Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07678g6.25ON74174133930.0
SAKL0E01452g6.25ON73764818340.0
NCAS0H008606.25ON75576718110.0
Kpol_1037.296.25ON74662417930.0
KAFR0G026606.25ON73560317720.0
Suva_15.1766.25ON74558617570.0
TDEL0G044406.25ON73562017520.0
TPHA0J003706.25ON74363117010.0
KNAG0M012306.25ON73861816980.0
YOR001W (RRP6)6.25ON73361216940.0
NDAI0D008506.25ON79055616950.0
Skud_15.1626.25ON73459016810.0
Smik_15.1706.25ON77361216840.0
CAGL0E02585g6.25ON73775416720.0
KLLA0D01309g6.25ON74466116480.0
ACL001C6.25ON74572816440.0
TBLA0A071706.25ON77164116330.0
Kwal_56.224476.25ON73555715910.0
Ecym_30306.25ON74761915810.0
KLTH0C11066g6.25ON73561015190.0
KNAG0E005905.87ON528102771.4
NCAS0J023004.373ON1544137709.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C07678g
         (741 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...  1311   0.0  
SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} simila...   711   0.0  
NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {O...   702   0.0  
Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {O...   695   0.0  
KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.2...   687   0.0  
Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...   681   0.0  
TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.2...   679   0.0  
TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON...   659   0.0  
KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {...   658   0.0  
YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...   657   0.0  
NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {O...   657   0.0  
Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...   652   0.0  
Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001...   653   0.0  
CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} simila...   648   0.0  
KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} simila...   639   0.0  
ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON} S...   637   0.0  
TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6...   633   0.0  
Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001...   617   0.0  
Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...   613   0.0  
KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {...   589   0.0  
KNAG0E00590 Chr5 (100162..101748) [1587 bp, 528 aa] {ON} Anc_5.8...    34   1.4  
NCAS0J02300 Chr10 complement(443929..448563) [4635 bp, 1544 aa] ...    32   9.1  

>ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 741

 Score = 1311 bits (3393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 653/741 (88%), Positives = 653/741 (88%)

Query: 1   MAEESNEQLLPKVVGTVRXXXXXXXQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60
           MAEESNEQLLPKVVGTVR       QDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI
Sbjct: 1   MAEESNEQLLPKVVGTVRAAAALAAQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60

Query: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDRKGAALMYLDDAARS 120
           DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDRKGAALMYLDDAARS
Sbjct: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDRKGAALMYLDDAARS 120

Query: 121 DMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHXXX 180
           DMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEH   
Sbjct: 121 DMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHYPQ 180

Query: 181 XXXXXXXXXXXXXSILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLEH 240
                        SILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLEH
Sbjct: 181 PYEYEIENQEYNESILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLEH 240

Query: 241 HDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWLQ 300
           HDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWLQ
Sbjct: 241 HDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWLQ 300

Query: 301 RDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSAY 360
           RDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSAY
Sbjct: 301 RDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSAY 360

Query: 361 ARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVDR 420
           ARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVDR
Sbjct: 361 ARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVDR 420

Query: 421 ADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDPT 480
           ADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDPT
Sbjct: 421 ADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDPT 480

Query: 481 GVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHDLSQVLTVGQI 540
           GVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHDLSQVLTVGQI
Sbjct: 481 GVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHDLSQVLTVGQI 540

Query: 541 ESQVSQFHDLSKAFKGLSQGTXXXXXXXXIIFGNILHAPCGFVGYGRSLKKPVTDKQIEK 600
           ESQVSQFHDLSKAFKGLSQGT        IIFGNILHAPCGFVGYGRSLKKPVTDKQIEK
Sbjct: 541 ESQVSQFHDLSKAFKGLSQGTNSSNSSSSIIFGNILHAPCGFVGYGRSLKKPVTDKQIEK 600

Query: 601 RKLELSEALEFIDAETATTIQEEDRGSELTHEPADDKKVSENDXXXXXXXXXXXXXXXXX 660
           RKLELSEALEFIDAETATTIQEEDRGSELTHEPADDKKVSEND                 
Sbjct: 601 RKLELSEALEFIDAETATTIQEEDRGSELTHEPADDKKVSENDESKKEEAKETEPEEDKN 660

Query: 661 XIITLXXXXXXXXXXXXXNESEPEEPIDYXXXXXXXXXXXXXXXXXXRAFDPYAASNDAG 720
            IITL             NESEPEEPIDY                  RAFDPYAASNDAG
Sbjct: 661 EIITLKKVKDRGKKSKRSNESEPEEPIDYKKSKKILETEKKSKSTKKRAFDPYAASNDAG 720

Query: 721 NAXXXXXXXXMARGKSASFKR 741
           NA        MARGKSASFKR
Sbjct: 721 NAPKPKKKRRMARGKSASFKR 741

>SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 737

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/648 (52%), Positives = 466/648 (71%), Gaps = 5/648 (0%)

Query: 1   MAEESNEQLLPKVVGTVRXXXXXXXQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60
           M+ +  ++LL  +VGTVR       QD+DF++SLD G++KS++ +S++L+++IN  LL I
Sbjct: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSI 60

Query: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDRKGAALMYLDDAARS 120
           D+N+  +E GK+  ++S KD  ++MDNLFEKSD + D L+  + ++  + + YLDD++RS
Sbjct: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQGNSNVQYLDDSSRS 120

Query: 121 DMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHXXX 180
           ++ P+KRI KPQ+ F+ PIDNTE+HPFKPLLENKPHALRPLS+ ++     E+IP H   
Sbjct: 121 NLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYPH 180

Query: 181 XXXXXXXXXXXXXSILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLEH 240
                        SIL+I +PIPS+PW+ ++PVWVD KESL  +L +L+ + EIAVDLEH
Sbjct: 181 PYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLEH 240

Query: 241 HDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWLQ 300
           HDYRSYYGIVCLMQ+STR+ D+LVDT+ALR++L VLNE+F +P ++KVFHGAFMDIIWLQ
Sbjct: 241 HDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWLQ 300

Query: 301 RDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSAY 360
           RDLG+Y+VSLFDTYHASR+LG PRHSLAYLLE FA FKTSKKYQLADWR+RPL+K M AY
Sbjct: 301 RDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRAY 360

Query: 361 ARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVDR 420
           ARADTHFLLNIYDQLRN LI +NKLA VL +SRNVAKR F+Y+ +RPK+ ++ V+SP+++
Sbjct: 361 ARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIEK 420

Query: 421 ADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDPT 480
            + W+ LM QYNIPL +E L++ LYEWRDTIARRDDESPRYVMPNQLL  LV   P DP 
Sbjct: 421 DEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDPA 480

Query: 481 GVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHDLSQVLTVGQI 540
           GV+SVS  +TD+VR+N+K L+NLI K+L+ + +             ++ DLSQVL++ QI
Sbjct: 481 GVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKDLSQVLSISQI 540

Query: 541 ESQVSQFHDLSKAFKGLSQGTXXXXXXXXIIFGNILHAPCGFVGYGRSLKKPVTDKQIEK 600
           ++   QF+ L+   K  +  T        +  G+ + +    V Y ++ K  + + Q+++
Sbjct: 541 QNMCLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVIDENQLQE 600

Query: 601 RKLELSEALEFIDA-----ETATTIQEEDRGSELTHEPADDKKVSEND 643
           RKLE+SE L+ +           T +E D  S+   E  D  + SE D
Sbjct: 601 RKLEVSEKLKEVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRASETD 648

>NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {ON}
           Anc_6.25 YOR001W
          Length = 755

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/767 (49%), Positives = 486/767 (63%), Gaps = 38/767 (4%)

Query: 1   MAEESNEQ---LLPKVVGTVRXXXXXXXQDVDFYRSLDKGVAKSLDKTSNELVSMINSTL 57
           M+E+S EQ   LLPKVV TVR       QDVDFYRS+DK +A SL+++SN++  MINS L
Sbjct: 1   MSEQSQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVL 60

Query: 58  LCIDQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDIL-RGRAPDRKGAALMYLDD 116
           L ID+NS  ++G KE LED  KDF NLMDNLFEKSDRS+DI+ RG       + + Y+D+
Sbjct: 61  LSIDENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDE 120

Query: 117 AARSDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPE 176
            +  D+ P K+ILKPQ++F  PIDNTE+HPF PLL+ KP AL+PL + ++++  DE  P 
Sbjct: 121 FSGRDLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPM 180

Query: 177 HXXXXXXXXXXXXXXXXSILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAV 236
           H                 IL+  +PIPS  W  +EP+WVD    L S++ DL+ STEIAV
Sbjct: 181 HYPQPYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAV 240

Query: 237 DLEHHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDI 296
           DLEHHDYR+YYGI CLMQ+STR+ DYL+DTLALR+DL +LN VFANP+I KVFHGAFMDI
Sbjct: 241 DLEHHDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDI 300

Query: 297 IWLQRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKA 356
           IWLQRDLGLY+V LFDT+HASRA+G P+HSLAYLLE FA FKTSKKYQLADWR+RPLSKA
Sbjct: 301 IWLQRDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKA 360

Query: 357 MSAYARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKV--PNSSV 414
           M AYARADTHFLLNI+DQ+RN LI +NKLAGVL ESRNVAKR F+YS +RPKV   N  V
Sbjct: 361 MHAYARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLV 420

Query: 415 YSPVDRADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDY 474
           YSP+++ D WK +M QYNIP +KE L+K LY+WRD IARRDDESPR+VMPNQLL  LV Y
Sbjct: 421 YSPIEKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAY 480

Query: 475 TPLDPTGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAG---SDIKVE--SVQHKDQH 529
           TP+D  GV+SVS +VTD+VR+N+K LANLI   L ++ D     +++  E  SV  +  H
Sbjct: 481 TPIDAPGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGH 540

Query: 530 DLSQVLTVGQIESQVSQFHDLSKAFKGLSQGTXXXXXXXXIIFGNILHAPCGFVGYGRSL 589
           DLSQ LT+ Q+++  S+F  LS  F   S  T         +F  I  A    + Y    
Sbjct: 541 DLSQKLTIHQLQNLKSKFQLLSDKFNN-SVKTRLSNHDQLYLFDGISFADDVTIKYFADG 599

Query: 590 KKPVTDKQIEKRKLELSEALEFIDA--------ETATTIQEEDRGSELTHEPADDKKVSE 641
           K   T +Q ++R  +  +A++ ++         E     Q++D    +T     + +V+E
Sbjct: 600 KIQTTAEQYKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATNAEGQVNE 659

Query: 642 NDXXXXXXXXXXXXXXXXXXIITLXXXXXXXXXXXXXNESEPE-EPIDYXXXXXXXXXXX 700
                               I+               N  EPE E IDY           
Sbjct: 660 ---------MIEKPEDLDEVIVLRKTNKNKSIKNKPKNREEPELEIIDYFKTAKVLTNDK 710

Query: 701 XX------XXXXXRAFDPYAASNDAGNAXXXXXXXXMARGKSASFKR 741
                        + FDPY+A+N+   A        + RGK+ SFKR
Sbjct: 711 NSRGGRNNNGNKRKRFDPYSAANEGPAA--PKKRKNVTRGKNVSFKR 755

>Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {ON}
           complement(68981..71221) [2241 nt, 747 aa]
          Length = 746

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/624 (54%), Positives = 454/624 (72%), Gaps = 10/624 (1%)

Query: 1   MAEESNEQLLPKVVGTVRXXXXXXXQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60
           M+E+ N++LL  VV TVR       QDVDFYR+LDK ++ SL+++S E+ +MIN+ LL I
Sbjct: 1   MSEDINKELLSSVVSTVRAASSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSI 60

Query: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDIL-RGRAPDRKGAALMYLDDAAR 119
           ++N+  LE GKE LE   KDFSN+MDNLFEKSDRSLDI+ R +  +   +   YL D+A+
Sbjct: 61  NENNEELESGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQ 120

Query: 120 SDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHXX 179
           SD  P+KR+ KPQ++F RP+DN+E+ PF PLL +KPH+++  +D + ++   E++P H  
Sbjct: 121 SDSNPSKRVTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYA 180

Query: 180 XXXXXXXXXXXXXXSILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLE 239
                         S+L++AEP+ S+PW+ SE  WVD  E+L SML  LK+ TEIAVDLE
Sbjct: 181 HPYEVEIDKQEYNASVLQVAEPLKSQPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLE 239

Query: 240 HHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWL 299
           HHDYRSYYGIVCLMQ+STR+ D+LVDTLALRD+L +LNEVFA+P I+KV HGAFMDIIWL
Sbjct: 240 HHDYRSYYGIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWL 299

Query: 300 QRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSA 359
           QRDLGLY+VSLFDTYHASRALGFPRHSLAYLLE +A+FKTSKKYQLADWRVRPLSK M A
Sbjct: 300 QRDLGLYVVSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHA 359

Query: 360 YARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVD 419
           YARADTHFLLNIYDQ+RN+LI ENKLA VL ESRNVAKR F+YS++RPKVP+ +V++P++
Sbjct: 360 YARADTHFLLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIE 419

Query: 420 RADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDP 479
           + + W+ L+ QYN+P  K  L+K ++EWRD IARRDDESPRY+MPNQL+  LV+YTP+DP
Sbjct: 420 KEEPWRTLVYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDP 479

Query: 480 TGVISVSPTVTDHVRTNAKALANLIVKSLQQIAD--AGSDIKVESVQHK-DQHDLSQVLT 536
            GVISVS  +TDHVR+N+K +ANLI KSL+ +    AG+    +++ +K  Q   S  LT
Sbjct: 480 AGVISVSNVMTDHVRSNSKVIANLIKKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLT 539

Query: 537 VGQIESQVSQFHDLSKAFKGLSQGTXXXXXXXXIIFGNILHAPCGFVGYGRSLKKPVTDK 596
           + QI++  + F +++     + +          I+F NI  +    V Y    +  VT++
Sbjct: 540 ISQIQNMTALFKEIASNPSIIEKDV--SKKIDPILFSNIFLSKNEIVLYDHDKRHVVTNE 597

Query: 597 QIEKRKLELSEALEFIDAETATTI 620
           Q+  R  E+     F++    TT+
Sbjct: 598 QLAGRAEEVE---GFMNEANNTTL 618

>KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/603 (56%), Positives = 429/603 (71%), Gaps = 2/603 (0%)

Query: 1   MAEESNEQLLPKVVGTVRXXXXXXXQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60
           M  E  ++LL  VV TVR       QDVDFYRSLD  V+ S+++ ++EL  M+NS +L I
Sbjct: 1   MLLEEQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSI 60

Query: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDR-KGAALMYLDDAAR 119
           D+N   L+ GKE+L +S K  SN++DNLFEKSDRSLDIL+  A  +       Y ++A  
Sbjct: 61  DENYETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATT 120

Query: 120 SDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHXX 179
           ++ IP KRI KPQ++F  PIDN+E+HPF PLL+ KP+AL+ + +  +L+ +DE++PEH  
Sbjct: 121 TENIPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYA 180

Query: 180 XXXXXXXXXXXXXXSILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLE 239
                         SIL++ EPIPSK W  +E VWVDN ESL+ ML D+KK TEIA+DLE
Sbjct: 181 HPYEYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLE 240

Query: 240 HHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWL 299
           HHDYR+YYGIVCLMQ+STR+TDYLVDT+ALR+DL VLNEVF +P +VKV HGAFMDIIWL
Sbjct: 241 HHDYRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWL 300

Query: 300 QRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSA 359
           QRDLGLYIVSLFDT+HASRALGFPRHSLAYLLE FA+FKTSKKYQLADWRVRPLSKAM+A
Sbjct: 301 QRDLGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTA 360

Query: 360 YARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVD 419
           YARADTHFLLNIYDQLRN+L+  NKL GVL ESRNVAKR F+YSK+RP+VP+ +VYS ++
Sbjct: 361 YARADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALE 420

Query: 420 RADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDP 479
           + D W+ LM QYNIP E+E L+K L+EWRD IARRDDESPRY+MPNQL+  LV YTP DP
Sbjct: 421 KEDPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDP 480

Query: 480 TGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQH-KDQHDLSQVLTVG 538
            GVIS S  VTD+VR+N+K +ANLI  +L +  D    ++  +  H ++ +  +  +TV 
Sbjct: 481 AGVISASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVS 540

Query: 539 QIESQVSQFHDLSKAFKGLSQGTXXXXXXXXIIFGNILHAPCGFVGYGRSLKKPVTDKQI 598
           QI+   S F  +++     +             +   L      + Y    K  V  +Q+
Sbjct: 541 QIKETASVFIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKLDIIEYKNGEKHSVKQQQL 600

Query: 599 EKR 601
             R
Sbjct: 601 VSR 603

>Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001W
           (REAL)
          Length = 745

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/586 (58%), Positives = 421/586 (71%), Gaps = 4/586 (0%)

Query: 1   MAEESNEQLLPKVVGTVRXXXXXXXQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60
           MA E+++ LL KVV  +R       QDVDFYR+LD+  +K L   S++L  M+N  +L I
Sbjct: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78

Query: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDIL-RGRAPDRKGAALMYLDDAAR 119
           D++   LE  +E++ D  KDF N+MDNL EKSD SLD L R    +   A L YL D + 
Sbjct: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSG 138

Query: 120 SDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHXX 179
            D  P KR+ KPQ++F+ PIDN+E+HPF PLL+ KP+AL+PLSD +R+++ +E+ P H  
Sbjct: 139 KDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYP 198

Query: 180 XXXXXXXXXXXXXXSILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLE 239
                         +IL+I   IPSKPWD SEP+W+++K +L SML+DLK + EIAVDLE
Sbjct: 199 HPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLE 258

Query: 240 HHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWL 299
           HHDYRSYYG+VCLMQVSTR+ DYLVDTL LR+DL +LNEVF NP IVKVFHGAFMDIIWL
Sbjct: 259 HHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWL 318

Query: 300 QRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSA 359
           QRDLGLY+V LFDTYHAS+A+G PRHSLAYLLE FA+FKTSKKYQLADWR+RPLSK M+A
Sbjct: 319 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 378

Query: 360 YARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVD 419
           YARADTHFLLNIYDQLRNKLI  NKLAGVL ESRNVAKR F+YSKYRP  P+S VYSP +
Sbjct: 379 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTE 438

Query: 420 RADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDP 479
           + + W+VLM QYNI  E+E LVK+LYEWRD IARRDDESPR++MPNQLLA LV YTP+D 
Sbjct: 439 KENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDV 498

Query: 480 TGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHDLSQVLTVGQ 539
            GV+S+S  VTDHVR NAK LANLI  +L+ + D   +   E V  K +    + +TV Q
Sbjct: 499 IGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKE-SAEIVSSKFKSASLEAITVSQ 557

Query: 540 IESQVSQFHDLSKAFKGLSQGTXXXXXXXXIIFGNILHAPCGFVGY 585
           I   + +F   S     +++          I+FG IL    G + Y
Sbjct: 558 IRDIMDRFSVFSS--NSVTEDRSMDSTASSILFGKILPYEEGDIVY 601

>TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/620 (57%), Positives = 438/620 (70%), Gaps = 11/620 (1%)

Query: 1   MAEESNEQLLPKVVGTVRXXXXXXXQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60
           M     +QLL KVV T+R       QDVDF+RSL + + KSLD+TS  +VS+INS L  I
Sbjct: 1   MPPAEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSI 60

Query: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDRK--GAALMYLDDAA 118
           DQNS  L  GKE L +  KDFSN+MDNLFE SD S DIL  RAP  +  G  L +LD+++
Sbjct: 61  DQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADIL-TRAPGSRKDGEKLKFLDNSS 119

Query: 119 RSDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPL-SDCVRLVQADEDIPEH 177
            +D IP+KRI KPQ+ F+ P++NTE  PF PLL+ KP ALRPL SD   +V  ++ +PEH
Sbjct: 120 SNDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISD---IVPGNDAVPEH 176

Query: 178 XXXXXXXXXXXXXXXXSILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVD 237
                           S++  +EPIPSKPW+ +E +WVDN E L +M+ DLK  TEIAVD
Sbjct: 177 YAQPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVD 236

Query: 238 LEHHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDII 297
           LEHHDYRSYYGIVCLMQ+STR+ DYL+DT+ALRDDL +LNEVFANP I+KVFHGAFMDII
Sbjct: 237 LEHHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDII 296

Query: 298 WLQRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAM 357
           WLQRDLGLY+VSLFDT+HASRA+G PRHSLAYLLE FA+FKTSKKYQLADWR+RPLSKAM
Sbjct: 297 WLQRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAM 356

Query: 358 SAYARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSP 417
           +AYARADTHFLLNIYDQLRN LI +NKLAGVLAESRNVAKR F+YSK+RP  P+ +VY P
Sbjct: 357 NAYARADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCP 416

Query: 418 VDRADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPL 477
           +D+ D WKVLM QY+I   +E LVK LY+WRDTIARRDDESPRYVMPNQLL  L    P 
Sbjct: 417 IDKPDPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPT 476

Query: 478 DPTGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHDLSQVLTV 537
           +P  VISV+  VTDHVR+N+  LA+LI  +L   +D  SD K       +  D + +LTV
Sbjct: 477 EPINVISVNSIVTDHVRSNSLVLAHLIKNTLAS-SDKESD-KGTFEADNNSTDAASLLTV 534

Query: 538 GQIESQVSQFHDLSKAFKGLSQGTXXXXXXXXIIFGNILHAPCGFVGYGRSLKKPVTDKQ 597
            QI+   + F  +S+AF  L             IF +IL +    V Y  +    +T K+
Sbjct: 535 PQIQKLAACFAGVSRAFTILQNEYKDGRSSS--IFTDILTSEDDAVNYVGNNMDHITKKE 592

Query: 598 IEKRKLELSEALEFIDAETA 617
           + KR  +  +++E  D  T+
Sbjct: 593 LGKRAAKALQSMEQFDEATS 612

>TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON}
           Anc_6.25 YOR001W
          Length = 743

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/631 (51%), Positives = 435/631 (68%), Gaps = 5/631 (0%)

Query: 7   EQLLPKVVGTVRXXXXXXXQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCIDQNSRL 66
           ++LLP VV +VR       QDVDFYRSLDK +A SL  TS ++  MINS +  +D+NS  
Sbjct: 4   DELLPLVVSSVRAASALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEG 63

Query: 67  LEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDIL-RGRAPDRKGAALMYLDDAARSDMIPA 125
           L  GKE L++S KD  NL+D+LFE +D S+D L +          + YL+D+   +    
Sbjct: 64  LVEGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNV 123

Query: 126 KRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHXXXXXXXX 185
            R+ KPQ+ F  P+DN+ETHPF+PLL +KP+A+ PL + +++V   ED P+H        
Sbjct: 124 TRLSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETE 183

Query: 186 XXXXXXXXSILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLEHHDYRS 245
                    +L+ ++PIPSK W+ +E +WVDN+ESL +ML +LK +TE+AVDLEHHD+RS
Sbjct: 184 IDKQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRS 243

Query: 246 YYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWLQRDLGL 305
           YYGI CLMQ+STR TDYLVDT+ALRD L VLN VF +P I K+ HGAFMDIIWLQRDLGL
Sbjct: 244 YYGITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGL 303

Query: 306 YIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSAYARADT 365
           YIVSLFDTYHASRALGFPRHSLAYLLE FA FKTSK+YQLADWR RPLSKAM+AYARADT
Sbjct: 304 YIVSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADT 363

Query: 366 HFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVDRADGWK 425
           HFLLNI+DQLRN LI E+KLA +L ESR VAKR F+YSKY+P +P+S+V+SP +    W+
Sbjct: 364 HFLLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWR 423

Query: 426 VLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDPTGVISV 485
            ++ QYNIP +K  LVK L+EWRDTIARRDDESPRY+MPNQL+A LV+Y P +P GVISV
Sbjct: 424 SMIYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISV 483

Query: 486 SPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHDLSQVLTVGQIESQVS 545
           +  +TD VR+NAKA+ANLI  +L+ + +      V S   KD+   S  L+  QI+  VS
Sbjct: 484 NRMMTDPVRSNAKAIANLIKSTLEDMKNNNISTTVVSTTAKDKETSSNDLSTSQIKFIVS 543

Query: 546 QFHDLSKAFKGLSQG---TXXXXXXXXIIFGNILHAPCGFVGYGRSLKKPVTDKQIEKRK 602
           QF ++ + +   +              ++F  I ++    + Y +  K  +T++Q+  R+
Sbjct: 544 QFENILEKYSSNNSNLNDVTSKEGKDSLVFSKIFNSRDDIITYDKGTKHLITEQQLSDRQ 603

Query: 603 LELSEALEFIDAETATTIQEEDRGSELTHEP 633
            E+  A++  + E A +++ +D   E   +P
Sbjct: 604 KEVDAAMKQAE-EIAFSMEVQDTHKESMKQP 633

>KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {ON}
           Anc_6.25 YOR001W
          Length = 738

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/618 (53%), Positives = 424/618 (68%), Gaps = 8/618 (1%)

Query: 1   MAEESNEQLLPKVVGTVRXXXXXXXQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60
           M  E  ++LL K VGTVR       QDV F+ +LD  VA S+ +  NE++ MIN  L  I
Sbjct: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60

Query: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILR--GRAPDRKGAALMYLDDAA 118
           D+NS+      E++ +S +DF+NL DNLFEKSDRS+DI+    R   + G+ + YLDD  
Sbjct: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120

Query: 119 RSDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHX 178
            +D    KRI KPQ+ F RP+DN+E+ PFKPLL  KP+AL+PL + +++V A E+IP H 
Sbjct: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180

Query: 179 XXXXXXXXXXXXXXXSILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDL 238
                           IL+   PIPS PW  SEPVWVD+ E L S+L+DLKK  E+A+DL
Sbjct: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240

Query: 239 EHHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIW 298
           EHHDYRSYYGIVCLMQ+STR TDYLVDT+ALRD+L +LN+VF +P++ KVFHGAFMDIIW
Sbjct: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300

Query: 299 LQRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMS 358
           LQRDLGLYIVSLFDT+HAS+ALGFP+HSLAYLLET A+FKTSKKYQLADWR+RPLSK MS
Sbjct: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360

Query: 359 AYARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPV 418
            YARADTHFLLNI+DQ+RN+LI +NKLAGVL ESR VAKR F+YSK+RPK+    V++P+
Sbjct: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420

Query: 419 DRADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLD 478
           ++   W+ LM QYN+  EKE LVK LYEWRDTIARRDDESPRY+MPNQLL  L  YTP D
Sbjct: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480

Query: 479 PTGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHDLSQVLTVG 538
           P  ++SV+  VTD VR+N+K LANLI KS  + +  G   +     + +      VLT+ 
Sbjct: 481 PVSLVSVNSYVTDCVRSNSKVLANLI-KSFVESSKLGP--QSSYTPNTENTSTPFVLTLS 537

Query: 539 QIESQVSQFHDLSKAFKGLSQGTXXXXXXXXIIFGNILHAPCGFVGYGRSLKKPVTDKQI 598
           QI+    +F  L++ F+  S             FG++       V Y  +   PV+   +
Sbjct: 538 QIKDIGMRFTKLTENFQS-SSCQKISPLQRSSFFGDLSKGKVT-VSYNDAKTTPVSQSVL 595

Query: 599 EKRKLELSEALE-FIDAE 615
           E R  + +E ++ F D E
Sbjct: 596 ESRSKQFNEYMKAFGDIE 613

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
           exosome exonuclease component; has 3'-5' exonuclease
           activity; involved in RNA processing, maturation,
           surveillance, degradation, tethering, and export; has
           similarity to E. coli RNase D and to human PM-Sc1 100
           (EXOSC10); mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/612 (54%), Positives = 419/612 (68%), Gaps = 5/612 (0%)

Query: 1   MAEESNEQLLPKVVGTVRXXXXXXXQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60
           M  E+ + LL +V+  VR       QDVDFY++LD+G +K L   +++L  M N  +L I
Sbjct: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSI 60

Query: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDR-KGAALMYLDDAAR 119
           D++    E  +E + D   +F N+MDNL E SD SLD L      + +G+ L YL + + 
Sbjct: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG 120

Query: 120 SDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHXX 179
            +  P KR+ KPQ++F+ PIDN+E+HPF PLL+ KP+AL+PLS+ +RLV  DE+ P H  
Sbjct: 121 KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP 180

Query: 180 XXXXXXXXXXXXXXSILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLE 239
                          IL+I E IPSK WD S P+WVD    L+SML+DLK + EIAVDLE
Sbjct: 181 HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE 240

Query: 240 HHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWL 299
           HHDYRSYYGIVCLMQ+STR+ DYLVDTL LR++L +LNEVF NP IVKVFHGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL 300

Query: 300 QRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSA 359
           QRDLGLY+V LFDTYHAS+A+G PRHSLAYLLE FA+FKTSKKYQLADWR+RPLSK M+A
Sbjct: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 360

Query: 360 YARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVD 419
           YARADTHFLLNIYDQLRNKLI  NKLAGVL ESRNVAKR F+YSKYRP  P+S VYSP++
Sbjct: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE 420

Query: 420 RADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDP 479
           +   WK+LM QYNIP E+E+LV+ LY+WRD IARRDDESPR+VMPNQLLA LV YTP D 
Sbjct: 421 KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV 480

Query: 480 TGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSD-IKVESVQHKDQHDLSQVLTVG 538
            GV+S++  VT+HVR NAK LANLI  +L+ I +   +   + S + K    L + ++V 
Sbjct: 481 IGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISVP 540

Query: 539 QIESQVSQFHDLSKAFKGLSQGTXXXXXXXXIIFGNILHAPCGFVGYGR-SLKKPVTDKQ 597
           QI   + +F  L  +   +S+          I+ G IL      + Y +  L   V  + 
Sbjct: 541 QIRDVMERFSVLCNS--NISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTED 598

Query: 598 IEKRKLELSEAL 609
           I  R      AL
Sbjct: 599 IRIRAQNFKSAL 610

>NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {ON}
           Anc_6.25 YOR001W
          Length = 790

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/556 (59%), Positives = 413/556 (74%), Gaps = 12/556 (2%)

Query: 7   EQLLPKVVGTVRXXXXXXXQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCIDQNSRL 66
           +QLLP+VV TVR       QDVDFYRS+DK  AK+L +T+++L  MINS LL +D+NS  
Sbjct: 26  DQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSET 85

Query: 67  LEGGKEKLEDSRKDFSNLMDNLFEKSDRSLD-ILRGRAPDRKGAALMYLDDAARSDMIPA 125
           L+G KE LED+ KDFSNLMDNL EKSDRS+D +LR +  +   + + YLD+ +  D   +
Sbjct: 86  LDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSS 145

Query: 126 KR--ILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHXXXXXX 183
           KR  I KPQ+ F  P+DNTETHPF PLL++KP+AL+ L + ++L+  DE++PEH      
Sbjct: 146 KRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYE 205

Query: 184 XXXXXXXXXXSILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLEHHDY 243
                      IL++++PIPS+PW  +  +WVD  ESL SM++DL   TE AVDLEHHDY
Sbjct: 206 YEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDY 265

Query: 244 RSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWLQRDL 303
           R+YYGIVCLMQ+STR  DY+VDTL LR  L  LNE F NP I KV HGAFMDIIWLQRDL
Sbjct: 266 RTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDL 325

Query: 304 GLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSAYARA 363
           GLYIVSLFDT+HASRALGFP++SLAYLLE F++FKTSKKYQ+ADWR+RPLSKAM++YAR+
Sbjct: 326 GLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARS 385

Query: 364 DTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVDRADG 423
           DTHFLLNI+DQ+RNKL+ + KLAGVL ESRNVAKR F+Y KYRP + +S+VYSP+++ D 
Sbjct: 386 DTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDP 445

Query: 424 WKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDPTGVI 483
           WK LM QYNIPL KE+L+K LY+WRD IARRDDESPRY+MPNQLL  LV Y P++P GV+
Sbjct: 446 WKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVV 505

Query: 484 SVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQH---------DLSQV 534
           SVS  VTDHVR+N+K LANLI   L +I D      +   Q ++Q          DLS+ 
Sbjct: 506 SVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSEQ 565

Query: 535 LTVGQIESQVSQFHDL 550
           L++ Q+ +  SQF  L
Sbjct: 566 LSIHQLNTLKSQFLSL 581

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
           (REAL)
          Length = 734

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/590 (55%), Positives = 413/590 (70%), Gaps = 5/590 (0%)

Query: 1   MAEESNEQLLPKVVGTVRXXXXXXXQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60
           M  E+ + L  K+V  VR       QDVDFY++L++  +  L   S++L  M+N  +L I
Sbjct: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60

Query: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDR-KGAALMYLDDAAR 119
           D++    E  ++++    KDF N+MDNL E SD SLD L   A  +  GA L YL D + 
Sbjct: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120

Query: 120 SDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHXX 179
            D +  KR+ KPQ++F++ IDN+E+HPF PLL+ KP+AL+PLS+ +RL +A+E+ P H  
Sbjct: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPLSESLRLAEAEENNPSHYL 180

Query: 180 XXXXXXXXXXXXXXSILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLE 239
                          +L+I + IPSK WD SEP+W+D K  L  ML+DLK ++EIAVDLE
Sbjct: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240

Query: 240 HHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWL 299
           HHDYRSYYGIVCLMQVSTR+ DYLVDT+ LRD L +LNEVF +PLIVKVFHGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300

Query: 300 QRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSA 359
           QRDLGLY+V LFDTYHAS+A+G PRHSLAYLLE FA+FKTSKKYQLADWR RPLSK M+A
Sbjct: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360

Query: 360 YARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVD 419
           YARADTHFLLNIYDQLRNKLI  NKLAGVL ESRNVAKR F+YSK+RP+ P+S VYSP++
Sbjct: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420

Query: 420 RADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDP 479
           + + W+VLM QYNI  EKE LVK+LY WRD IARRDDESPR+VMPNQLLA LV Y P+D 
Sbjct: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480

Query: 480 TGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSD-IKVESVQHKDQHDLSQVLTVG 538
            GV+S++  VT+HVR NAK LANLI  +L  I D       + S + K      +V+T+ 
Sbjct: 481 IGVVSLTNGVTEHVRQNAKVLANLIENALGNIKDTNKKTTSITSSESKPDGISLEVITIS 540

Query: 539 QIESQVSQFHDLSKAFKGLSQGTXXXXXXXXIIFGNIL-HAPCGFVGYGR 587
           QI   + +F  LS +   ++  T        I+ G  L    CG + YG+
Sbjct: 541 QIRDIMERFSLLSNS-GVINNRTKTGDSTSSILLGKTLPFEECG-ISYGK 588

>Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001W
           (REAL)
          Length = 773

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/612 (54%), Positives = 418/612 (68%), Gaps = 5/612 (0%)

Query: 1   MAEESNEQLLPKVVGTVRXXXXXXXQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60
           MA ++ + LL KVV  +R       QDVDFY++LD+   K L   S++L  M N  +L I
Sbjct: 41  MASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSI 100

Query: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDIL-RGRAPDRKGAALMYLDDAAR 119
           D++    E   E +     DF N+MDNL E SD SLD L R       GA L YL D + 
Sbjct: 101 DEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSE 160

Query: 120 SDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHXX 179
            ++ PAKR+ KPQ++F+ PIDN+E+HPF PLL+ KP+AL+PLSD +RL++ D++ P H  
Sbjct: 161 KNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYP 220

Query: 180 XXXXXXXXXXXXXXSILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLE 239
                         +IL+I + IPSK W+ SEP+W+D    L+SML++LK   EIAVDLE
Sbjct: 221 HPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLE 280

Query: 240 HHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWL 299
           HHDYRSYYGIVCLMQ+STR+ DYLVDTL LR+ L +LNEVF +P IVKVFHGAFMDIIWL
Sbjct: 281 HHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWL 340

Query: 300 QRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSA 359
           QRDLGLY+V LFDTYHAS+A+G PRHSLAYLLE FA+FKTSKKYQLADWR+RPLSK M A
Sbjct: 341 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIA 400

Query: 360 YARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVD 419
           YARADTHFLLNIYDQLRNKLI  NKLAGVL ESRNVAKR F+YSKYRP++P+S VYSP++
Sbjct: 401 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIE 460

Query: 420 RADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDP 479
           +   W+VLM QYNI  EKE LVK+LY+WRD IARRDDESPR+VMPNQLLA LV YTP+D 
Sbjct: 461 KEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDV 520

Query: 480 TGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHDLS-QVLTVG 538
            GVIS++  +T+HVR NAK L NLI  SL+ I D   +    +      +++S + +T+ 
Sbjct: 521 IGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAITIP 580

Query: 539 QIESQVSQFHDLSKAFKGLSQGTXXXXXXXXIIFGNILHAPCGFVGY-GRSLKKPVTDKQ 597
           QI   + +F  LS +   +S           I+ G IL      + Y    L   V  + 
Sbjct: 581 QIRDIMERFSVLSNS--NVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFED 638

Query: 598 IEKRKLELSEAL 609
           I  R    + AL
Sbjct: 639 IRARAQSFNSAL 650

>CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001w RRP6
          Length = 737

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/754 (47%), Positives = 470/754 (62%), Gaps = 30/754 (3%)

Query: 1   MAEESNEQLLPKVVGTVRXXXXXXXQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60
           M+ +S + +L KV+ TVR       QDV+F++S+D  VA SL+K+   + S++N+ LL I
Sbjct: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60

Query: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDIL-RGRAPDRKGAALMYLDDAAR 119
           D N+  L+G  E LE+  K+FSN+MD LFEK+DRSLDIL R  + +     + +LDD   
Sbjct: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120

Query: 120 SDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHXX 179
           ++  P++RI KPQ+ F+ P+DN+E+HPFKPLL  KP+AL+ + +  +LV A EDIPEH  
Sbjct: 121 AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180

Query: 180 XXXXXXXXXXXXXXSILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLE 239
                          IL+  EPIPS  W  +  +WVDN  SL  M+Q+LKKS+EIAVDLE
Sbjct: 181 QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240

Query: 240 HHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWL 299
           HHD+RSYYG+VCLMQ+STR  DY+VDT+ALRDDL +LNEVF NPLI KVFHGAFMDIIWL
Sbjct: 241 HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300

Query: 300 QRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSA 359
           QRDLGLYIVSLFDT+HAS+ALG P+HSLAYLLE +A+FKTSKKYQLADWR RPLSKAM A
Sbjct: 301 QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360

Query: 360 YARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVD 419
           YARADTHFLLNI+DQ+RN LI   KLAGVL ESRNVA R F+YSKY+PK+P +++++PV+
Sbjct: 361 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420

Query: 420 RADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDP 479
           +   W+ LM QYNIP++KE L++ LYEWRD +ARRDDESPRYVMPNQLL  LV Y P+DP
Sbjct: 421 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480

Query: 480 TGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHDLSQVLTVGQ 539
             V+SVS  VTDHVR N+K LANLI K L++I       +V+S+ ++    L   L V Q
Sbjct: 481 ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLG----EVKSINNR----LPSSLDVSQ 532

Query: 540 IESQVSQFHD---LSKAFK----GLSQGT-XXXXXXXXIIFGNILHAPCGFVGYGRSLKK 591
            E Q    H    ++ AFK     L+Q T         ++   IL  P   V Y      
Sbjct: 533 DELQFLPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSAC 592

Query: 592 PVTDKQIEKRKLELSEALEFIDAETATTIQE-EDRGSELTHEPADDKKVSENDXXXXXXX 650
            V + +++ R L   +A     ++    + E  +  + L  E   +KK  +         
Sbjct: 593 SVEESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQ-------IQ 645

Query: 651 XXXXXXXXXXXIITLXXXXXXXXXXXXXNESEP--EEPIDYXXXXXXXX-XXXXXXXXXX 707
                      I+ L             ++     EEP+DY                   
Sbjct: 646 VIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKK 705

Query: 708 RAFDPYAASNDAGNAXXXXXXXXMARGKSASFKR 741
           R FDPY+++ +   A        + +GK  SFK+
Sbjct: 706 RVFDPYSSTGEGPKA--AKKRRLVTKGKKISFKK 737

>KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 744

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/661 (48%), Positives = 442/661 (66%), Gaps = 21/661 (3%)

Query: 1   MAEESNEQLLPKVVGTVRXXXXXXXQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60
           M+ E  + LL  +V TVR       QD+DFY+SLD  +  SL+ TS  ++S+IN  LL I
Sbjct: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTSTNILSLINDLLLSI 60

Query: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDRKGA-ALMYLDDAAR 119
           D N+ +++ GK+   DS K  SN+MDNLFEKSD +LD +R       G  +L YL+D  R
Sbjct: 61  DPNNDVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRAGNGGNAGGPSLKYLNDDDR 120

Query: 120 SDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHXX 179
           S+  P+KRI KPQ+ F+ P+DNTE HPFKPLLE KPH+L+P    +++V  +E IP H  
Sbjct: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180

Query: 180 XXXXXXXXXXXXXXSILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLE 239
                         SIL   EPIPSK WD +E +WVD  E L+ M  +L K+TE+A+DLE
Sbjct: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240

Query: 240 HHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWL 299
           HHDYRSYYGIVCLMQ+S R+ D++VDT+ALR++L +LN++F +P + KV HGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300

Query: 300 QRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSA 359
           QRDLGLYIV LFDTYHASR LGFP+HSLAYLLE FA+FKTSKKYQLADWR+RPL+K M A
Sbjct: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360

Query: 360 YARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVD 419
           YARADTHFLLNI+D+LRN L+ +NK++ VL ESR VAKR F+YS +RPKVP+S+V+SP++
Sbjct: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420

Query: 420 RADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDP 479
           + + WK +M QYNIP  KE+L++ LYEWRDTIARRDDESPRYVMPNQLL  LV   P +P
Sbjct: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480

Query: 480 TGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQH--DLSQVLTV 537
             V+SVS  V++H+RTN+K +ANLI ++L+ +    +   +  ++  + +  DL+ ++T 
Sbjct: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540

Query: 538 GQIESQVSQFHDLSKAFKGLSQGTXXXXXXXXIIFGNILHAPCGF-VGYGRSLKKPVTDK 596
            QI+S  + FH L+       +          ++F  I +      V Y    +  +   
Sbjct: 541 SQIKSIQNIFHSLASEINS-QKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQH 599

Query: 597 QIEKRKLELSEAL--EFIDAETATTI-------------QEEDRGSELTHEPADDKKVSE 641
           ++ KR+ E++  L  E+ D +  + +              +E+R   +T +P+ + ++ E
Sbjct: 600 ELLKRQHEITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSDPSQE-EIEE 658

Query: 642 N 642
           N
Sbjct: 659 N 659

>ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR001W
           (RRP6)
          Length = 745

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/728 (45%), Positives = 442/728 (60%), Gaps = 11/728 (1%)

Query: 1   MAEESNEQLLPKVVGTVRXXXXXXXQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60
           MA    + L  ++V T+R       QD+DFYRSL   V + LD TS  +VS+IN  LL +
Sbjct: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60

Query: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLD-ILRGRAPDRKGAALMYLDDAAR 119
           D+N+  L+ G++  EDS K+ SN+MDN+FEKSD + D I  G +   +G  + YL D++ 
Sbjct: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120

Query: 120 SDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHXX 179
            D  P+KRI KPQ+ F+ P+DNTE HPFKPLL+ KPHAL+PL + + L   +E++P H  
Sbjct: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180

Query: 180 XXXXXXXXXXXXXXSILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLE 239
                         S+L++ E I  +PW+ +EP+WVDN ESL  ML +LK+  E+AVDLE
Sbjct: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240

Query: 240 HHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWL 299
           HHDYRSYYGIVCLMQ+S+R  D+LVDT+ALRDDL VLN +  +P +VKVFHGAFMD+IWL
Sbjct: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300

Query: 300 QRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSA 359
           QRDLGLY+VSLFDTYHASRALGFP+HSLAYLLETFA FKTSKKYQLADWRVRPL K +  
Sbjct: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360

Query: 360 YARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVD 419
           YAR+DTHFLL+IYD LRN L+   KLA VL  SRNVAKR F+Y+ +RP++P+S+VYSP++
Sbjct: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420

Query: 420 RADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDP 479
             + W+ LM QYN+P  KE L+K LYEWRDT+ARRDDES RYVMPNQLL  LV  +P + 
Sbjct: 421 STEPWRKLMYQYNLPPSKEPLLKKLYEWRDTVARRDDESVRYVMPNQLLVSLVSLSPSET 480

Query: 480 TGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHDLSQVLTVGQ 539
            GV+SVS  VTD+VR+NA+ LANLI ++L+ I    + +   S   +   + +  L++  
Sbjct: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSERALSNPAATLSLHM 540

Query: 540 IESQVSQFHDLSKAFKGLSQGTXXXXXXXXIIFGNILHAPCGFVGYGRSLKKPVTDKQIE 599
           I++    F  L    +  S G+        ++F + L      V Y    K  + D  ++
Sbjct: 541 IQNLDDHFRSLLMEAQKQS-GSICSQHSSSLLFNSDLATGPSAVEYTNGQKHVIGDNVLQ 599

Query: 600 KRKLELSEALEFIDAETATTIQEEDRGSELTHEPADDKKVSENDXXXXXXXXXXXXXX-X 658
            RK  L +       E  T I+     S  +  P   + +S ++                
Sbjct: 600 TRKHALLQKFTSQPVEPVTDIEAPSHQSS-SENPQVSEDISPSEPQESQNEVQKDEPDFE 658

Query: 659 XXXIITLXXXXXXXXXXXXXNESEPEEPIDYXXXXXXXXXXXXXXXX-------XXRAFD 711
              I+ L               S P E +DY                         R FD
Sbjct: 659 KSEIVVLRKKKKAHAQKPKGTSSSPTETVDYSNAKEVLGKGTSSTAKRGDKDRPRKRKFD 718

Query: 712 PYAASNDA 719
           PY   N+A
Sbjct: 719 PYGQDNNA 726

>TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6.25
           YOR001W
          Length = 771

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/641 (50%), Positives = 433/641 (67%), Gaps = 13/641 (2%)

Query: 1   MAEESNEQLLPKVVGTVRXXXXXXXQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60
           M+E++ E+LL  +VG VR       QDVDFY+SLDK V+ SL+KT+N+ + + NS LL I
Sbjct: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85

Query: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDIL-RGRAPDRKGAALMYLDDAAR 119
           D+N   LE GK+++ D    FSN+MDNL EKSD  +D L +    + K     +LD+ +R
Sbjct: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSR 145

Query: 120 SDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHXX 179
           ++  P+KRI KPQ+ F +P+DNT++ PFKPLL  KP+AL+PL D + LV     +P H  
Sbjct: 146 TNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYL 205

Query: 180 XXXXXXXXXXXXXXSILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLE 239
                          +++I +P P KPW+ +  +W+D KESL  +L DL+K +EIAVDLE
Sbjct: 206 QPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLE 265

Query: 240 HHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWL 299
           HHD RSYYGI CLMQ+STR+ DY+VDT++LRDDL+VLNE+F NP I KVFHGA MDIIWL
Sbjct: 266 HHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWL 325

Query: 300 QRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSA 359
           QRDLGLYIVSLFDT+HAS+ALG  RHSLAYLLE +ASFKTSKKYQLADWR RPL+  M A
Sbjct: 326 QRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLA 385

Query: 360 YARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVD 419
           YAR+DTHFLLNI+DQLRN LI +NKLAGVL ESRNVAKR F+Y K+RP VP  ++Y+ ++
Sbjct: 386 YARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIE 445

Query: 420 RADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDP 479
           +   WK L+ QYNI  EKEILV+ L+EWRD IARRDDESPRY+MP Q+L  L+ YTP D 
Sbjct: 446 KEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDS 505

Query: 480 TGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHD--LSQVLTV 537
           +GVISVS  VT+HVR+N+  LANLI K+L+      +     S  +  + D  ++ ++++
Sbjct: 506 SGVISVSNMVTEHVRSNSTTLANLIKKALESTKSIPNSSDSSSTFNMSRTDTNVASLISI 565

Query: 538 GQIESQVSQFHDLSKAF---KGLSQGTXXXXXXXXIIFGNILHAPCGFVGYGRSLKKPVT 594
            +I +   +F+ LSK +   K L+ G         ++F NI+ +      Y +       
Sbjct: 566 TEINNICLKFNSLSKHYNTSKFLTSGI----EVSSLLFSNIMTSSPKISDYSKDKTTSFK 621

Query: 595 DKQIEKRKLELSEALEFIDAETATTIQ---EEDRGSELTHE 632
            + +  R + LSE L+ + A  +   Q   E+ +  E+T E
Sbjct: 622 SEDMIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTE 662

>Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001W
           (RRP6) - involved in 5.8S rRNA processing [contig 185]
           FULL
          Length = 735

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/557 (54%), Positives = 391/557 (70%), Gaps = 6/557 (1%)

Query: 3   EESNEQLLPKVVGTVRXXXXXXXQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCIDQ 62
           E+    +L +VVGT+R       QDVDFY+SLD  +++SLD+TS +L+S+IN  ++ ID 
Sbjct: 6   EDKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLSLINDVVISIDD 65

Query: 63  NSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDRKGAALMYLDDAARSDM 122
           N+ L+E G+  LE+S  +   +MD LFEKS+ +L  ++ +  +  G  L YLDD+     
Sbjct: 66  NNDLIEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGSNIIGNNLQYLDDSQPLTD 125

Query: 123 IPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHXXXXX 182
               +I KPQ  F RP+DNTE+HPFKPLL  KP+ALRPL D ++L   +E IP H     
Sbjct: 126 TTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPY 185

Query: 183 XXXXXXXXXXXSILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLEHHD 242
                      S+L+I  PIPSKPW+ ++  WVDN  +L+ M+++L K+ E+A+DLEHHD
Sbjct: 186 EYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHD 245

Query: 243 YRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWLQRD 302
           YR+YYGI CLMQ+STR+ D+LVDT+ALRD L VLNE+F NP ++KVFHGAFMD+IWLQRD
Sbjct: 246 YRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRD 305

Query: 303 LGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSAYAR 362
           LGLY+VSLFDT+HASR LGFP+HSLAYLLE +A FKTSKKYQLADWR+RPLSK + AYAR
Sbjct: 306 LGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYAR 365

Query: 363 ADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVDRAD 422
           ADTHFLLNIYDQ+RN LI + KLA  L  SR VAKR F+Y+K+RP V  S VYSPV+R D
Sbjct: 366 ADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVERED 425

Query: 423 GWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDPTGV 482
            W+ L+  YNIP  K  L+K LYEWRDTIARRDDESPRYVMPNQLL  LV   P D  G+
Sbjct: 426 PWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGL 485

Query: 483 ISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHD--LSQVLTVGQI 540
           +SV+  VT+HVR+NAK+L+ LI K+L    D  +D     + H D +   +   L+ G +
Sbjct: 486 LSVTSFVTEHVRSNAKSLSQLIKKTLASPQDLFTD----QINHMDSNKSMVDSKLSPGDV 541

Query: 541 ESQVSQFHDLSKAFKGL 557
           ++    F   ++  + L
Sbjct: 542 KANHQNFDQYTRKSREL 558

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii ACL001C
          Length = 747

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/619 (50%), Positives = 415/619 (67%), Gaps = 17/619 (2%)

Query: 1   MAEESNEQLLPKVVGTVRXXXXXXXQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60
           M+ ++ + LL K++GTVR       QD+DF R LD  V + LD+TS  +VS++N  +L  
Sbjct: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60

Query: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDRKGAA---LMYLDDA 117
            + +  LE GK+ LE + KD SN++DNLFEKSD SLD+L+             + YL+  
Sbjct: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHSLDVLQKLLSSSSSQLDTNMQYLNVD 120

Query: 118 ARSDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEH 177
           ++ D   ++RI+KPQ++F+ P+DN+E HPFKPLL+ KPHAL+PL +   L    E +P H
Sbjct: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180

Query: 178 XXXXXXXXXXXXXXXXSILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVD 237
                           S+L I EPI    WD +EP+WVDN  +L+ ML  LK   EIAVD
Sbjct: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240

Query: 238 LEHHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDII 297
           LEHHDYRSYYG+VCLMQ+STR++D+LVDT+ALR DL VLNE+F +P I+KVFHGAFMDII
Sbjct: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300

Query: 298 WLQRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAM 357
           WLQRDLGLY+VSLFDTYHASRALGFP+HSLAYLLETFA+FKTSKKYQLADWR+RPLSK M
Sbjct: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360

Query: 358 SAYARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSP 417
             YARADTHFLLNIYD+LRN LI E+KL+GVL  SRNVAKR F+Y+ +RPKV + +V+SP
Sbjct: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420

Query: 418 VDRADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPL 477
           +++ D W+ LM+QYN+P  KE L++ LY+WRD +AR+DDES RYVMPNQLL  LV   P 
Sbjct: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480

Query: 478 DPTGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIK-VESVQHKDQHDLSQVLT 536
           DP+G+++V   + DHVR NA+ L N+I K++++I     + + +E+V        +  ++
Sbjct: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVT-------TTYVS 533

Query: 537 VGQIESQVSQFHDLSKAFKGLSQGTX------XXXXXXXIIFGNILHAPCGFVGYGRSLK 590
               E  VS    + + FK L                  ++F   L      V Y    K
Sbjct: 534 AQDPEMSVSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGK 593

Query: 591 KPVTDKQIEKRKLELSEAL 609
           + V D+++  RK +LS+  
Sbjct: 594 RLVNDRELLDRKSDLSQKF 612

>KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {ON}
           similar to uniprot|Q12149 Saccharomyces cerevisiae
           YOR001W RRP6 Exonuclease component of the nuclear
           exosome contributes to the quality-control system that
           retains and degrades aberrant mRNAs in the nucleus
          Length = 735

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/610 (49%), Positives = 399/610 (65%), Gaps = 19/610 (3%)

Query: 9   LLPKVVGTVRXXXXXXXQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCIDQNSRLLE 68
           +L +V+ T+R       QDV FY++LD  +A S++  S  L+ +IN  LL +D+N+ ++E
Sbjct: 12  VLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDENNDIIE 71

Query: 69  GGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDRKGAALMYLDDAARSDMIPAKRI 128
            G E LE +  +   +MD LFEKS+ +L     R        + YLDD+        K+I
Sbjct: 72  QGSEGLESAWSNVGEVMDLLFEKSEHALAAGEKRDNGELSKTVQYLDDSPSLHDGAPKKI 131

Query: 129 LKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHXXXXXXXXXXX 188
           LKPQ+ F+RPIDN+E+HPFKPLL+ KPHALR L + +RL    ED+P H           
Sbjct: 132 LKPQLLFKRPIDNSESHPFKPLLKKKPHALRSLDESLRLTAEQEDVPAHYPQPYEYEIDH 191

Query: 189 XXXXXSILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLEHHDYRSYYG 248
                S+L+I+EP+PS PWD +E  WVDN ++L  ML +L  + EIA+DLEHHDYR+YYG
Sbjct: 192 QEYNESVLQISEPVPSLPWDETEAEWVDNTDALKLMLNELLLANEIAIDLEHHDYRTYYG 251

Query: 249 IVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWLQRDLGLYIV 308
           I CLMQ+STR+ D+L+DT+ALRDDL +LNEVF +P I KV HGAFMDIIWLQRDLGLYIV
Sbjct: 252 ITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQRDLGLYIV 311

Query: 309 SLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSAYARADTHFL 368
           SLFDTYHASR LG P+HSLAYLLE +A FKTSKKYQL+DWRVRPL KA+ AYARADTHFL
Sbjct: 312 SLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYARADTHFL 371

Query: 369 LNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVDRADGWKVLM 428
           LNIYD +RN LI +NKL+ VL +SRNVAKR F+++ +RPK+  S V+SP++R D W+ LM
Sbjct: 372 LNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIEREDPWRTLM 431

Query: 429 NQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDPTGVISVSPT 488
            QYNIP  K +LV+ LYEWRD +ARRDDESPRYV+PNQLL  L    P  P  +++ S  
Sbjct: 432 FQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPALIMATSTF 491

Query: 489 VTDHVRTNAKALANLIVKSLQ-------QIADAGSDIKVESVQHKDQHDLSQVLTVGQIE 541
           VT+H+R NAK+LA LI KSL+       Q+ ++ + ++  S       D+ +       E
Sbjct: 492 VTEHIRQNAKSLALLIKKSLESSSNEFGQLLNSANTVQNSSPTKMSSEDIEK--NSRMFE 549

Query: 542 SQVSQFHDLSKAFKGLSQGTXXXXXXXXIIFGNILHAPC-GFVGYGRSLKKPVTDKQIEK 600
             +  F     A  G+S G+         +F      PC  +V Y  S    V    +E 
Sbjct: 550 KFLEDFSYEKAADCGISLGSS--------LFQKKF-VPCEEYVSYQESRASLVDHNSLEN 600

Query: 601 RKLELSEALE 610
           R+ ++S+  E
Sbjct: 601 RRHQVSKKYE 610

>KNAG0E00590 Chr5 (100162..101748) [1587 bp, 528 aa] {ON} Anc_5.87
           YHR159W
          Length = 528

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 48/102 (47%), Gaps = 9/102 (8%)

Query: 41  SLDKTSNELVSMINSTLLCIDQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILR 100
           + D+T+N L ++ N  L   D         K K+ED ++  +N  +  +++  + L +L+
Sbjct: 219 TTDQTNNLLKTLANKELELFD--------SKRKIEDLKRQLANC-EKTYQQQSKDLQLLK 269

Query: 101 GRAPDRKGAALMYLDDAARSDMIPAKRILKPQVRFQRPIDNT 142
            +   R       L+  +    I  +R L PQ + Q+P+ N+
Sbjct: 270 EKVSKRINTTNEQLEKLSSQSAITPERNLSPQPQKQKPMANS 311

>NCAS0J02300 Chr10 complement(443929..448563) [4635 bp, 1544 aa]
           {ON} Anc_4.373 YJR138W
          Length = 1544

 Score = 31.6 bits (70), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 64/137 (46%), Gaps = 13/137 (9%)

Query: 3   EESNEQLLPKVVGTVRXXXXXXXQDVDFYRSLDKGVAKSLD---------KTSNELVSMI 53
           EES EQL  K+V +         +D+D + ++    A S+D         K    L +  
Sbjct: 294 EESGEQLFQKMVNSFFPKIFKKWKDIDTHHNITIAFAISMDNSEVSFKQLKPGERLSNTT 353

Query: 54  NSTLLCIDQNSRLLEGGKEKLEDSRKDFSNLMDNLFE-KSDRSLDILRGR-APDRKGAAL 111
           +   + +D+ + +     E +E  RK+F +L  +L   K+++   I++GR AP  K   L
Sbjct: 354 DYYRIVVDEVNII--HWVEIMETLRKEFMHLTKDLLNVKTEKGYTIIKGRFAPVIKSNFL 411

Query: 112 MYLDDAARSDMIPAKRI 128
             ++ A+   + P +++
Sbjct: 412 ELINFASTVLINPFRQL 428

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,483,137
Number of extensions: 2781638
Number of successful extensions: 9094
Number of sequences better than 10.0: 29
Number of HSP's gapped: 9278
Number of HSP's successfully gapped: 29
Length of query: 741
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 624
Effective length of database: 40,065,477
Effective search space: 25000857648
Effective search space used: 25000857648
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)