Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07722g6.23ON37337319920.0
SAKL0E01342g6.23ON34135711871e-163
TDEL0G044606.23ON36930611811e-162
CAGL0F01815gsingletonON31430611581e-159
CAGL0I08151gsingletonON38231111541e-157
NCAS0D021706.23ON31030611441e-157
KNAG0D02240singletonON35931211201e-152
NCAS0H008406.23ON36030811141e-151
KLLA0D01243g6.23ON31129710981e-150
KAFR0A050806.23ON31130110841e-148
NDAI0D008306.23ON37430710821e-146
NDAI0C026206.23ON31130210671e-145
Kwal_56.224396.23ON32030010621e-144
TPHA0M002806.23ON30329810491e-143
KNAG0M011906.23ON38034510551e-142
KLTH0C11154g6.23ON30529710451e-142
KAFR0G026806.23ON38335110491e-141
Kpol_385.5singletonON30630110401e-141
Kpol_1061.27singletonON30630110391e-141
KNAG0K01400singletonON30929310071e-136
CAGL0L04202g2.140ON243106731.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C07722g
         (373 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conser...   771   0.0  
SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conser...   461   e-163
TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON}              459   e-162
CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {O...   450   e-159
CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly...   449   e-157
NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON...   445   e-157
KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {O...   436   e-152
NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {O...   433   e-151
KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {O...   427   e-150
KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {...   422   e-148
NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {O...   421   e-146
NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23      415   e-145
Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {O...   413   e-144
TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}...   408   e-143
KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {...   410   e-142
KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserv...   407   e-142
KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23     408   e-141
Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..137...   405   e-141
Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON} (79476.....   404   e-141
KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {O...   392   e-136
CAGL0L04202g Chr12 complement(492759..493490) [732 bp, 243 aa] {...    33   1.2  

>ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conserved
           hypothetical protein
          Length = 373

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/373 (100%), Positives = 373/373 (100%)

Query: 1   MSESEKGRVTGINYLKVLIFTLVGLIAFQSCSYLTSNKDNKQLFSFLSGQEQNPKEPINY 60
           MSESEKGRVTGINYLKVLIFTLVGLIAFQSCSYLTSNKDNKQLFSFLSGQEQNPKEPINY
Sbjct: 1   MSESEKGRVTGINYLKVLIFTLVGLIAFQSCSYLTSNKDNKQLFSFLSGQEQNPKEPINY 60

Query: 61  QFNDGIMSKSISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPA 120
           QFNDGIMSKSISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPA
Sbjct: 61  QFNDGIMSKSISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPA 120

Query: 121 GFPDHPHHGQETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGS 180
           GFPDHPHHGQETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGS
Sbjct: 121 GFPDHPHHGQETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGS 180

Query: 181 ASNGLQLWVDLPAELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYT 240
           ASNGLQLWVDLPAELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYT
Sbjct: 181 ASNGLQLWVDLPAELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYT 240

Query: 241 PVHFYHFITSKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGT 300
           PVHFYHFITSKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGT
Sbjct: 241 PVHFYHFITSKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGT 300

Query: 301 SVSDDAEFVLIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAG 360
           SVSDDAEFVLIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAG
Sbjct: 301 SVSDDAEFVLIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAG 360

Query: 361 GISEAEARKLYKE 373
           GISEAEARKLYKE
Sbjct: 361 GISEAEARKLYKE 373

>SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conserved
           hypothetical protein
          Length = 341

 Score =  461 bits (1187), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 228/357 (63%), Positives = 265/357 (74%), Gaps = 27/357 (7%)

Query: 17  VLIFTLVG-LIAFQSCSYLTSNKDNKQLFSFLSGQEQNPKEPINYQFNDGIMSKSISVRS 75
           V I  L   L+++ S  Y  SNK          GQE               MSK   VR+
Sbjct: 9   VYILALFAVLVSWASSKYFMSNK----------GQENR-------------MSK---VRT 42

Query: 76  VLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHPHHGQETITY 135
           + K+F+A+EQ EGVGARVRRSIGT ++R F PFLMLD F V PPAGFPDHPHHGQETITY
Sbjct: 43  IYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHGQETITY 102

Query: 136 NLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQLWVDLPAEL 195
            L GM+AHEDFTGSKGVL PGDLQFMTAGKGIVHSEIPV +E G  + GLQLWVDLP  L
Sbjct: 103 VLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWVDLPERL 162

Query: 196 KNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYHFITSKKGTE 255
           KNCEPRYRDLR  +TP  + + NL VRVISG+SYGV S  ELAYTPVHFYHFI+SKKGT 
Sbjct: 163 KNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFISSKKGTP 222

Query: 256 FAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDAEFVLIGGKI 315
           F Q+FP+DFNVF Y+LKGSL +N + FP++SA+FF  DGEGV G + SDD EF L+GG I
Sbjct: 223 FEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFALVGGSI 282

Query: 316 LDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAEARKLYK 372
           L+Q V+QHGPFVETS+ERMI VF++YQ+GMNGFE AH+W S I+ GIS+  A K  K
Sbjct: 283 LEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNAEKQLK 339

>TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON} 
          Length = 369

 Score =  459 bits (1181), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 209/306 (68%), Positives = 255/306 (83%)

Query: 67  MSKSISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHP 126
           MSK++ VRS++KNF+A +QEEGVGA VRRSIGTM+MRRF PFLMLD F V PPAGFPDHP
Sbjct: 58  MSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHP 117

Query: 127 HHGQETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQ 186
           HHGQETITY L GM+AHEDF+ SKG+L PGDLQFMTAGK I+HSEIPV ++ G  + GLQ
Sbjct: 118 HHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQ 177

Query: 187 LWVDLPAELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYH 246
           LWVDLP +LKNCEPRYRDL+ K  P +K +++L V VISG SYGV S ++LAYTPVH+YH
Sbjct: 178 LWVDLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYH 237

Query: 247 FITSKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDA 306
           F TSKKGTEF QEFP+ FN F YILKGS+ + +++FP+ S VFFDTDG+ V G S SD+A
Sbjct: 238 FATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNA 297

Query: 307 EFVLIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAE 366
           EFVLIGG+IL Q+V+QHGPFVET+RER+I+VF NYQ  +NGF+   +W S IAGGI+E+E
Sbjct: 298 EFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITESE 357

Query: 367 ARKLYK 372
           A+K ++
Sbjct: 358 AKKDFR 363

>CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {ON}
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii
          Length = 314

 Score =  450 bits (1158), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 207/306 (67%), Positives = 251/306 (82%), Gaps = 5/306 (1%)

Query: 72  SVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHPHHGQE 131
           + RS+ K+F+  EQEEGVGARVRRS+GTMK R F PFLMLDDF+VK PAGFPDHPHHGQE
Sbjct: 3   TYRSIQKHFMTFEQEEGVGARVRRSVGTMKQRMFSPFLMLDDFYVKHPAGFPDHPHHGQE 62

Query: 132 TITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQLWVDL 191
           TITY L GM+AHEDFTG+KGVL  GDLQFMTAGKGIVHSEIPV +E G A +GLQ WVDL
Sbjct: 63  TITYVLNGMVAHEDFTGAKGVLGKGDLQFMTAGKGIVHSEIPVQMESGEACHGLQFWVDL 122

Query: 192 PAELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYHFITSK 251
           P +LK CEPRYR+LR  + P V+ N+NLTV+VISGKSYGVDSV++LAYTP+H YH++T+K
Sbjct: 123 PKDLKWCEPRYRNLRGDKIPVVRPNENLTVKVISGKSYGVDSVRDLAYTPIHMYHYLTNK 182

Query: 252 KGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDAEFVLI 311
            GT++ QEFPK+FNVF Y++KG ++V DQVFPEH+AVFF+TDG+ V G   +DDA+F ++
Sbjct: 183 AGTQWEQEFPKNFNVFMYVMKGKVSVGDQVFPEHTAVFFNTDGDAVKGEFATDDAQFAIM 242

Query: 312 GGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEA-----E 366
           GG+ILDQ+ +QHGPFVET RE ++ VF NYQYG+NGFE A  W S I  GI+E      E
Sbjct: 243 GGQILDQQTIQHGPFVETDRESLMKVFMNYQYGINGFERAKGWQSSIIHGITEKQVRENE 302

Query: 367 ARKLYK 372
           A+ LYK
Sbjct: 303 AKGLYK 308

>CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii and YALI0E33297g
           Yarrowia lipolytica and CA2891|CaIFS4 Candida albicans
          Length = 382

 Score =  449 bits (1154), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 210/311 (67%), Positives = 249/311 (80%), Gaps = 1/311 (0%)

Query: 63  NDGIMSKSISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGF 122
           NDGI    I  RS+L +FIA EQEEGVGARVRRS+GT +MRRF PFLMLDDF V PP GF
Sbjct: 73  NDGINDDRI-YRSILTHFIAGEQEEGVGARVRRSVGTYQMRRFTPFLMLDDFTVAPPNGF 131

Query: 123 PDHPHHGQETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSAS 182
           PDHPHHGQETITY   GMIAHED TGSKGVL  GDLQFMTAGKGIVHSEIPV+ +DG   
Sbjct: 132 PDHPHHGQETITYVTDGMIAHEDITGSKGVLLKGDLQFMTAGKGIVHSEIPVTTKDGKPC 191

Query: 183 NGLQLWVDLPAELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPV 242
            GLQLWVDLP+++KN +PRYR+LR  +TP    N+NL VRVISGKSYGV+S+++LAYTPV
Sbjct: 192 RGLQLWVDLPSDMKNIDPRYRNLRGNETPVAYPNENLEVRVISGKSYGVESLRDLAYTPV 251

Query: 243 HFYHFITSKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSV 302
           H YHF+ +K GTEF Q+ P+DFNVF Y++KGS+ VND      S+ FFD DG  + G ++
Sbjct: 252 HLYHFLANKTGTEFVQDIPEDFNVFIYVMKGSIQVNDVELTTFSSAFFDVDGNAIRGKAL 311

Query: 303 SDDAEFVLIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGI 362
           S+DA+F +I G+ILDQEV+QHGPFVET+RE++++VFRNYQ   NGFENAHSW S I  GI
Sbjct: 312 SEDAQFAIIAGRILDQEVIQHGPFVETNREKLMEVFRNYQEEKNGFENAHSWRSSIHDGI 371

Query: 363 SEAEARKLYKE 373
           SE EA KLY+E
Sbjct: 372 SEEEALKLYRE 382

>NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON}
           Anc_6.23
          Length = 310

 Score =  445 bits (1144), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 204/306 (66%), Positives = 248/306 (81%)

Query: 67  MSKSISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHP 126
           M+KS+  RSVLK+F+AIEQEEGVGA VRRSIG+MK R F PFL++D+F V  PAGFPDHP
Sbjct: 1   MTKSMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHP 60

Query: 127 HHGQETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQ 186
           HHGQETITY LKGMIAHEDFTGS+GVL PGDLQFMTAGK I+HSEIPV + +G A  G+Q
Sbjct: 61  HHGQETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQ 120

Query: 187 LWVDLPAELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYH 246
           LWVDLP +LKNCEPRYR+LR  + P VK ND+LTVRV+SGKSYGV+SV++LAYTP+ +Y 
Sbjct: 121 LWVDLPKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYF 180

Query: 247 FITSKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDA 306
             T K GTEF QEFP DFNVF YI+KGS+ +ND V P++S +FF TDG+ + G S S+D 
Sbjct: 181 MNTKKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDT 240

Query: 307 EFVLIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAE 366
           EFVL+GG+ILDQ ++QHGPFVE+ RE +++VF+NYQY +NGFE A  W S+IA GI E +
Sbjct: 241 EFVLVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDD 300

Query: 367 ARKLYK 372
                K
Sbjct: 301 VEAFEK 306

>KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score =  436 bits (1120), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 201/312 (64%), Positives = 248/312 (79%)

Query: 59  NYQFNDGIMSKSISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKP 118
           N   ND  M     +RS+  +FI  E  EGVGARV+RS+G+M+ RRF PFLMLDDF VK 
Sbjct: 46  NTTNNDYTMPSLFKLRSIANHFIPREVAEGVGARVKRSVGSMQQRRFTPFLMLDDFTVKS 105

Query: 119 PAGFPDHPHHGQETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLED 178
           P+GFPDHPHHGQETITY + G+IAHEDFTGSKGVL PGDLQFMTAGKGIVHSE+PV +ED
Sbjct: 106 PSGFPDHPHHGQETITYVIDGLIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVEMED 165

Query: 179 GSASNGLQLWVDLPAELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELA 238
           G  + GLQLWVDLP +LKNCEPRYR+LR +  P VK ++NL VRVISGKSYG +SV++LA
Sbjct: 166 GRPARGLQLWVDLPKDLKNCEPRYRNLRSEDIPVVKPHENLEVRVISGKSYGTESVKDLA 225

Query: 239 YTPVHFYHFITSKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVA 298
           YTP+ FY+ + SK GTEFAQE P DFN F Y++KGS+ +N++VF +++A+FFDTDGEGVA
Sbjct: 226 YTPIDFYYMLASKAGTEFAQEIPSDFNAFLYVMKGSVVINEKVFKQNTAIFFDTDGEGVA 285

Query: 299 GTSVSDDAEFVLIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKI 358
           G + SDD EF +IGGKILDQ ++QHGPFVET +E++ + F NY+    GFE A  W S I
Sbjct: 286 GQAGSDDTEFAIIGGKILDQPLVQHGPFVETDQEKLYEAFMNYEGYTKGFERAKGWRSDI 345

Query: 359 AGGISEAEARKL 370
           A GI+E+EA++L
Sbjct: 346 ASGINESEAKQL 357

>NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {ON}
           Anc_6.23
          Length = 360

 Score =  433 bits (1114), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 199/308 (64%), Positives = 245/308 (79%)

Query: 64  DGIMSKSISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFP 123
           D   ++S   RS+LK+FIA EQ EG GA VRRS+G+ +M RF PFLMLDDF V PP GFP
Sbjct: 52  DSATAESQKERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFP 111

Query: 124 DHPHHGQETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASN 183
           DHPHHGQETITY   G++AHEDFTGSKGVL+PGDLQFMTAGKGIVH E+PV++ D + S 
Sbjct: 112 DHPHHGQETITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVST 171

Query: 184 GLQLWVDLPAELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVH 243
           GLQ WVDLPA+LKNCEPRYR+LR    P V+VNDNL V+VISGKSY V+SV++LAYTP+ 
Sbjct: 172 GLQFWVDLPADLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPID 231

Query: 244 FYHFITSKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVS 303
           FY+FI++K GTEFAQE P DFN F Y+ KG++ + ++VF  HS+VFF TDG  + G + S
Sbjct: 232 FYYFISNKAGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTAS 291

Query: 304 DDAEFVLIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGIS 363
           D+ EF +IGGKILDQ+V+QHGPFVET+RE++I+VF NY+ G+NGFE A  W S I+ GI 
Sbjct: 292 DNTEFAVIGGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGID 351

Query: 364 EAEARKLY 371
           E  AR+ Y
Sbjct: 352 EQTAREWY 359

>KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {ON}
           conserved hypothetical protein
          Length = 311

 Score =  427 bits (1098), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 194/297 (65%), Positives = 245/297 (82%)

Query: 73  VRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHPHHGQET 132
           VRSVLK+F+AIEQ EG GA V+RSIGT++MR FPPFLMLD+F V PPAGFP+HPHHGQET
Sbjct: 9   VRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHGQET 68

Query: 133 ITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQLWVDLP 192
           ITY L+GM+AHEDFTGSKGVL  GDLQFMTAGK IVHSEIPV +++G ++ GLQLWVDLP
Sbjct: 69  ITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVDLP 128

Query: 193 AELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYHFITSKK 252
            ++KN EPRYRDLR+++ P    +DNL V+VISG+SYGV S+ ELAYTPV FYHFI +KK
Sbjct: 129 NDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIANKK 188

Query: 253 GTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDAEFVLIG 312
            TEFAQ F  DF+ F YI+KGS++++DQ +PE SA+FF  DG+G+ G + SD+AEF +I 
Sbjct: 189 NTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAIIA 248

Query: 313 GKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAEARK 369
           GK  +Q+V+Q+GPFVE+SRE ++DV +NYQ G+NGFENA +W   I  G++EAE ++
Sbjct: 249 GKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQ 305

>KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {ON}
           Anc_6.23
          Length = 311

 Score =  422 bits (1084), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 190/301 (63%), Positives = 244/301 (81%)

Query: 70  SISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHPHHG 129
           + + R++ K+F+A+EQEEGVGARVRRS+G+M+ R F PFL+LD F V  PAGFPDHPHHG
Sbjct: 7   ATTFRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHG 66

Query: 130 QETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQLWV 189
           QETITY   GMIAHEDFTGSKG+L PGDLQFMTAGKGI+HSEIPV +E+G A  GLQLWV
Sbjct: 67  QETITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWV 126

Query: 190 DLPAELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYHFIT 249
           DLP E+K+CEPRYR+LR  + P V+ N++L V+VISG+SYGV+SV+ELAYTPV FYHFI+
Sbjct: 127 DLPQEMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFIS 186

Query: 250 SKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDAEFV 309
           +KKGT+F Q+ P++FN F Y++KGS+ + D+ FP++S +FF+ DG G+ G    DD EF 
Sbjct: 187 NKKGTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFA 246

Query: 310 LIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAEARK 369
           +IGG ILDQ V+QHGPF+E++RE++I+VF+N+QYG+NGFE A  W S I  GI E +  K
Sbjct: 247 IIGGLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPK 306

Query: 370 L 370
            
Sbjct: 307 F 307

>NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {ON}
           Anc_6.23
          Length = 374

 Score =  421 bits (1082), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 198/307 (64%), Positives = 241/307 (78%), Gaps = 3/307 (0%)

Query: 67  MSKSISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPP-AGFPDH 125
           ++ +   R++LK FI  EQ EGVGARVRR+IGT +M RFPPFLMLD F V PP  GFPDH
Sbjct: 66  IATTDDARTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDH 125

Query: 126 PHHGQETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGL 185
           PHHGQETITY L GMIAHEDFTGSKGVL PGDLQFMTAGKGIVHSE+PV ++DG    GL
Sbjct: 126 PHHGQETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGL 185

Query: 186 QLWVDLPAELKNCEPRYRDLRKKQTPEVKVND--NLTVRVISGKSYGVDSVQELAYTPVH 243
           QLWVDLP ELKNCEPRYR+LRK + P V  +D  ++TV+VISG +YGVDSV++LAYTP+H
Sbjct: 186 QLWVDLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIH 245

Query: 244 FYHFITSKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVS 303
           FYH+I+ K G EF Q  P DFNVF Y++KG++ ++DQ+F +++AVFF+ DG  + G S +
Sbjct: 246 FYHYISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSAT 305

Query: 304 DDAEFVLIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGIS 363
           +D EF +IGGKILDQ ++QHGPFVET+RE +  VF NYQ G+NGFE A +W S IA GI 
Sbjct: 306 NDTEFAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGID 365

Query: 364 EAEARKL 370
           E  A  L
Sbjct: 366 EDTANAL 372

>NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23
          Length = 311

 Score =  415 bits (1067), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 198/302 (65%), Positives = 237/302 (78%), Gaps = 1/302 (0%)

Query: 67  MSKSISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHP 126
           MSK   +RSV KNFIAIEQEEGVGA VRRSIG+MK R F PFL++D F V  PAGFPDHP
Sbjct: 1   MSKVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHP 60

Query: 127 HHGQETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQ 186
           HHGQETITY L GMIAHEDFTGSKGVL PGDLQFMTAGK I+HSEIPV +E+G+   G+Q
Sbjct: 61  HHGQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQ 120

Query: 187 LWVDLPAELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYH 246
           LWV LP +LKN EPRYR+LR  + P +K N+NLTVRVISGKSYG +SV++LAYTP+ +Y 
Sbjct: 121 LWVALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYI 180

Query: 247 FITSKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSD-D 305
           F  +KKG EF QE P++FN F YI KG++ +N  V+P++S VFFDTDG+ + G S +D +
Sbjct: 181 FNMNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEE 240

Query: 306 AEFVLIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEA 365
            EF +IGG ILDQ +LQHGPFVET RE ++ VF+NYQY +NGFE A  W S IA GI E 
Sbjct: 241 TEFAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEK 300

Query: 366 EA 367
           + 
Sbjct: 301 DV 302

>Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {ON}
           [contig 185] FULL
          Length = 320

 Score =  413 bits (1062), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 189/300 (63%), Positives = 232/300 (77%)

Query: 73  VRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHPHHGQET 132
            RS+LK F A+EQ EGVGA+VRRSIGT K+R F PFLMLD F + PPAGFPDHPHHGQET
Sbjct: 18  ARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHGQET 77

Query: 133 ITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQLWVDLP 192
           +T+ L+G +AHEDFTGSKGVL  GDLQFMTAGKG VHSEIPV LE G  + G+QLWVDLP
Sbjct: 78  VTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWVDLP 137

Query: 193 AELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYHFITSKK 252
           A LK+C+PRYRDL++ + P  +  + L + VISG+SYGVDS+QELAYT VH+YH++ S+ 
Sbjct: 138 ARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVFSEA 197

Query: 253 GTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDAEFVLIG 312
              F Q FP DFNVF Y+LKG L +  Q F +HS++FF TDG  V+G S S+D EF+L G
Sbjct: 198 NISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFILAG 257

Query: 313 GKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAEARKLYK 372
           G+ILDQ ++Q+GPFVETS+ERM++VF+NYQ G NGFE A  W S IA GI E++     K
Sbjct: 258 GQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDISDFVK 317

>TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}
           Anc_6.23
          Length = 303

 Score =  408 bits (1049), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 190/298 (63%), Positives = 235/298 (78%)

Query: 70  SISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHPHHG 129
           S + RS+LK+FIA EQ EGVGARVRRSIGT KMR+F PFLMLD F V PPAGFPDHPHHG
Sbjct: 2   SQNTRSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHG 61

Query: 130 QETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQLWV 189
           QETITY  KGM+AHEDFTGSKG+L PGDLQFMTAGK + HSE+PV +E+G   +GLQLWV
Sbjct: 62  QETITYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWV 121

Query: 190 DLPAELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYHFIT 249
           DLP  LKN EPRYRDL K+  P  K ++NL + VISGKSYG++SV++LAYTPV FY +  
Sbjct: 122 DLPTNLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKA 181

Query: 250 SKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDAEFV 309
            KKG+ F Q+F +D+NVF YI+KGS+A+ ++VFP+HS++FF+TDG+ V G   SDD EF 
Sbjct: 182 RKKGSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFA 241

Query: 310 LIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAEA 367
           +IGG+IL QE +QHGPFVE + E+++ VF NY+    GFE A +W S I  GI E++A
Sbjct: 242 IIGGQILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQA 299

>KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {ON}
           Anc_6.23
          Length = 380

 Score =  410 bits (1055), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 194/345 (56%), Positives = 253/345 (73%), Gaps = 7/345 (2%)

Query: 30  SCSYLTSNKDNKQLFSFLSGQEQNPKEPINYQFND-------GIMSKSISVRSVLKNFIA 82
           +C ++       QLFS  S Q       + + ++           ++    R++ K+FIA
Sbjct: 25  TCWFIGKRSSFSQLFSLYSTQNTIQYRRVVHCYSTISPTTTATTTTEMPEFRTIQKHFIA 84

Query: 83  IEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHPHHGQETITYNLKGMIA 142
            EQEEGVGARVRRS+G+M+ R F PFL+LD F V  PAGFPDHPHHGQETITY  +GMIA
Sbjct: 85  GEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQETITYVREGMIA 144

Query: 143 HEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQLWVDLPAELKNCEPRY 202
           HEDF GSKGVL PGDLQFMTAGKGI+HSEIPV +E+G A  GLQLWVDLP ++K+C PRY
Sbjct: 145 HEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPKDMKDCAPRY 204

Query: 203 RDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYHFITSKKGTEFAQEFPK 262
           R+LR  + P  + N++L ++VISGKS+G+DSV+ELAYTPV FYH+I+ KKGT F QE P 
Sbjct: 205 RNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDKKGTGFVQEVPT 264

Query: 263 DFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDAEFVLIGGKILDQEVLQ 322
           +FNVF Y++KG++ ++ QVFP++S VF++ +G+ + G    DD EF +IGG ILDQ V+Q
Sbjct: 265 NFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAIIGGLILDQPVIQ 324

Query: 323 HGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAEA 367
           HGPFVET+RE++I+VF+N+QYG+NGFE A  W S I  GI E + 
Sbjct: 325 HGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDV 369

>KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserved
           hypothetical protein
          Length = 305

 Score =  407 bits (1045), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 195/297 (65%), Positives = 234/297 (78%)

Query: 74  RSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHPHHGQETI 133
           RS+LK F A+EQ EGVGA+VRRSIG+ ++R F PFLMLD F V PPAGFPDHPHHGQETI
Sbjct: 5   RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 64

Query: 134 TYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQLWVDLPA 193
           TY L GMIAHEDFTGS+GVL PGDLQFMTAGKGI+HSEIPV LE G+ S GLQLWVDLP 
Sbjct: 65  TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 124

Query: 194 ELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYHFITSKKG 253
            LK+CEPRYRDL   + P V+    L VRVISG+SYGV S+ ELAYTPVHFYH+IT K G
Sbjct: 125 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 184

Query: 254 TEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDAEFVLIGG 313
           T F Q FP +FNVF Y+LKGS+ VN + F ++S+VFF+TDG  V G+  S+++EF+LIGG
Sbjct: 185 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDGSRVEGSGSSEESEFILIGG 244

Query: 314 KILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAEARKL 370
           ++LDQ +LQ+GPFVETS++ M +V  NYQ G NGFE A  W S IA G+  ++  K+
Sbjct: 245 EVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKI 301

>KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23
          Length = 383

 Score =  408 bits (1049), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 196/351 (55%), Positives = 254/351 (72%), Gaps = 2/351 (0%)

Query: 20  FTLVGLIAFQSCSYLTSNKDNKQLFSFLSGQEQNPKEPINYQFNDGIMSKSISVRSVLKN 79
           +T+ G+I   +C          +   +  G E   +   N +  +  MS+ I  RS++ +
Sbjct: 33  YTIFGVIGLLACFVFQKIVLEPRRIKW--GLEDFRQNNFNEEKQEDEMSRIIHQRSIINH 90

Query: 80  FIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHPHHGQETITYNLKG 139
           FI  E  EG GARV+RSIG+ + RRF PFLMLDDF V PPAGFPDHPHHGQETITY L G
Sbjct: 91  FIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHPHHGQETITYVLSG 150

Query: 140 MIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQLWVDLPAELKNCE 199
           MIAHEDFTG  G+L PGDLQFMTAG+GIVHSEIPV++E+G +  GLQLWVDLP +LK  E
Sbjct: 151 MIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQLWVDLPQDLKTIE 210

Query: 200 PRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYHFITSKKGTEFAQE 259
           PRYR+LR    P     +NL V VISGKSY V+S+ +LAYTPVH YHF+T K GT F QE
Sbjct: 211 PRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTIKAGTPFIQE 270

Query: 260 FPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDAEFVLIGGKILDQE 319
           FPKDFNVF Y++KG++ +N+++F E++A+FFD DGE + G   +DD+EFVL+GG+IL+Q 
Sbjct: 271 FPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDSEFVLVGGEILNQP 330

Query: 320 VLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAEARKL 370
           V+Q GPFVET +++++ VF +++   NGFE A +W+S I  GI EAEAR+L
Sbjct: 331 VVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAEAREL 381

>Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..13708)
           [921 nt, 307 aa]
          Length = 306

 Score =  405 bits (1040), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 188/301 (62%), Positives = 231/301 (76%)

Query: 67  MSKSISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHP 126
           MSK  ++RS+ K+FIA EQ EGVGARVRRSIGTM +R+F PFLMLD F V P AGFPDHP
Sbjct: 1   MSKQQNLRSIFKHFIAREQAEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHP 60

Query: 127 HHGQETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQ 186
           HHGQETITY  +GMIAHEDFTG KGVL+ GDLQFMTAGK I H+E+PV    G    GLQ
Sbjct: 61  HHGQETITYVNEGMIAHEDFTGCKGVLYKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQ 120

Query: 187 LWVDLPAELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYH 246
           LWVDLP ++KN EPRYRDL+ K+ P     D+L V VISG SYGVDSV++LAYTP+ FY 
Sbjct: 121 LWVDLPTDMKNTEPRYRDLKNKEIPRANPTDDLEVEVISGNSYGVDSVKDLAYTPIDFYM 180

Query: 247 FITSKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDA 306
           +   K GTEF Q F +DFNVF Y+L+G++ + DQVFP++S++FF+TDG+ V GT  +D+ 
Sbjct: 181 YRGKKAGTEFTQNFSRDFNVFIYVLQGAITIGDQVFPQYSSIFFNTDGDAVGGTIAADNT 240

Query: 307 EFVLIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAE 366
           EF +IGGKILDQ+ +QHGPFVE ++E++I VF +YQ   NGFE A +W S I  GI E +
Sbjct: 241 EFAIIGGKILDQQTVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWKSSIRDGIKEND 300

Query: 367 A 367
           A
Sbjct: 301 A 301

>Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON}
           (79476..80396) [921 nt, 307 aa]
          Length = 306

 Score =  404 bits (1039), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 190/301 (63%), Positives = 230/301 (76%)

Query: 67  MSKSISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHP 126
           MSK  ++RS+ K+FI+ EQ EGVGARVRRSIGTM +R+F PFLMLD F V P AGFPDHP
Sbjct: 1   MSKQQNLRSIFKHFISREQSEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHP 60

Query: 127 HHGQETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQ 186
           HHGQETITY  +GMIAHEDFTG KGVL  GDLQFMTAGK I H+E+PV    G    GLQ
Sbjct: 61  HHGQETITYVNEGMIAHEDFTGCKGVLGKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQ 120

Query: 187 LWVDLPAELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYH 246
           LWVDLP ++KN EPRYRDLR K  P     D+L + VISG SYGVDSV++LAYTP+ FY 
Sbjct: 121 LWVDLPTDMKNTEPRYRDLRNKDIPRANPTDDLEIEVISGNSYGVDSVKDLAYTPIDFYM 180

Query: 247 FITSKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDA 306
           +   K GTEF Q+F +DFNVF Y+LKG++ + DQVFP++S++FF+TDG+ V GT  +DD 
Sbjct: 181 YRGKKAGTEFTQKFSRDFNVFIYVLKGAVNIGDQVFPQYSSIFFNTDGDAVGGTVAADDT 240

Query: 307 EFVLIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAE 366
           EF +IGGKILDQE +QHGPFVE ++E++I VF +YQ   NGFE A +W S I  GI E +
Sbjct: 241 EFAIIGGKILDQETVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWRSSIRDGIKEDD 300

Query: 367 A 367
           A
Sbjct: 301 A 301

>KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {ON} 
          Length = 309

 Score =  392 bits (1007), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 178/293 (60%), Positives = 229/293 (78%)

Query: 74  RSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHPHHGQETI 133
           RSV K F A+EQ EGVGA VRRSIG  + R F PFL+LD F V  P+GFPDHPHHGQETI
Sbjct: 6   RSVQKAFRALEQAEGVGALVRRSIGVRRQRNFSPFLLLDHFTVSHPSGFPDHPHHGQETI 65

Query: 134 TYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQLWVDLPA 193
           TY  +GMIAHEDFTGSKG+L PGDLQFMTAGKGIVHSEIPV  +D  A+ GLQLWVDLP 
Sbjct: 66  TYIQQGMIAHEDFTGSKGILRPGDLQFMTAGKGIVHSEIPVLTKDAKAAVGLQLWVDLPK 125

Query: 194 ELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYHFITSKKG 253
            +K+C PRYR+LR  + P  + N++L V+VISGKSYGV+SV+ELAYTPV FYH+I+ K+G
Sbjct: 126 NMKDCPPRYRNLRASEIPIAQPNEHLKVKVISGKSYGVESVKELAYTPVDFYHYISDKEG 185

Query: 254 TEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDAEFVLIGG 313
             F QE P+++N F Y+++GS+ V+ Q +P++S +F++ +G  + G +   + EF +I G
Sbjct: 186 INFVQEIPENYNAFLYVMEGSVVVDGQEYPQYSTIFYNANGNAIKGVTGEKNTEFAIIAG 245

Query: 314 KILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAE 366
            ILDQ+++QHGPFVETS E+M +VFRNYQ+G+NGFE A +W+S I  GI+E +
Sbjct: 246 LILDQDIVQHGPFVETSPEKMKEVFRNYQWGINGFEKAINWESSIINGITEKD 298

>CAGL0L04202g Chr12 complement(492759..493490) [732 bp, 243 aa] {ON}
           similar to uniprot|P53915 Saccharomyces cerevisiae
           YNL129w
          Length = 243

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 14/106 (13%)

Query: 72  SVRSVLKNFIAIEQEEGVGAR------VRRSIGTMKMRRF--PPFLMLDDFFVKPPAGFP 123
           ++R VL +   I  ++ V ++      +R    T+K RR   P +  LD F+V PP  F 
Sbjct: 122 NLRIVLVDGFLIYHDKSVASKFDVRLLIRAPYETLKKRRAARPGYQTLDSFWVDPPYYFD 181

Query: 124 DHPH------HGQETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTA 163
           D  +      H    I  N++G + +E     K      D+Q  TA
Sbjct: 182 DFVYKNYKEAHAHLFIDNNVEGQLKYELNDSIKDFNNDEDVQISTA 227

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,520,555
Number of extensions: 1874411
Number of successful extensions: 4118
Number of sequences better than 10.0: 23
Number of HSP's gapped: 4194
Number of HSP's successfully gapped: 23
Length of query: 373
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 262
Effective length of database: 40,753,473
Effective search space: 10677409926
Effective search space used: 10677409926
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)