVAWINNVALFTL 420

Query: 419 WPLLKKDGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPK 478
           WPLLKKDGL LQY + F   NWL+GNFSFVTPTFLPKFLTPGPSVS V  +YRRRSLLPK
Sbjct: 421 WPLLKKDGLLLQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPK 480

Query: 479 SIIWKLIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFS 538
           +I W++IIV SY+ M  IH+LD++V PP NYPD+WV+  C LGF CF  FWLWNYY+L+ 
Sbjct: 481 NIFWRIIIVSSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYR 540

Query: 539 LAGQSLQQL 547
           +   SL +L
Sbjct: 541 MRNSSLNEL 549

>ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR002W (ALG6)
          Length = 563

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/548 (61%), Positives = 427/548 (77%), Gaps = 3/548 (0%)

Query: 2   PSKT--SKKVEKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIG 59
           PSK    K +         +E+F+ASPLYDFLYP +PV +QW  +YII++FA+IIR A+G
Sbjct: 17  PSKEPGQKGIATDAKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVG 76

Query: 60  LGPYSGQSVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKL 119
           LG YSG    PM GDFEAQRHW+E+TQH+P+S+WY+  L+YWGLDYPPLTAYHSY+LGKL
Sbjct: 77  LGGYSGMGKPPMFGDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKL 136

Query: 120 GSLINPDWFALNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQ 179
           GS I+P+WF+L+ SRG ES DLK+YMR TVILSE+ FYIPAV+YFT+W+GR R  SP+GQ
Sbjct: 137 GSYISPEWFSLHASRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQ 196

Query: 180 FIAAAAILFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMA 239
           +IA AAILFQPAL+LIDHGHFQYNCVMLG TV AIN+L+D++YA AA  FV S+ FKQMA
Sbjct: 197 YIAGAAILFQPALILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMA 256

Query: 240 LYYSPIFFAYLLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHR 299
           LYY+P+ F YLL R ++   +  PRF+++A+AT+  F V+Y PLY++G+ S  + QS+HR
Sbjct: 257 LYYAPVMFVYLLSRSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNISA-IFQSIHR 315

Query: 300 IFPFARGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKK 359
           +FPF RG+FEDKVANFWCVTN+ VKYK  +T  QL+ +SL+ T+   LP++++  LYPKK
Sbjct: 316 VFPFERGLFEDKVANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKK 375

Query: 360 HLVPFALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTLW 419
            ++P+ALAACSMSFFLF FQVHEK            YTST+W+VLS+V+WINN+ LFTLW
Sbjct: 376 FMLPYALAACSMSFFLFGFQVHEKTILVPLLPITLLYTSTDWNVLSMVAWINNIALFTLW 435

Query: 420 PLLKKDGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKS 479
           PLLKKDGL+LQY + F   NWLIGNFSF+TPTFLPK LTPGPSVS V   YRRRSLLP +
Sbjct: 436 PLLKKDGLSLQYAIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSN 495

Query: 480 IIWKLIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSL 539
           IIW++IIV SYI +GAIH+ +++  P    PD+WV+ NC +G   F LFW+WN YK+F++
Sbjct: 496 IIWRIIIVVSYICVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAM 555

Query: 540 AGQSLQQL 547
              ++  L
Sbjct: 556 RNSTISDL 563

>YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON}
           ALG8Glucosyl transferase, involved in N-linked
           glycosylation; adds glucose to the dolichol-linked
           oligosaccharide precursor prior to transfer to protein
           during lipid-linked oligosaccharide biosynthesis;
           similar to Alg6p
          Length = 577

 Score =  124 bits (310), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 78/260 (30%), Positives = 122/260 (46%), Gaps = 25/260 (9%)

Query: 74  DFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFALNVS 133
           DF+  R+WL IT  LPIS+WYY     W LDYPP  AY  + L +       D   L++ 
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKSVRDDGCLDIV 125

Query: 134 R-GLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPAL 192
             G        + R TVI SE++ ++   +Y        R  S    F+ A++I+  P  
Sbjct: 126 EIGKFGLPTIVFQRLTVIFSEILLFVILQIYINTTKLSERSQS----FVVASSIVLSPGF 181

Query: 193 MLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLG 252
           ++IDH HFQYN  +    + +I +  ++ Y   A  +  +ICFK + LY +P +F +LL 
Sbjct: 182 LIIDHIHFQYNGFLFAILIGSIVAAKNKRYILCAVLYTTAICFKHIFLYLAPCYFVFLLR 241

Query: 253 RCVFKTG-------------IRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHR 299
             V                 IR+   L +A   +  F + ++P       +  + Q + R
Sbjct: 242 AYVLNVNNFKFKSYKDFLFLIRWANLLKLATVVVGIFTICFLPF------AHQMPQVLSR 295

Query: 300 IFPFARGIFEDKVA-NFWCV 318
           +FPF+RG+     A NFW +
Sbjct: 296 LFPFSRGLTHAYWAPNFWAL 315

>Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  122 bits (305), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 79/260 (30%), Positives = 120/260 (46%), Gaps = 25/260 (9%)

Query: 74  DFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFALN-V 132
           DF+  R+WL IT  LPIS+WYY     W LDYPP  AY  + L +    +  D   L+ V
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 133 SRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPAL 192
             G        + R TVI SE++ Y    +Y        R  S    F+ A++I+  P  
Sbjct: 126 EVGKFGLPTIVFQRLTVIFSEILLYAVLQIYINTTKLSERSQS----FVVASSIVLSPGF 181

Query: 193 MLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLG 252
           ++IDH HFQYN  +    + +I +  ++ Y   A  +  +ICFK + LY +P +F +LL 
Sbjct: 182 LMIDHIHFQYNGFLFAILIGSIVAAKNKKYLLCAFLYTTAICFKHIFLYLAPCYFVFLLR 241

Query: 253 RCVFKTG-------------IRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHR 299
             V                 IR+     +    I  F + ++P       +  + Q + R
Sbjct: 242 AYVLNVNNFKFKSYKDFLFLIRWANLFKLGSIVIGIFTICFVPF------AHQMPQVLSR 295

Query: 300 IFPFARGIFEDKVA-NFWCV 318
           +FPF+RG+     A NFW +
Sbjct: 296 LFPFSRGLTHAYWAPNFWAL 315

>TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {ON}
           Anc_5.669 YOR067C
          Length = 575

 Score =  121 bits (303), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/260 (30%), Positives = 125/260 (48%), Gaps = 25/260 (9%)

Query: 74  DFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFALN-V 132
           DF+  R+WL IT +LPIS+WYY +   W LDYPP  AY  ++L +    I  +   L+ V
Sbjct: 64  DFDVHRNWLAITSNLPISKWYYENTSEWTLDYPPFFAYFEWVLSRFAPEIVKNDGCLDIV 123

Query: 133 SRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPAL 192
             G        + R TVI+SE++ +     Y      + RG      F+ A++I+  P  
Sbjct: 124 EVGQFGLPTIVFQRLTVIISEILLFAVLQYYINTSNSKERGQC----FVVASSIVLSPGF 179

Query: 193 MLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLG 252
           ++IDH HFQYN  +    + +I +   + Y   A  + +S+CFK + LY +P +F +LL 
Sbjct: 180 LIIDHIHFQYNGFLFAIFIASIVAAKQKKYLACAVFYSISLCFKHIFLYLAPCYFVFLLR 239

Query: 253 RCV-------------FKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHR 299
             V              ++ I++ R   +A      F + + P          + Q + R
Sbjct: 240 AYVLNFENFKFKSYMDLQSVIQWKRLFKLAGIVSGIFTICFAPFIF------QLPQVLSR 293

Query: 300 IFPFARGIFEDKVA-NFWCV 318
           +FPF+RG+     A NFW +
Sbjct: 294 LFPFSRGLTHAYWAPNFWAM 313

>Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON}
           YOR067C (REAL)
          Length = 576

 Score =  120 bits (301), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 78/260 (30%), Positives = 120/260 (46%), Gaps = 25/260 (9%)

Query: 74  DFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFALN-V 132
           DF+  R+WL IT  LP+S+WYY     W LDYPP  AY  + L +    +  D   L+ V
Sbjct: 66  DFDVHRNWLAITNKLPMSEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 133 SRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPAL 192
             G        + R TVI SE++ +    +Y        R  S    F+ A++I+  P  
Sbjct: 126 EVGKFGLPTIVFQRLTVIFSEILLFAVLQIYINTTKLSERSQS----FVVASSIVLSPGF 181

Query: 193 MLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLG 252
           ++IDH HFQYN  +    + +I +  ++ Y   A  +  SICFK + LY +P +F +LL 
Sbjct: 182 LMIDHIHFQYNGFLFAILIGSIVAAKNKKYLWCAVLYTTSICFKHIFLYLAPCYFVFLLR 241

Query: 253 RCVFKTG-------------IRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHR 299
             V                 IR+     +    I  F + ++P       +  + Q + R
Sbjct: 242 AYVLNVNNFKFKSYKDFLFLIRWTNLFKLGSIVIGIFTICFLPF------AHQMPQVLSR 295

Query: 300 IFPFARGIFEDKVA-NFWCV 318
           +FPF+RG+     A NFW +
Sbjct: 296 LFPFSRGLTHAYWAPNFWAL 315

>Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  119 bits (298), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 78/260 (30%), Positives = 119/260 (45%), Gaps = 25/260 (9%)

Query: 74  DFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFALN-V 132
           DF+  R+WL IT  LPIS+WYY     W LDYPP  AY  + L +    +  D   L+ V
Sbjct: 66  DFDVHRNWLAITNKLPISKWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 133 SRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPAL 192
             G        + R TVI S+++ ++   VY        R  S    F+ A++I+  P  
Sbjct: 126 EVGKFGLPTIVFQRLTVIFSDILLFVVLQVYINTTDLSERSQS----FVVASSIVLSPGF 181

Query: 193 MLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLG 252
            +IDH HFQYN  +    + +I +   + Y   A  +  +ICFK + LY +P +F +LL 
Sbjct: 182 FMIDHIHFQYNGFLFAILIGSIVAAKKKRYILCAILYTTAICFKHIFLYLAPCYFVFLLR 241

Query: 253 RCVFKTG-------------IRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHR 299
             V                 IR+     +    I  F + ++P       +  + Q + R
Sbjct: 242 AYVLNVNNFKFKSYKDFLFLIRWANLFKLGSIVIGIFTICFLPF------AHQMPQVLSR 295

Query: 300 IFPFARGIFEDKVA-NFWCV 318
           +FPF+RG+     A NFW +
Sbjct: 296 LFPFSRGLTHAYWAPNFWAL 315

>KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 555

 Score =  117 bits (293), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 107/415 (25%), Positives = 173/415 (41%), Gaps = 75/415 (18%)

Query: 74  DFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGK-LGSLINPDWFALNV 132
           DF+  R+WL IT  LP+ +WYY     W LDYPP  AY  ++L + +   +  D     V
Sbjct: 44  DFDVHRNWLAITNKLPLHKWYYESTSQWTLDYPPFFAYFEWLLSQFVPQRVQDDGCLDIV 103

Query: 133 SRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPAL 192
           + G        + R TVI+SE++ ++   VY  K     R       F+ A++I+  P  
Sbjct: 104 AVGQFGLPTIVFQRVTVIVSEILLFVVLQVYINKSHISDRS----ANFVVASSIVLSPGF 159

Query: 193 MLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLG 252
           ++IDH HFQYN  +    + +I +   + Y      F  ++CFK + LY +P FFA+LL 
Sbjct: 160 LIIDHIHFQYNGFLFAILIASIVAAKHQRYLLCGFFFSTALCFKHIFLYLAPSFFAFLLR 219

Query: 253 RCV-------FKT------GIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHR 299
             +       F+T       +R+     +    ++ F V + P          + Q + R
Sbjct: 220 VYILDFSNFRFRTYNDLISMVRWKNLFKLGTVVLSVFAVCFAPFI------YQLPQLMSR 273

Query: 300 IFPFARGIFEDKVA-NFWCVTNIFVKYKQLF--------------------------TQQ 332
           +FPF+RG+     A NFW + +   K   LF                           + 
Sbjct: 274 LFPFSRGLTHAYWAPNFWALYSALDKVLTLFFLKVPYVHKFLTQVVSPPLIPVTIDEIKT 333

Query: 333 QLQLYSLLATAL------GFLPAV------VLVLLYPKKHLVPF-----------ALAAC 369
           +LQ Y++    L        LP +      +L L Y    ++P            +L  C
Sbjct: 334 KLQQYNVGTKGLVQDVYFVILPQIQPKLTFILTLFYQILAVIPVLFSPSFERFVGSLTLC 393

Query: 370 SMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTLWPLLKK 424
             + FLF + VHEK             T T+  +L+    + + G  +L+PLL +
Sbjct: 394 GFASFLFGWHVHEKAVLLIIIPFSFLVT-TDRRLLTPFHLVASAGYVSLFPLLHE 447

>Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {ON}
           YOR067C (ALG8) - glycosyl transferase [contig 126] FULL
          Length = 555

 Score =  116 bits (291), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 109/417 (26%), Positives = 176/417 (42%), Gaps = 73/417 (17%)

Query: 71  MHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKL-GSLINPDWFA 129
           +  DF+  R+WL IT  LP+ QWY+ +   W LDYPP  AY  + L +L  +++  D   
Sbjct: 41  LSTDFDVHRNWLAITNKLPLKQWYFENTSQWTLDYPPFFAYFEWALSQLVPNIVRQDGCL 100

Query: 130 LNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQ 189
             V  G        + R TVI SE++ ++   VY  K     R       F+ A++I+  
Sbjct: 101 DIVKVGQFGMPTIVFQRLTVIASEILLFVVLQVYINKSHISERS----ANFVVASSIVLS 156

Query: 190 PALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAY 249
           P  ++IDH HFQYN  +    + +I +  ++ Y      F ++ICFK + LY +P FF +
Sbjct: 157 PGFLIIDHIHFQYNGFLFAILIASIVAAKEQRYLLCGLFFSIAICFKHIFLYLAPSFFVF 216

Query: 250 LLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVL------------QSV 297
           LL   V    + F  F   +   + + +V +  L+ +GS    V             Q +
Sbjct: 217 LLRVYV----LDFSNFHFKSYNDLIS-IVQWRNLFKLGSVVLCVFGVCFAPFISQWPQLL 271

Query: 298 HRIFPFARGIFEDKVA-NFWCVTNIFVKYKQLF--------------------------T 330
            R+FPF+RG+     A NFW + ++  K   L                            
Sbjct: 272 SRLFPFSRGLTHAYWAPNFWAMYSLLDKVLTLIILKVPYVHKFLTQFIAPPLIPATIGEI 331

Query: 331 QQQLQLYSLLATAL------GFLPAV------VLVLLYPKKHLVPF-----------ALA 367
           +Q+L  Y++    L        LP +      +L L Y    ++P            +L 
Sbjct: 332 KQKLLQYNVGTKGLVQDVYFVILPQIQPRLTFILTLFYQILAIIPVLFSPSFKRFVGSLT 391

Query: 368 ACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTLWPLLKK 424
            C  + FLF + VHEK             TS    +L+  + + + G  +L+PLL +
Sbjct: 392 LCGFASFLFGWHVHEKAIMLIIIPFSFLVTSDR-RLLTPFNLLASAGYVSLFPLLHE 447

>ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR067C
           (ALG8)
          Length = 572

 Score =  115 bits (288), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/286 (28%), Positives = 131/286 (45%), Gaps = 26/286 (9%)

Query: 74  DFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKL-GSLINPDWFALNV 132
           DFE  R+WL +T  LP+ +WY      W +DYPPL A+  + L ++    +  D     V
Sbjct: 59  DFEVHRNWLAVTHRLPLRKWYVDATSQWTMDYPPLFAWLEWALSQVVPGAVRRDGCLKLV 118

Query: 133 SRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPAL 192
           + G        + R TVI SEV+ Y+   VY +    + R ++    F+   ++   PA 
Sbjct: 119 AEGRYGWPTVVFQRLTVIASEVLLYVVLQVYVSSSAAQERTVN----FVVTTSVALSPAF 174

Query: 193 MLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLG 252
           +L+DH HFQYN  +    V +I +  +  Y    A F +++C K + LY +P +F +LL 
Sbjct: 175 LLVDHIHFQYNGFLFAVLVASIVAARERRYVLCGALFTVALCLKHIFLYLAPAYFVFLLR 234

Query: 253 RCVFKTG-------------IRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHR 299
             V   G             +R+     +    +A   V + P       +  + Q + R
Sbjct: 235 AYVLDLGEFRFRSYRDLVFAVRWGNLCRLGGVVLAIMAVTFAPF------AGVMPQLMAR 288

Query: 300 IFPFARGIFEDKVA-NFWCVTNIFVKYKQLFTQQQLQLYSLLATAL 344
           +FPF+RG+     A NFW + + FV     F   ++     LAT+L
Sbjct: 289 LFPFSRGLTHAYWAPNFWAIYS-FVDKVLTFLMLRVPYVYKLATSL 333

>TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON}
           Anc_5.669 YOR067C
          Length = 546

 Score =  114 bits (285), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 103/405 (25%), Positives = 175/405 (43%), Gaps = 50/405 (12%)

Query: 74  DFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGK-LGSLINPDWFALNV 132
           DF+  R+WL IT  LP+ +WYY +   W LDYPP  AY  + L + +   +  D     +
Sbjct: 43  DFDVHRNWLAITNKLPLREWYYENTSQWTLDYPPFFAYFEWFLSQFVPKFVKEDGCLDIL 102

Query: 133 SRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPAL 192
             G        + R TVI+SE++ ++   V+        +  S    F+ A++I+  P  
Sbjct: 103 PEGEFGWSTIVFQRLTVIISEILLFVVLQVFINNSGSNEKTQS----FVVASSIILSPGF 158

Query: 193 MLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLG 252
           ++IDH HFQYN  + G  + +I +  ++ Y      + +++CFK + LY +P +F +LL 
Sbjct: 159 LMIDHIHFQYNGFLFGILIASIVAAKNKRYLLCGLFYSIALCFKHIFLYLAPCYFVFLLR 218

Query: 253 RCVFK-TGIRFPRFLSIAMATIATFLVMY--IPLYIMGSGS----QNVLQSVHRIFPFAR 305
             V      +F  +  + +      L+    I + +MG       +++ Q + R+FPF+R
Sbjct: 219 AYVLNFQDFKFKSYKDLILVVQWGNLMKLGGIVVCVMGVCFGPFWRDMNQLLSRLFPFSR 278

Query: 306 GI--------------FEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATAL------G 345
           G+              F DK+ +   V   F K+  L   ++ + ++  +  L       
Sbjct: 279 GLTHAYWAPNFWAIYSFVDKMLSILFVRVPFNKFINLDKIEERKRWNNGSRGLVEDVFFV 338

Query: 346 FLPAV------VLVLLYPKKHLVPF-----------ALAACSMSFFLFSFQVHEKXXXXX 388
            LP +      VL L Y    +VP            +L  C  + FLF + VHEK     
Sbjct: 339 ILPQIQPNLTFVLTLFYQVLAVVPVLFDPSFKRFIGSLTLCGFASFLFGWHVHEKAILLV 398

Query: 389 XXXXXXXYTSTNWDVLSLVSWINNVGLFTLWPLLKKDGLALQYCV 433
                         +LS    + + G  +L+PLL K    L  C+
Sbjct: 399 IIPFSFLVVCDR-RLLSSFMLVGSAGYVSLFPLLFKGQDFLLKCL 442

>CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa]
           {ON} similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067c ALG8 Glucosyltransferase
          Length = 550

 Score =  114 bits (285), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/260 (29%), Positives = 121/260 (46%), Gaps = 25/260 (9%)

Query: 74  DFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGK-LGSLINPDWFALNV 132
           DF+  R+WL IT  LP+ QWYY     W LDYPP  AY  + L + + S +  D     V
Sbjct: 36  DFDVHRNWLAITNKLPLRQWYYEHTSQWTLDYPPFFAYFEWFLSQFVPSYVKSDGCLDIV 95

Query: 133 SRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPAL 192
             G        + R TVI SE++ ++   VY        R  S    F+ A++I   P  
Sbjct: 96  EVGQFGMPTVVFQRLTVIASEILLFVVLQVYINTSKVSERTQS----FVVASSIAISPGF 151

Query: 193 MLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLG 252
           ++IDH HFQYN  +    + +I +  ++ Y      + +++CFK + LY +P +F +LL 
Sbjct: 152 LIIDHIHFQYNGFLFAILIASIVAAKNKKYLWCGFFYSVALCFKHIYLYLAPCYFVFLLR 211

Query: 253 RCVFKTG-------------IRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHR 299
             V                 +++   + +    IATF V + P         ++ Q + R
Sbjct: 212 AYVLNLKDFKFKSYRDLIFIVKWRHLVKLGSVVIATFAVAFGPFIF------DLPQLLTR 265

Query: 300 IFPFARGIFEDKVA-NFWCV 318
           +FPF+RG+     A NFW +
Sbjct: 266 LFPFSRGLTHAYWAPNFWAI 285

>KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 561

 Score =  114 bits (285), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 83/291 (28%), Positives = 139/291 (47%), Gaps = 27/291 (9%)

Query: 74  DFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFALNVS 133
           DF+  R+WL IT  LP+++WY      W LDYPP  AY  + L +       +   L++ 
Sbjct: 52  DFDVHRNWLAITNKLPLNKWYVESTSQWTLDYPPFFAYFEWFLSQFVPKSVAEDGCLDIV 111

Query: 134 RGLESNDLKT--YMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPA 191
           + + S  L T  + R TVILSE++ Y    V+        +       F+ A++I+  P 
Sbjct: 112 K-VGSFGLPTIIFQRITVILSELVLYAALQVFINTSDISEKS----ANFVVASSIVLSPG 166

Query: 192 LMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFF---- 247
           L+++DH HFQYN  + G  + +I +  ++ Y   AA F +++CFK + LY +P +F    
Sbjct: 167 LLIVDHIHFQYNGFLFGILISSIVAAKNKRYILCAAFFSIALCFKHIFLYLAPAYFVFLL 226

Query: 248 -AYLLGRCVFK--------TGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVH 298
            AY+L    FK        + +++   L +A   +  F + ++P            Q + 
Sbjct: 227 RAYVLDFSSFKFRSYKDLISIVQWSNLLKLASVVMGIFSLAFLPFITTWQ------QLLA 280

Query: 299 RIFPFARGIFEDKVA-NFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLP 348
           R+FPF+RG+     A N W V +   K   +   +   L  +L+  L  +P
Sbjct: 281 RLFPFSRGLTHAYWAPNVWAVYSFTDKVLTVLVLKLPYLQKILSIVLTSMP 331

>TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.669
           YOR067C
          Length = 569

 Score =  114 bits (285), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 78/267 (29%), Positives = 128/267 (47%), Gaps = 27/267 (10%)

Query: 74  DFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFALNVS 133
           DF+  R+WL IT  LP+ +WYY     W LDYPP  AY  ++L +    I  +  AL++ 
Sbjct: 55  DFDVHRNWLAITNELPLKEWYYEKTSQWTLDYPPFFAYFEWLLSQFVPKIVKEDGALDIV 114

Query: 134 R-GLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPAL 192
             G        + R TVI SEV+ ++   V+    V           F+ A++I+  P  
Sbjct: 115 EIGQFGWPTVVFQRLTVIFSEVLLFVVLQVF----VNTSSATEKTRSFVVASSIVLSPGF 170

Query: 193 MLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLG 252
           ++IDH HFQYN  +    + +I +   + Y   A  + +++CFK + LY +P +F +LL 
Sbjct: 171 LMIDHIHFQYNGFLFAPLIASIVAAKHKKYMWCATFYAIALCFKHIFLYLAPCYFVFLLR 230

Query: 253 RCV-------FKTG------IRFPRFLSIAMATIATFLVMYIP-LYIMGSGSQNVLQSVH 298
             V       FK+       +++     +A   +  F + + P LY       ++ Q + 
Sbjct: 231 AYVLNFKNFEFKSYKDLIFIVQWKHLFKMASVVLGIFFICFGPFLY-------DLPQVMT 283

Query: 299 RIFPFARGIFEDKVA-NFWCVTNIFVK 324
           R+FPF+RG+     A NFW + +   K
Sbjct: 284 RLFPFSRGLTHAYWAPNFWAIYSFLDK 310

>ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 556

 Score =  113 bits (283), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 78/266 (29%), Positives = 129/266 (48%), Gaps = 25/266 (9%)

Query: 74  DFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGK-LGSLINPDWFALNV 132
           DF+  R+WL IT +LP+ QWYY     W LDYPP  AY  + L + +   +  D     V
Sbjct: 45  DFDVHRNWLAITHNLPLRQWYYEATSQWTLDYPPFFAYFEWFLSQFVPGTVKQDGCLEIV 104

Query: 133 SRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPAL 192
            +G        + R TVILSE++ ++   V+        R  S    F+ A++I+  PA 
Sbjct: 105 DKGQFGWSTLVFQRSTVILSEILLFVVLQVFINTSSVTERTQS----FVIASSIVLSPAF 160

Query: 193 MLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLL- 251
           +++DH HFQYN  +    + +I +     Y   A  + +++CFK + LY +P +F +LL 
Sbjct: 161 LIVDHIHFQYNGFLFAILIASIVAAKRGKYLWCATFYSVALCFKHIFLYLAPCYFVFLLR 220

Query: 252 GRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGS------------GSQNVLQSVHR 299
             C+     +F  +  +       F+V +  L+ +GS              +++ Q + R
Sbjct: 221 AYCLNFQDFKFKSYKDL------IFIVKWRHLFQLGSIVIGVFALCFGPFVKDLPQVLTR 274

Query: 300 IFPFARGIFEDKVA-NFWCVTNIFVK 324
           +FPF+RG+     A NFW + +   K
Sbjct: 275 LFPFSRGLTHAYWAPNFWALYSFLDK 300

>SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly
           similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067C ALG8 adds glucose to the dolichol- linked
           oligosaccharide precursor prior to transfer to protein
           glycosyl transferase
          Length = 561

 Score =  113 bits (283), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 91/307 (29%), Positives = 137/307 (44%), Gaps = 46/307 (14%)

Query: 74  DFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFALN-V 132
           DF+  R+WL IT  LP+ +WY      W LDYPP  AY  + L +    I  D   L+ V
Sbjct: 48  DFDVHRNWLAITNKLPLREWYIEATSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDIV 107

Query: 133 SRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPAL 192
             G        + R TVI+SEV+ ++   ++  K     +       FI A++I+  P  
Sbjct: 108 EVGNFGMPTIIFQRITVIVSEVLLFVVLQIFINKSATNEKS----ANFIVASSIVLSPGF 163

Query: 193 MLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFF----- 247
           +++DH HFQYN  +    + AI +     Y    A F  ++CFK + LY +P FF     
Sbjct: 164 LIVDHIHFQYNGFLFAILIAAIVAAKHHRYLLCGAFFATALCFKHIFLYLAPSFFVFLLR 223

Query: 248 AYLLGRCVFK--------TGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHR 299
           AY+L    FK        + +++ R L + +  +  F V + P          + Q + R
Sbjct: 224 AYILDFTNFKFKSYKDLVSIVKWQRALKLGLVVLGIFAVCFAPFI------SEMPQLLER 277

Query: 300 IFPFARGIFEDKVA-NFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPK 358
           +FPF+RG+     A NFW                   LYSLL   L F   V+L L Y  
Sbjct: 278 LFPFSRGLTHAYWAPNFWA------------------LYSLLDKVLTF---VMLRLPYVH 316

Query: 359 KHLVPFA 365
           + ++ F 
Sbjct: 317 RFIIKFV 323

>Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa]
           {ON} complement(205615..207480) [1866 nt, 622 aa]
          Length = 621

 Score =  112 bits (279), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 76/260 (29%), Positives = 123/260 (47%), Gaps = 25/260 (9%)

Query: 74  DFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFALN-V 132
           DF+  R+W+ IT  LPIS+WY+ +   W LDYPP  AY  + L +    I  D   L+ V
Sbjct: 109 DFDVHRNWMAITNALPISKWYFENTSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDIV 168

Query: 133 SRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPAL 192
             G        + R TVI+SE+  +     Y        R  S    F+ A++I+  P  
Sbjct: 169 EVGQFGWPTVVFQRLTVIISEICLFAVLQYYINTSNLNERTQS----FVVASSIVLSPGF 224

Query: 193 MLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLG 252
           +++DH HFQYN  +    + +I +   + Y   A  + +++CFK + LY +P +F +LL 
Sbjct: 225 LIVDHIHFQYNAFLFSILIASIVAAKQKKYIACAVFYTIALCFKHIFLYLAPCYFVFLLR 284

Query: 253 RCV-------FKTG------IRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHR 299
             V       FK+       +++ R L +    +  F + + P          + Q + R
Sbjct: 285 AYVLNFKDFKFKSYKDLIFIVQWRRLLKLGSIVLGIFGICFAPFIF------QMPQVLSR 338

Query: 300 IFPFARGIFEDKVA-NFWCV 318
           +FPF+RG+     A NFW +
Sbjct: 339 LFPFSRGLTHAYWAPNFWAI 358

>NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  111 bits (277), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 120/254 (47%), Gaps = 13/254 (5%)

Query: 74  DFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFALNVS 133
           DF+  R+WL +T  LP+ QWYY     W LDYPP  AY  +I+ +    +  D   L++ 
Sbjct: 56  DFDVHRNWLAVTNKLPLKQWYYEHTSQWTLDYPPFFAYFEWIISQFVPQVVRDDGCLDIV 115

Query: 134 R-GLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPAL 192
             G        + R +VI SE++ ++    +      + R  S    FI A +I+  P  
Sbjct: 116 EIGKFGEPTVIFQRLSVITSEILLFVVLQWFINTSNVKERTQS----FIVATSIILSPGF 171

Query: 193 MLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLG 252
           +++DH HFQYN  +    + +I +   + Y   A  +  ++CFK + LY +P +F +LL 
Sbjct: 172 LIVDHIHFQYNGFLFSILIASIVAAKQKRYILCAVFYTTALCFKHIFLYLAPCYFVFLLR 231

Query: 253 RCVFKT-GIRFPRFLSIAMATIATFL------VMYIPLYIMGSGSQNVLQSVHRIFPFAR 305
             V    G +F  +  +      T L      V+ I     G    ++ Q + R+FPF+R
Sbjct: 232 AYVLNVKGFQFKSYKDLVRLVQWTNLFRLAGVVLSIVGVCFGPFIFDMPQLLTRLFPFSR 291

Query: 306 GIFEDKVA-NFWCV 318
           G+     A NFW +
Sbjct: 292 GLTHAYWAPNFWAI 305

>Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar to
           Ashbya gossypii ADR210C
          Length = 604

 Score =  109 bits (273), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/260 (28%), Positives = 122/260 (46%), Gaps = 25/260 (9%)

Query: 74  DFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFALN-V 132
           D E  R+WL +T  LP+  WY      W LDYPP  AY  ++L +    +  D   L+ V
Sbjct: 93  DLEVHRNWLALTNKLPLLDWYREATSQWTLDYPPFFAYFEWVLSQFVPAVVRDDGCLDIV 152

Query: 133 SRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPAL 192
             G        ++R TVI +E++ ++   V+        R ++    FI A++I   P  
Sbjct: 153 KEGKFGWPTVVFLRLTVIGTEILLFVVLQVFINTSDESERTVN----FIIASSIALSPGF 208

Query: 193 MLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLG 252
           +++DH HFQYN  +    + +I +   E Y    A F   +CFK + LY +P +F +LL 
Sbjct: 209 LIVDHMHFQYNGFLFAILIASIVAAKKERYLLCGAFFTTVLCFKHIFLYLAPAYFTFLLR 268

Query: 253 RCV-------FKT------GIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHR 299
             V       F+T       +R+   L + +  ++   V ++P   +      + Q + R
Sbjct: 269 AYVLNFSNFSFRTYRDLIFVVRWFNLLKLGVIIVSILAVCFVPFIPV------LPQLISR 322

Query: 300 IFPFARGIFEDKVA-NFWCV 318
           +FPF+RG+     A NFW V
Sbjct: 323 LFPFSRGLTHAYWAPNFWAV 342

>NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  108 bits (269), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 102/431 (23%), Positives = 169/431 (39%), Gaps = 77/431 (17%)

Query: 74  DFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFALN-V 132
           DF+  R+WL IT  LP+ +WYY     W LDYPP  AY  + + +    +  D   L+ V
Sbjct: 54  DFDVHRNWLAITNKLPLKEWYYEHTSQWTLDYPPFFAYFEWFMSQFVPKVVRDDGCLDIV 113

Query: 133 SRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPAL 192
             G        + R +VI+SE++ ++    +  K     R  S    FI A +I+  P  
Sbjct: 114 PVGQFGWATVVFQRTSVIISEILLFVVLQWFINKSKDNERTQS----FIVATSIILSPGF 169

Query: 193 MLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLG 252
           ++IDH HFQYN  +    + +I +   E Y      + +++CFK + LY +P +F +LL 
Sbjct: 170 LIIDHIHFQYNGFLFAILIASIVAAKQERYLLCGLFYSIALCFKHIFLYLAPCYFVFLLR 229

Query: 253 RCVFKTG-------------IRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHR 299
             V                 I++     +    ++ F + ++P         ++ Q   R
Sbjct: 230 AYVLNVKNFKFKSYKDLILLIQWNNLFKLGGIVLSIFGICFLPFI------YHLPQVFTR 283

Query: 300 IFPFARGI--------------FEDKVANFW-------------CVTNIFVKYKQLFTQQ 332
           +FPF RG+              F DK+A                C+ +      +   Q 
Sbjct: 284 LFPFGRGLTHAYWAPNFWAIYSFTDKIATTLLLKLPYVHKLLCKCIKHPLFPTTREEIQS 343

Query: 333 QLQLY------------------------SLLATALGFLPAVVLVLLYPKKHLVPFALAA 368
           ++  Y                        S + T    L AVV +L  P       +L  
Sbjct: 344 RIMEYGNNGSKGLVEDVYFIILPQIIPKLSFILTGFYQLLAVVPLLFDPSFKRFIGSLTL 403

Query: 369 CSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTNWDVLSLVSWINNVGLFTLWPLL-KKDGL 427
           C M+ FLF + VHEK                   +L+    +++ G  +L+PLL K D  
Sbjct: 404 CGMASFLFGWHVHEKAILLVIIPFSFLVVCDR-RLLTSFMLVSSAGYVSLFPLLYKNDDF 462

Query: 428 ALQYCVCFAFC 438
            ++    + +C
Sbjct: 463 LIKTLYTYIWC 473

>KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {ON}
           Anc_5.669 YOR067C
          Length = 568

 Score =  108 bits (269), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 74/263 (28%), Positives = 126/263 (47%), Gaps = 25/263 (9%)

Query: 74  DFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGK-LGSLINPDWFALNV 132
           DF+  R+WL IT  LP+ +WYY     W LDYPP  AY  ++L + + + +  D     V
Sbjct: 53  DFDVHRNWLAITNALPLREWYYEKTSQWTLDYPPFFAYFEWVLSQFVPAAVRADGCLDIV 112

Query: 133 SRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPAL 192
            +G+       + R TVI SEV+ ++   VY    +           F+ A++I+  P L
Sbjct: 113 PQGVFGALTVLFQRCTVIASEVLLFVVLQVY----INTSPPAEKTQSFVVASSIVLSPML 168

Query: 193 MLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLG 252
           +++DH HFQYN  +    + +I +     +   A  +  ++CFK + LY +P +F +LL 
Sbjct: 169 LIVDHIHFQYNGFLFAILIASIVAARKRKFLLCAFFYSTALCFKHIFLYLAPCYFMFLLR 228

Query: 253 RCVFK-TGIRFP------------RFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHR 299
             V +  G RF             R   +    +   +V + P       ++++ Q + R
Sbjct: 229 TYVLQFEGFRFKSYKDLFRIIHWGRLFKLGGVVLGVAVVCFAPF------ARDMPQLLSR 282

Query: 300 IFPFARGIFEDKVA-NFWCVTNI 321
           +FPF+RG+     A NFW + ++
Sbjct: 283 LFPFSRGLTHAYWAPNFWALYSL 305

>KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.669
           YOR067C
          Length = 575

 Score =  105 bits (262), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/274 (27%), Positives = 122/274 (44%), Gaps = 25/274 (9%)

Query: 74  DFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKL-GSLINPDWFALNV 132
           DF+  R+WL IT  + +  WYY     W LDYPP  AY  + +  L  S +  D     V
Sbjct: 64  DFDVHRNWLAITNGMHLKDWYYEHTSQWTLDYPPFFAYFEWFISHLVPSFVRRDGCLDIV 123

Query: 133 SRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPAL 192
             G        + R TVI SE + ++   +Y        R  S    FI A++I+  P  
Sbjct: 124 EVGQFGWPTVLFQRLTVIFSESLLFLVLQIYINTSEVEERTQS----FIVASSIVLSPGF 179

Query: 193 MLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLG 252
           +++DH HFQYN  +    V +I +  ++ Y   A  + +++CFK + LY +P +F +LL 
Sbjct: 180 LIVDHIHFQYNGFLFAILVASIVAARNKRYLLCALFYSIALCFKHIFLYLAPCYFVFLLR 239

Query: 253 RCVFKTG-------------IRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHR 299
             V                 IR+     + M  +  F + + P         ++ Q + R
Sbjct: 240 VYVLNFENFKFRSYKDLIFLIRWKNLCQLGMIVVGVFSLCFGPFIF------DMPQLLSR 293

Query: 300 IFPFARGIFEDKVA-NFWCVTNIFVKYKQLFTQQ 332
           +FPF+RG+     A NFW + +   K   +F  +
Sbjct: 294 LFPFSRGLTHAYWAPNFWALYSFLDKVLTVFALR 327

>KNAG0D03530 Chr4 (646700..648088) [1389 bp, 462 aa] {ON} Anc_4.112
           YGL012W
          Length = 462

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 2/42 (4%)

Query: 481 IWKLIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGF 522
           +W L + G Y  M   H+ DMF+  PLN    W IL+  + F
Sbjct: 181 LWTLFVSGDYHRMTGNHLYDMFMGAPLN--PRWGILDLKMFF 220

>AGL087C Chr7 complement(541373..542761) [1389 bp, 462 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL012W
           (ERG4)
          Length = 462

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 34/71 (47%), Gaps = 14/71 (19%)

Query: 481 IWKLIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGC----FMLFWLWNYYKL 536
           +W L +   Y  M   H+ DMF+  PLN    W IL+  + F      FMLF       L
Sbjct: 181 LWTLFVSHDYYRMTGNHLYDMFMGAPLN--PRWGILDLKMFFEVRLPWFMLF-------L 231

Query: 537 FSLAGQSLQQL 547
            SL G SL+Q+
Sbjct: 232 LSL-GASLRQV 241

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.143    0.469 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,935,989
Number of extensions: 2346460
Number of successful extensions: 6482
Number of sequences better than 10.0: 46
Number of HSP's gapped: 6499
Number of HSP's successfully gapped: 49
Length of query: 547
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 432
Effective length of database: 40,294,809
Effective search space: 17407357488
Effective search space used: 17407357488
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 68 (30.8 bits)