Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07634g6.26ON38238217640.0
TDEL0G044306.26ON3473148251e-108
Kpol_1037.306.26ON3672657821e-101
Kwal_56.224436.26ON2802467196e-93
YOL001W (PHO80)6.26ON2932577199e-93
Skud_15.1616.26ON2932387102e-91
Suva_15.1746.26ON2952447093e-91
KLTH0C11110g6.26ON2802357059e-91
CAGL0E02541g6.26ON3422347003e-89
KNAG0I017506.26ON3242506942e-88
TPHA0J003806.26ON3562556962e-88
SAKL0E01408g6.26ON3072266913e-88
Smik_15.1696.26ON2912496867e-88
ACR001C6.26ON3462376864e-87
Ecym_30296.26ON3512296822e-86
KLLA0D01287g6.26ON3452336552e-82
TBLA0A071606.26ON2682346352e-80
NCAS0D021506.26ON3692595623e-68
NDAI0C026406.26ON4272104863e-56
YIL050W (PCL7)7.240ON2851832043e-17
Suva_9.1497.240ON2861691945e-16
Smik_9.1407.240ON2851571945e-16
Skud_9.1197.240ON2851631892e-15
KNAG0D016307.240ON4382031843e-14
NCAS0E032207.240ON3411931753e-13
SAKL0F08602g7.240ON4741531737e-13
KLTH0A04268g7.240ON5801181748e-13
Kwal_23.58077.240ON4651161721e-12
Ecym_43367.240ON3851161682e-12
NCAS0A134807.240ON4481921693e-12
KLLA0C08305g7.240ON4091741674e-12
NDAI0A025607.240ON5031901675e-12
TPHA0C010907.240ON3852201656e-12
ADL075W7.240ON2071071596e-12
KAFR0I018407.240ON3251151621e-11
CAGL0M12342g7.240ON4571311632e-11
KAFR0L008807.240ON3131121531e-10
KNAG0L014707.240ON3541281452e-09
TDEL0H020207.240ON3631811391e-08
ZYRO0C08118g7.240ON4051921363e-08
TBLA0D040707.240ON661601321e-07
Kpol_2000.147.289ON3101091273e-07
Kpol_1033.137.240ON250601254e-07
Suva_5.1677.240ON424601248e-07
Smik_5.1897.240ON415601248e-07
Skud_5.1737.240ON420881231e-06
YER059W (PCL6)7.240ON420951231e-06
NDAI0E047707.240ON303571193e-06
ZYRO0C09284g7.289ON3111391174e-06
NCAS0D040706.236ON4731491177e-06
CAGL0J09328g7.289ON2971181158e-06
YDL127W (PCL2)7.289ON3081111113e-05
Suva_4.687.289ON3051281113e-05
TBLA0C048507.289ON3681271113e-05
NCAS0A137707.289ON3121061104e-05
TDEL0H015507.289ON3091331095e-05
Smik_4.1107.289ON3081111071e-04
TPHA0P008107.289ON2471361051e-04
Suva_4.1187.289ON3091091051e-04
TBLA0J006507.289ON3631331052e-04
YDL179W (PCL9)7.289ON3041291042e-04
Kwal_23.60067.289ON3041431042e-04
NDAI0A022707.289ON3301041023e-04
Suva_14.503.70ON279961014e-04
Kpol_1020.87.289ON2961231014e-04
SAKL0F09856g7.289ON335991007e-04
CAGL0E02233g3.70ON266105997e-04
Skud_4.1287.289ON308109990.001
Skud_4.797.289ON309153970.001
YPL219W (PCL8)6.236ON492140970.002
AFR159C7.289ON308109950.003
Smik_14.423.70ON279106940.003
KNAG0A014903.70ON262108940.003
YNL289W (PCL1)3.70ON27996930.005
Skud_14.483.70ON27996930.005
TPHA0A005803.70ON289114920.005
KNAG0B029307.289ON312132920.006
KLTH0A05346g7.289ON301109910.008
Ecym_80387.289ON314111910.009
Suva_16.876.236ON501177900.013
CAGL0J06336g7.289ON314133880.017
TBLA0A078903.70ON361127880.022
NDAI0C019805.347ON226107860.028
KLLA0E13223g3.70ON282120860.032
TPHA0A032507.289ON289121860.032
Skud_16.606.236ON500110870.035
ZYRO0C02068g3.70ON330116860.037
Smik_4.607.289ON305103840.056
Kpol_1020.163.70ON28296830.066
Smik_6.4246.236ON492110820.13
KLLA0F05654g7.289ON311123810.15
YHR071W (PCL5)5.347ON229158780.30
TDEL0E007903.70ON254108770.44
SAKL0C12100g3.70ON314106770.48
CAGL0E05918g6.236ON481166731.4
Skud_16.1478.642ON45061731.6
NCAS0A098703.70ON29487712.1
KAFR0A082803.70ON241112712.1
KAFR0C015603.70ON26794712.3
AEL195W3.70ON237108693.4
Skud_8.1295.347ON220111676.3
YDR103W (STE5)8.247ON917173686.3
NDAI0A060503.70ON28697676.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C07634g
         (382 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} simila...   684   0.0  
TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.2...   322   e-108
Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {O...   305   e-101
Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W...   281   6e-93
YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cycli...   281   9e-93
Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W...   278   2e-91
Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W...   277   3e-91
KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {O...   276   9e-91
CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} simila...   274   3e-89
KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26...   271   2e-88
TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON...   272   2e-88
SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar...   270   3e-88
Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W...   268   7e-88
ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON} S...   268   4e-87
Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to ...   267   2e-86
KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} simila...   256   2e-82
TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6....   249   2e-80
NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26     221   3e-68
NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {O...   191   3e-56
YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p ...    83   3e-17
Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W (...    79   5e-16
Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W (...    79   5e-16
Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W (...    77   2e-15
KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.2...    75   3e-14
NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {O...    72   3e-13
SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} simila...    71   7e-13
KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} simila...    72   8e-13
Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL05...    71   1e-12
Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}...    69   2e-12
NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa] ...    70   3e-12
KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {...    69   4e-12
NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.2...    69   5e-12
TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {O...    68   6e-12
ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic hom...    66   6e-12
KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.24...    67   1e-11
CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa...    67   2e-11
KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.2...    64   1e-10
KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7....    60   2e-09
TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {O...    58   1e-08
ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} simila...    57   3e-08
TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa] ...    55   1e-07
Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON} (24019.....    54   3e-07
Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON} (30454.....    53   4e-07
Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W ...    52   8e-07
Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W ...    52   8e-07
Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W ...    52   1e-06
YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p...    52   1e-06
NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7....    50   3e-06
ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {O...    50   4e-06
NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236     50   7e-06
CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} simila...    49   8e-06
YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,...    47   3e-05
Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W (R...    47   3e-05
TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa] ...    47   3e-05
NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {...    47   4e-05
TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.28...    47   5e-05
Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W (...    46   1e-04
TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {O...    45   1e-04
Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W (...    45   1e-04
TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {...    45   2e-04
YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,...    45   2e-04
Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {...    45   2e-04
NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289      44   3e-04
Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W (R...    44   4e-04
Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON} (18215..1...    44   4e-04
SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {...    43   7e-04
CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar...    43   7e-04
Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W (...    43   0.001
Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W (R...    42   0.001
YPL219W Chr16 (136750..138228) [1479 bp, 492 aa] {ON}  PCL8Cycli...    42   0.002
AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON} Sy...    41   0.003
Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W (R...    41   0.003
KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70 Y...    41   0.003
YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin, ...    40   0.005
Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W (R...    40   0.005
TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70...    40   0.005
KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.28...    40   0.006
KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {O...    40   0.008
Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON} si...    40   0.009
Suva_16.87 Chr16 (146154..147659) [1506 bp, 501 aa] {ON} YPL219W...    39   0.013
CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {...    39   0.017
TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3...    39   0.022
NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON...    38   0.028
KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} simil...    38   0.032
TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.28...    38   0.032
Skud_16.60 Chr16 (110205..111707) [1503 bp, 500 aa] {ON} YPL219W...    38   0.035
ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {O...    38   0.037
Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W (R...    37   0.056
Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON...    37   0.066
Smik_6.424 Chr6 complement(686097..687575) [1479 bp, 492 aa] {ON...    36   0.13 
KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly ...    36   0.15 
YHR071W Chr8 (237004..237693) [690 bp, 229 aa] {ON}  PCL5Cyclin,...    35   0.30 
TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70...    34   0.44 
SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa] ...    34   0.48 
CAGL0E05918g Chr5 complement(585960..587405) [1446 bp, 481 aa] {...    33   1.4  
Skud_16.147 Chr16 complement(271583..272935) [1353 bp, 450 aa] {...    33   1.6  
NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {...    32   2.1  
KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {...    32   2.1  
KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON...    32   2.3  
AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic hom...    31   3.4  
Skud_8.129 Chr8 (210309..210971) [663 bp, 220 aa] {ON} YHR071W (...    30   6.3  
YDR103W Chr4 (658350..661103) [2754 bp, 917 aa] {ON}  STE5Pherom...    31   6.3  
NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {...    30   6.7  

>ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 382

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/382 (88%), Positives = 339/382 (88%)

Query: 1   MYDNDRVAPSVFTAPXXXXXXXXXXXQGPPTTGIRIDNVNDVPTVILPKRFSECSRTDLV 60
           MYDNDRVAPSVFTAP           QGPPTTGIRIDNVNDVPTVILPKRFSECSRTDLV
Sbjct: 1   MYDNDRVAPSVFTAPNAVVNVGNNNVQGPPTTGIRIDNVNDVPTVILPKRFSECSRTDLV 60

Query: 61  ILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLM 120
           ILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLM
Sbjct: 61  ILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLM 120

Query: 121 AAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELN 180
           AAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELN
Sbjct: 121 AAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELN 180

Query: 181 VLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQDGDDWTPIXXXXXXXXXXXXXX 240
           VLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQDGDDWTPI              
Sbjct: 181 VLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQDGDDWTPILSNLSGNRNNSGYN 240

Query: 241 VLDTYYNKIVQLVGSLKSTQDKSKLVNYTFANTLKPTNIHNNEGLNLNPSPSGNNDKMTT 300
           VLDTYYNKIVQLVGSLKSTQDKSKLVNYTFANTLKPTNIHNNEGLNLNPSPSGNNDKMTT
Sbjct: 241 VLDTYYNKIVQLVGSLKSTQDKSKLVNYTFANTLKPTNIHNNEGLNLNPSPSGNNDKMTT 300

Query: 301 TCXXXXXXXXXXXXXXXXXXQIGLEQGTSSRKRNLDTDVYESGNESYGKDITGCENTLRN 360
           TC                  QIGLEQGTSSRKRNLDTDVYESGNESYGKDITGCENTLRN
Sbjct: 301 TCNNGIDNDNNDGSNSNSNSQIGLEQGTSSRKRNLDTDVYESGNESYGKDITGCENTLRN 360

Query: 361 GDRGTSGNLNKRHFNRQKKDSD 382
           GDRGTSGNLNKRHFNRQKKDSD
Sbjct: 361 GDRGTSGNLNKRHFNRQKKDSD 382

>TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.26
           YOL001W
          Length = 347

 Score =  322 bits (825), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 166/314 (52%), Positives = 213/314 (67%), Gaps = 24/314 (7%)

Query: 37  DNVNDVPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVP 96
           +  +++ T+ LP++FS+CSRTDL +LISRMLTFLIQ+NDS + S  ++   LT+FHS+VP
Sbjct: 25  EGTDEISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENARGLTRFHSRVP 84

Query: 97  PGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASK 156
           PGISVYNYL+RLTKYSSL+HCVL+ AVYYIDL+SSVYP FTL+SLTVHRFLLTATTVASK
Sbjct: 85  PGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTVASK 144

Query: 157 GLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVL- 215
           GLCDSFCTNTHYAKVGGVH SELN+LECE L+R+NYRI+PRDDNI WC LE++ + F L 
Sbjct: 145 GLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKFTLY 204

Query: 216 -DTQDGDDWTPIXXXXXXXXXXXXXXVLDTYYNKIVQLVGSLKSTQDKSKLVNYTFANTL 274
            + + G +  P               VLD Y+ KIVQLVGS  S+ DKSK+VNY     L
Sbjct: 205 EEPEMGQNSRP-----QNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVNY----VL 255

Query: 275 KPTNIHNNEGLNLNPSPSGNNDKM---TTTCXXXXXXXXXXXXXXXXXXQIGLEQGTSSR 331
           +P+          +P   G+ D       +                   +   ++  S+R
Sbjct: 256 RPS----------SPIKDGSRDSTHDHALSSQTSLESISTRTINSDSKPKSHEDEEPSAR 305

Query: 332 KRNLDTDVYESGNE 345
           KRNLD++ + +G +
Sbjct: 306 KRNLDSEAHPNGKD 319

>Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {ON}
           complement(72024..73127) [1104 nt, 368 aa]
          Length = 367

 Score =  305 bits (782), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 151/265 (56%), Positives = 191/265 (72%), Gaps = 13/265 (4%)

Query: 39  VNDVPTVILPKRFSECSRTDLVILISRMLTFLIQMNDS--SSTSALD------SVTNLTK 90
           + ++ T+ LP +F +CSR+DLV LI+RML+FLI+MND+  ++T+ L+      SV NLT+
Sbjct: 40  IENIETITLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTR 99

Query: 91  FHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTA 150
           FHS+VPP ISVYNYL+RLTKYSSL+HCVL++ VYYIDL+SSVYP F +NSLTVHRFLLTA
Sbjct: 100 FHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTA 159

Query: 151 TTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQH 210
           TT+ASKGLCDSFCTN+HY+KVGGVHCSELN+LE E LRR+NYRIIPRDDNI  C +E Q 
Sbjct: 160 TTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQ 219

Query: 211 RHFVLDTQDGDDWTPIXXXXXXXXXXXXXXVLDTYYNKIVQLVGSLKSTQDKSKLVNYTF 270
             F   T D  D + +              +LD YY+KIVQLVGS  ++ DKS+  NYT 
Sbjct: 220 NKF---TMDFSDLSMVGMTVQSNHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTL 276

Query: 271 ANTLKPTNIHNNEGLNLNPSPSGNN 295
              L   N+      N+  + +G N
Sbjct: 277 L--LSGNNMEKEVSNNIKENSNGQN 299

>Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W
           (PHO80) - The Pho80p Cyclin [contig 185] FULL
          Length = 280

 Score =  281 bits (719), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 142/246 (57%), Positives = 178/246 (72%), Gaps = 14/246 (5%)

Query: 28  GPPTTGIRIDNVNDVPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTN 87
            P + G R++    VP V LP+ FS+CSRTDLVILISRML+FL ++NDS      D    
Sbjct: 16  SPKSPGERLEEA-PVPEVALPEDFSQCSRTDLVILISRMLSFLTRINDSVPK---DDAKE 71

Query: 88  LTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFL 147
           LT+FHS+VPP ISVY+Y+MRLT+YSSL+  VL+A+VYYIDL+S++YP+F+LNSLTVHRFL
Sbjct: 72  LTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFL 131

Query: 148 LTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLE 207
           LTATTVASKGLCDSFCTN+HYAKVGGV CSEL+VLE E L+++NYRI+PRDDNI+ C  E
Sbjct: 132 LTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAE 191

Query: 208 SQHRHFVLDTQDGDDWTPIXXXXXXXXXXXXXXVLDTYYNKIVQLVGSLKSTQDKSKLVN 267
            +   FV  T       P               VLDTYY KI+++VGS  S+ DK+K  +
Sbjct: 192 KKAGLFVTPTYSKSCRGP----------NNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAH 241

Query: 268 YTFANT 273
           Y   N+
Sbjct: 242 YVMINS 247

>YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cyclin,
           interacts with cyclin-dependent kinase Pho85p; regulates
           the response to nutrient levels and environmental
           conditions, including the response to phosphate
           limitation and stress-dependent calcium signaling
          Length = 293

 Score =  281 bits (719), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 140/257 (54%), Positives = 184/257 (71%), Gaps = 19/257 (7%)

Query: 31  TTGIRIDNVND---VPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTN 87
           T+G R +N+++   +P VILP  F++CSRTDLV+LISRML  LI +N++S+T   D    
Sbjct: 4   TSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQIT 63

Query: 88  LTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFL 147
           LT++HSK+PP IS++NY +RLTK+SSL+HCVLM ++YYIDL+ +VYP FTLNSLT HRFL
Sbjct: 64  LTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFL 123

Query: 148 LTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLE 207
           LTATTVA+KGLCDSF TN HYAKVGGV C ELN+LE + L+R+NYRIIPRD NI  C++E
Sbjct: 124 LTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIE 183

Query: 208 SQHRHFVLD-----TQDGDDWTPIXXXXXXXXXXXXXXVLDTYYNKIVQLVGSLKSTQDK 262
            + + FV+D     + D D ++ +              VLD YY +IVQLVGS  ++ DK
Sbjct: 184 QKQKKFVIDKNALGSLDLDSYSYV------NRPKSGYNVLDKYYRRIVQLVGSFNASPDK 237

Query: 263 SKLVNYTFANTLKPTNI 279
           S+ V+Y       P NI
Sbjct: 238 SRKVDYVL-----PPNI 249

>Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W
           (REAL)
          Length = 293

 Score =  278 bits (710), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 135/238 (56%), Positives = 169/238 (71%), Gaps = 6/238 (2%)

Query: 42  VPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISV 101
           +P VILP  F +CSRTDLV+LISRML  LI +N++S+T   D    LT++HSKVPP IS+
Sbjct: 18  IPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDDQITLTRYHSKVPPNISI 77

Query: 102 YNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDS 161
           +NY +RLTK+SSL+HCVLM ++YYIDL+ + YP FTLNSLT HRFLLTATTVA+KGLCDS
Sbjct: 78  FNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLCDS 137

Query: 162 FCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQDGD 221
           F TN HYAKVGGV C ELN+LE + L+R+NYRIIPRD NI  C++E + + FV D     
Sbjct: 138 FSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVADKNAPG 197

Query: 222 DWTPIXXXXXXXXXXXXXXVLDTYYNKIVQLVGSLKSTQDKSKLVNYTFANTLKPTNI 279
            +  +              VLD YY +IVQLVGS  ++ DKSK V+Y       P+NI
Sbjct: 198 SFD-LDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKVDYVL-----PSNI 249

>Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W
           (REAL)
          Length = 295

 Score =  277 bits (709), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 133/244 (54%), Positives = 174/244 (71%), Gaps = 7/244 (2%)

Query: 42  VPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISV 101
           +P +ILP  F +CSRTDLV+LISRML  LI +N++SST   D    LT++HSK+PP IS+
Sbjct: 18  IPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQITLTRYHSKIPPNISI 77

Query: 102 YNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDS 161
           +NY +RLTK+SSL+HCVL+ ++YYIDL+ + YP FTLNSLT HRFLLTATTVA+KGLCDS
Sbjct: 78  FNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLCDS 137

Query: 162 FCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQDGD 221
           F TN HY+KVGGV C ELN+LE + L+R+NYRI+PRD NI  C++E + + FV+D ++  
Sbjct: 138 FSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQKTFVID-KNAL 196

Query: 222 DWTPIXXXXXXXXXXXXXXVLDTYYNKIVQLVGSLKSTQDKSKLVNYTFANTLKPTNI-H 280
               +              VLD YY +IVQLVGS  ++ DKS+ VNY       P+N   
Sbjct: 197 GSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRRVNYAL-----PSNFDE 251

Query: 281 NNEG 284
           +NEG
Sbjct: 252 DNEG 255

>KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {ON}
           similar to uniprot|P20052 Saccharomyces cerevisiae
           YOL001W PHO80 Cyclin negatively regulates phosphate
           metabolism Pho80p-Pho85p (cyclin-CDK complex)
           phosphorylates Pho4p and Swi5p deletion of PHO80 leads
           to aminoglycoside supersensitivity truncated form of
           PHO80 affects vacuole inheritance
          Length = 280

 Score =  276 bits (705), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 139/235 (59%), Positives = 170/235 (72%), Gaps = 13/235 (5%)

Query: 42  VPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISV 101
           VP V LP  FS+C RTDLVILISRML+FLI++NDS      D+ + LT+FHS+VPP ISV
Sbjct: 29  VPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSIPK---DNSSELTRFHSRVPPQISV 85

Query: 102 YNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDS 161
           Y+YLMRLT+YSSL+  VL+A+VYYIDL+S++Y  F+LNSLTVHRFLLTATTV SKGLCDS
Sbjct: 86  YDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTATTVGSKGLCDS 145

Query: 162 FCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQDGD 221
           FCTN+HYAKVGGV CSEL+VLE E L+R+NYRI+PRDDNI  C  E +   FV  T   +
Sbjct: 146 FCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERREGLFVTATYAKE 205

Query: 222 DWTPIXXXXXXXXXXXXXXVLDTYYNKIVQLVGSLKSTQDKSKLVNYTFANTLKP 276
           +  P               VLDTYY KI+++VGS  S+ DK+K  +Y       P
Sbjct: 206 NRGP----------NNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAHYVMKTPPAP 250

>CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001w PHO80
           cyclin
          Length = 342

 Score =  274 bits (700), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 167/234 (71%), Gaps = 1/234 (0%)

Query: 35  RIDNVNDVPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSK 94
           +I+   ++PT+ LP+ F +C + DLVILI+RML F+IQ+NDS+     +    LT+FHSK
Sbjct: 7   QINTDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKEN-ERKYGLTRFHSK 65

Query: 95  VPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVA 154
           + P ISV+NY  RLTKYS L+H VL++AVYYIDL+S+VYP F LNSLT HRFLLTATT+A
Sbjct: 66  IAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIA 125

Query: 155 SKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFV 214
           SKGLCDSFCTNTHY+KVGGV C+ELNVLE E LR++NYRIIPRD+NI +C +E Q   F+
Sbjct: 126 SKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFI 185

Query: 215 LDTQDGDDWTPIXXXXXXXXXXXXXXVLDTYYNKIVQLVGSLKSTQDKSKLVNY 268
           L      D  P               VL  YY KI+++VG   S+ DK+K VNY
Sbjct: 186 LPESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNY 239

>KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26
           YOL001W
          Length = 324

 Score =  271 bits (694), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 141/250 (56%), Positives = 168/250 (67%), Gaps = 21/250 (8%)

Query: 41  DVPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSS--------------TSALD--- 83
           ++ TV LP  FS CSR DL+ LISRML FLIQ+ND ++              T A D   
Sbjct: 20  EIQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDG 79

Query: 84  -SVTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLT 142
            S T LT+FHS VPP ISVYNYL+RLTKYS+L+  VL+ ++YYIDL+SSVYP FT+NSLT
Sbjct: 80  SSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLT 139

Query: 143 VHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIA 202
           VHRFLLTATTVASKGLCDSFCTN HYAKVGGV  SELN+LE E L++INYR++PRDDNI 
Sbjct: 140 VHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNIT 199

Query: 203 WCNLESQHRHFVLDTQDGDDWTPIXXXXXXXXXXXXXXVLDTYYNKIVQLVGSLKSTQDK 262
           WC  E +   F +  +     T +              VL  YY+KI+QLVG   S+ DK
Sbjct: 200 WCKYEHRAHEFTIYNKAA--LTNV-SKPTHTQRNSGYNVLQMYYHKIIQLVGKFSSSLDK 256

Query: 263 SKLVNYTFAN 272
           SK  NY F N
Sbjct: 257 SKKANYVFEN 266

>TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON}
           Anc_6.26 YOL001W
          Length = 356

 Score =  272 bits (696), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 177/255 (69%), Gaps = 20/255 (7%)

Query: 42  VPTVILPKRFSECSRTDLVILISRMLTFLIQMND-----SSSTSAL------------DS 84
           + T++LP  F +CSR+DLV+LISRMLTFLIQ+ND     + + SA+            ++
Sbjct: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVNNKNNNN 91

Query: 85  VTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVH 144
           + NLT+FHS+VPP ISV NYL+RLTKY+SL+H VL++++YYIDL+SSVYP F +NSLTVH
Sbjct: 92  MINLTRFHSRVPPNISVNNYLIRLTKYASLEHSVLLSSLYYIDLLSSVYPEFKINSLTVH 151

Query: 145 RFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWC 204
           RFLL ATTVASKGL DSFCTN+HYAKVGGV CSELN+LE + LRRINYRIIPRDDNI  C
Sbjct: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211

Query: 205 NLESQHRHFVLDTQDGDDWTPIXXXXXXXXXXXXXXVLDTYYNKIVQLVGSLKSTQDKSK 264
            LE +   F LD     D                  VL+ YY K+VQ+VG LK++ DKSK
Sbjct: 212 KLEKKSSQFTLDL---GDLLAANIQPELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSK 268

Query: 265 LVNYTFANTLKPTNI 279
            VNY        TNI
Sbjct: 269 KVNYIIQTNYNDTNI 283

>SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar to
           uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 307

 Score =  270 bits (691), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 161/226 (71%), Gaps = 13/226 (5%)

Query: 45  VILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISVYNY 104
           ++LP  F +CSRT LV+LISRML+ LIQMNDS      D    LT+FHS+VPPGISVYNY
Sbjct: 47  IMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMCK---DKNLKLTRFHSRVPPGISVYNY 103

Query: 105 LMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDSFCT 164
           L+RL KYSSL+  VL+AAVYYIDL+SSVYP+FTLNSLTVHRFLLTATTVASKGL DSFCT
Sbjct: 104 LIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDSFCT 163

Query: 165 NTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQDGDDWT 224
           N HYAKVGGV CSELNVLE E L+R+NYRIIPRDDNI  C  E Q   F+          
Sbjct: 164 NVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITFPLADKIKG 223

Query: 225 PIXXXXXXXXXXXXXXVLDTYYNKIVQLVGSLKSTQDKSKLVNYTF 270
           P               VLDTYY K++QLVG   S+ DK+  V+Y  
Sbjct: 224 P----------NNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVL 259

>Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W
           (REAL)
          Length = 291

 Score =  268 bits (686), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 174/249 (69%), Gaps = 8/249 (3%)

Query: 42  VPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISV 101
           +  VILP  F++CSRTDLV+LISRML  LI +N++S +   ++   LT++HSK+PP IS+
Sbjct: 18  IQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNISI 77

Query: 102 YNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDS 161
           +NY +RLTK+SSL+HCVLM ++YYIDL+ + YP FTLNSLT HRFLLTATT+A+KGLCDS
Sbjct: 78  FNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIATKGLCDS 137

Query: 162 FCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQDGD 221
           F TN HYAKVGGV C ELN+LE + L+R+NYRIIPRD NI  C++E + + FV+D     
Sbjct: 138 FSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVIDKNALG 197

Query: 222 DWTPIXXXXXXXXXXXXXXVLDTYYNKIVQLVGSLKSTQDKSKLVNYTFANTLKPTNI-- 279
            +  +              VLD YY +IVQLVGS  ++ DKSK ++Y       P+NI  
Sbjct: 198 SFD-LDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKIDYVL-----PSNIDK 251

Query: 280 HNNEGLNLN 288
            N  G  +N
Sbjct: 252 DNESGPQIN 260

>ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL001W
           (PHO80)
          Length = 346

 Score =  268 bits (686), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 169/237 (71%), Gaps = 10/237 (4%)

Query: 42  VPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISV 101
           V  + LP++F  CSRT LV+LISRMLT LI MND+    +      LT+FHS+VPP ISV
Sbjct: 13  VTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKS--KPIKLTRFHSRVPPAISV 70

Query: 102 YNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDS 161
           YNYL+RLTKYSSL+HCVL+A+VYYIDL+++VYP F L+SLTVHRFLLTATTVASKGLCDS
Sbjct: 71  YNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATTVASKGLCDS 130

Query: 162 FCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQDGD 221
           FCTNTHYAKVGGV CSELNVLE E L R+NYRI+PRDDNI  C+LE Q R F        
Sbjct: 131 FCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERIFSYSN---- 186

Query: 222 DWTPIXXXXXXXXXXXXXXVLDTYYNKIVQLVGSLKSTQDKSKLVNYTFANTLKPTN 278
              P+              VL+ YY++++ L+G    + DKS  +++T A +  PTN
Sbjct: 187 --IPMDKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAES--PTN 239

>Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR001C
          Length = 351

 Score =  267 bits (682), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 132/229 (57%), Positives = 168/229 (73%), Gaps = 9/229 (3%)

Query: 42  VPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISV 101
           VP   LP++F +CSRT LV+LISRML+ LI++ND+ + S   +   LT+FHS+VPP ISV
Sbjct: 20  VPEFRLPRKFLDCSRTHLVVLISRMLSSLIRLNDAYTES---NTLQLTRFHSRVPPSISV 76

Query: 102 YNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDS 161
           Y+YL+RLTKYSSL+HCVL+A+VYYIDL+SSV+P F L+SLTVHRFLLTATTVASKGLCDS
Sbjct: 77  YDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLCDS 136

Query: 162 FCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQDGD 221
           FCTNTHYAKVGGV C+ELNVLE E L R+NYRI+PRD+NI  C+ E Q   F        
Sbjct: 137 FCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFSFAN---- 192

Query: 222 DWTPIXXXXXXXXXXXXXXVLDTYYNKIVQLVGSLKSTQDKSKLVNYTF 270
              P               VL+ YY++++ L+G+L ++ DKS  +N+T 
Sbjct: 193 --IPADAEQDQKSEENRFDVLENYYHRMIHLIGNLDASPDKSYDLNFTL 239

>KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 345

 Score =  256 bits (655), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 128/233 (54%), Positives = 165/233 (70%), Gaps = 13/233 (5%)

Query: 45  VILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISVYNY 104
           + LP+ +  CSRT LV++ISRML+FLIQ+ND+++  A +    LT+FHSK  P I+VY Y
Sbjct: 19  IPLPEEYLRCSRTHLVVIISRMLSFLIQINDANN--AGNQTMELTRFHSKAAPSITVYQY 76

Query: 105 LMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDSFCT 164
           L+RLTKYSSL+H VL++AVYYIDL+S+VYP FTLNSLTVHRFLLTATT+ASKGLCDSFCT
Sbjct: 77  LIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGLCDSFCT 136

Query: 165 NTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQ-HRHFVLDTQDGDDW 223
           NTHY+KVGGV CSELN+LE E L R+ YRIIPRDDNI  C +E +   + ++  ++    
Sbjct: 137 NTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSNMLIPMKNASQR 196

Query: 224 TPIXXXXXXXXXXXXXXVLDTYYNKIVQLVGSLKSTQDKSKLVNYTFANTLKP 276
            P               VL  YY KIVQLVG+  ++ DK+    +   + + P
Sbjct: 197 GP----------DNGFNVLQNYYRKIVQLVGNPLNSPDKTSTYFFKMVDPMNP 239

>TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6.26
           YOL001W
          Length = 268

 Score =  249 bits (635), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 128/234 (54%), Positives = 169/234 (72%), Gaps = 17/234 (7%)

Query: 45  VILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTN-------LTKFHSKVPP 97
           V+L + F +CS+ DL+ LISRML+F I +NDS +     +VTN       LT+FHSKVPP
Sbjct: 12  VVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHG--NVTNNRLSPLFLTRFHSKVPP 69

Query: 98  GISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKG 157
            IS+++YL+RLTKYSSL+  VL+ +VYYIDL+S+VYP F+LNSLTVHR+LLTATT+ASKG
Sbjct: 70  NISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIASKG 129

Query: 158 LCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDT 217
           LCDSFCTN+HYAKVGG+ C+ELNVLE E L R+ YR+IPRD+ I  C LE  +++  ++ 
Sbjct: 130 LCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLE--YKYSPIED 187

Query: 218 QDGDDWTPIXXXXXXXXXXXXXXVLDTYYNKIVQLVGSLKSTQDKSKLVNYTFA 271
            + D   P               VL TYYNK+VQLVG+ KS+++  + VNY F+
Sbjct: 188 INNDIHIP------DELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIFS 235

>NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26
          Length = 369

 Score =  221 bits (562), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 124/259 (47%), Positives = 161/259 (62%), Gaps = 14/259 (5%)

Query: 27  QGPPTTGIRIDNVNDVPTVILPKRFSECSRTDLVILISRMLTFLIQMND---SSSTSALD 83
           + P T+ I++  V        P  + +CSR+DLV+L+SRML  LIQ ND   ++S S+ D
Sbjct: 19  ESPMTSKIQVIEV--------PYEYIKCSRSDLVVLVSRMLVLLIQSNDMTSNTSNSSSD 70

Query: 84  SVTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTV 143
           S  +LT+FHS++PP IS++NYL RLTKY  ++HCVL++ +YYIDL ++ YPTFT NSLT 
Sbjct: 71  SNMHLTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTA 130

Query: 144 HRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAW 203
           HRFLLTA TVA KGLCDSFCT   YAK+GGV   ELN+LE   LR +NYRIIPR  N+  
Sbjct: 131 HRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTL 190

Query: 204 CNLESQHRHFVLDTQDGDDWTPIXXXXXXXXXXXXXXVLDTYYNKIVQLVGSLKSTQDKS 263
             LE  ++ F LD  D  D   +              VL+ YY  IV++ G+  S+    
Sbjct: 191 IKLERGNQVFTLDHLDMKD-PKLSFLSYDYLPDNGYSVLNIYYQNIVRITGA--SSDLLF 247

Query: 264 KLVNYTFANTLKPTNIHNN 282
           K V YTF N    T   NN
Sbjct: 248 KRVIYTFPNNSALTQKLNN 266

>NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {ON}
           Anc_6.26 YOL001W
          Length = 427

 Score =  191 bits (486), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 131/210 (62%), Gaps = 2/210 (0%)

Query: 45  VILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISVYNY 104
           + LP +F EC R DLV+LISRML  LI++ND+ +          T+FHS+V PGIS+ NY
Sbjct: 57  ITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSNYATRFHSRVIPGISIGNY 116

Query: 105 LMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDSFCT 164
           L+RLTK+  L   VL+ AVYYIDL+S+V+P+F+ NSLT HRF+LTA  VASK LCDS  +
Sbjct: 117 LLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCDSCLS 176

Query: 165 NTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQDGDDWT 224
            THYAK GGV  +EL +LE   L+ I YR++PRD N   C++E     F L+  DG    
Sbjct: 177 ITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALN--DGQIKE 234

Query: 225 PIXXXXXXXXXXXXXXVLDTYYNKIVQLVG 254
                           VL  YY +I+ ++G
Sbjct: 235 SGTSFSYRQLPHSGYNVLHMYYRRIIDIIG 264

>YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p
           cyclin of the Pho80p subfamily, forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p; involved in glycogen
           metabolism, expression is cell-cycle regulated
          Length = 285

 Score = 83.2 bits (204), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/183 (28%), Positives = 90/183 (49%), Gaps = 31/183 (16%)

Query: 32  TGIRIDNVNDVPTVILPKRFSECSRTDLVILISRMLTFLIQMNDS--------SSTSALD 83
           T ++I N+ D PT             +L+++IS +L  +I  ND         S  +  +
Sbjct: 95  TDVKILNIADFPT------------DELILMISALLNRIITANDETTDVSQQVSDETEDE 142

Query: 84  SVTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVY---------- 133
            +T +  F+ K  P I+V  YL R+ KY    + + ++ + Y D +S  Y          
Sbjct: 143 LLTPILAFYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCA 202

Query: 134 -PTFTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINY 192
              F ++S  +HR L+T  T+ +K L D F +N+ YAKVGG+   ELN LE + L   ++
Sbjct: 203 KQLFVMDSGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDF 262

Query: 193 RII 195
           +++
Sbjct: 263 KLL 265

>Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W
           (REAL)
          Length = 286

 Score = 79.3 bits (194), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 89/169 (52%), Gaps = 20/169 (11%)

Query: 58  DLVILISRMLTFLIQMNDSSSTSALDSVTN--------LTKFHSKVPPGISVYNYLMRLT 109
           +L++++S +L  +++ ND ++  +   V +        +  F+ K  P I+V  YL R+ 
Sbjct: 110 ELILMVSALLNKIVKANDETTDPSQQVVEDGEDELLAPVLAFYGKNVPEIAVVQYLERIQ 169

Query: 110 KYSSLDHCVLMAAVYYIDLVSSVYPT-----------FTLNSLTVHRFLLTATTVASKGL 158
           KY    + + ++ + Y D +S  Y +           F ++S  +HR L+T  T+ +K +
Sbjct: 170 KYCPTTNDIFLSLLVYFDRISKNYGSSPDRNGHVRQIFVMDSGNIHRLLITGITICTKFM 229

Query: 159 CDSFCTNTHYAKVGGVHCSELNVLECELLRRINYR-IIPRDDNIAWCNL 206
            D F +N+ YAKVGG+   ELN LE + L   +++ ++ R++   + +L
Sbjct: 230 SDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLLVSREEMQKYADL 278

>Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 79.3 bits (194), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 82/157 (52%), Gaps = 19/157 (12%)

Query: 58  DLVILISRMLTFLIQMNDSSST--------SALDSVTNLTKFHSKVPPGISVYNYLMRLT 109
           +L+I++S +L  +I +ND+++         +    +T +  F+ K  P I V  YL R+ 
Sbjct: 109 ELIIMVSALLNKIITVNDATTDISQQVPGDTEEKFLTPILAFYGKNVPEIDVVQYLERIQ 168

Query: 110 KYSSLDHCVLMAAVYYIDLVSSVY-----------PTFTLNSLTVHRFLLTATTVASKGL 158
           KY    + + ++ + Y D +S  Y             F ++S  +HR L+T  T+ +K L
Sbjct: 169 KYCPTTNDIFLSLLVYFDRISKNYGHSPEENGHSKQLFVMDSGNIHRLLITGITICTKFL 228

Query: 159 CDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRII 195
            D F +N+ YAKVGG+   ELN LE + L   +++++
Sbjct: 229 SDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 77.4 bits (189), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 83/163 (50%), Gaps = 19/163 (11%)

Query: 52  SECSRTDLVILISRMLTFLIQMNDS--------SSTSALDSVTNLTKFHSKVPPGISVYN 103
           ++ S  +L+ +IS +L  ++  ND         S  +  + +  +  F+ K  P ISV  
Sbjct: 103 ADFSTDELIQMISALLNRIVTANDEYAEISQQVSKDNQDELLAPILAFYGKSVPEISVVQ 162

Query: 104 YLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFT-----------LNSLTVHRFLLTATT 152
           YL R+ KY    + + ++ + Y D +S  Y  F+           ++S  +HR L+T  T
Sbjct: 163 YLERIQKYCPTTNDIFLSLLVYFDRISKKYGHFSDRNAHTKQMFGMDSGNIHRLLITGIT 222

Query: 153 VASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRII 195
           + +K L D F +N+ YAKVGG+   ELN LE + L   +++++
Sbjct: 223 ICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.240
           YIL050W
          Length = 438

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 94/203 (46%), Gaps = 41/203 (20%)

Query: 38  NVNDVPTVIL----PKRFSECSRTDLVIL-ISRMLTFLI--------QMNDSSSTSAL-- 82
           N ND P        PKR+   S   L I  I +MLT L+        ++N+    +    
Sbjct: 213 NTNDQPHAPQETNCPKRYESISIATLPIDDILQMLTALLDKIVSSNDELNNGGPPAGCED 272

Query: 83  -----DSVTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVS------- 130
                D++  +T F+ K  P I++  YL+R+ KY    + + ++ + + D +S       
Sbjct: 273 KQQDHDTINAITSFYGKHVPQITIEQYLLRIQKYCPTTNDIFLSLLVFFDRISKKFNIHQ 332

Query: 131 -------------SVYPTFTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCS 177
                        + + TF ++S  +HR L+   TV++K   D F +N  YA+VGG+   
Sbjct: 333 QKQQSNVSDSDEQAPHQTFVMDSYNIHRLLIAGVTVSTKFFSDFFYSNARYARVGGISLQ 392

Query: 178 ELNVLECELLRRINYR-IIPRDD 199
           E+N LE + L   +++ +IP D+
Sbjct: 393 EMNHLELQFLILCDFKLLIPIDE 415

>NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {ON}
           Anc_7.240
          Length = 341

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 85/193 (44%), Gaps = 42/193 (21%)

Query: 51  FSECSRTDLVILISRMLTFLIQMNDS----SSTSALDS-----------VTNLTKFHSKV 95
            ++ S   L+ +IS +L  LI+ ND     + TS  D            V ++  F  K 
Sbjct: 129 ITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRGKH 188

Query: 96  PPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVY---------------------- 133
            P I +  Y  R+ KY   ++ VL+A + Y D +S V                       
Sbjct: 189 IPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRNY 248

Query: 134 -----PTFTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLR 188
                  F L+S  +HR +++A TV++K   D F +N+ YAKVGG+   E+N LE + L 
Sbjct: 249 DCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFLL 308

Query: 189 RINYRIIPRDDNI 201
             N+ +I   + I
Sbjct: 309 ISNFDLIISSEEI 321

>SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 474

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 75/153 (49%), Gaps = 16/153 (10%)

Query: 59  LVILISRMLTFLIQMNDS------SSTSALDSVTNLTKFHSKVPPGISVYNYLMRLTKYS 112
           L+ +++ +L  +++ ND         ++  D  + +  F  K  P IS+  Y  R+ KY 
Sbjct: 299 LLNMLTSLLNKIVKSNDQLRNTNVQESAFNDYTSQVLSFRGKHVPAISLDQYFQRIQKYC 358

Query: 113 SLDHCVLMAAVYYIDLVSSV----------YPTFTLNSLTVHRFLLTATTVASKGLCDSF 162
              + V ++ + Y D ++               F ++S  +HR ++ A TV++K   D F
Sbjct: 359 PTTNDVFLSLLVYFDRIAKRCNINEEGEDGQQLFVMDSYNIHRLIIAAVTVSTKFFSDFF 418

Query: 163 CTNTHYAKVGGVHCSELNVLECELLRRINYRII 195
            +N+ YA+VGG+   ELN LE + L   ++ +I
Sbjct: 419 YSNSRYARVGGISLQELNRLELQFLILCDFELI 451

>KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 580

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 62/118 (52%), Gaps = 5/118 (4%)

Query: 83  DSVTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSV-----YPTFT 137
           D    +  F  K  P I+++ Y  R+ KY    + V ++ + Y D ++          F 
Sbjct: 427 DLAAEILSFRGKHVPAITLHQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHAKEQLFV 486

Query: 138 LNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRII 195
           ++S  +HR +++A TV++K   D F +N+ YA+VGG+   ELN LE + L   ++ +I
Sbjct: 487 MDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 544

>Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL050W
           (PCL7) - PHO85 cyclin [contig 11] FULL
          Length = 465

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 61/116 (52%), Gaps = 5/116 (4%)

Query: 85  VTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSV-----YPTFTLN 139
            + +  F  K  P I++  Y  R+ KY    + V ++ + Y D ++          F ++
Sbjct: 318 ASEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMD 377

Query: 140 SLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRII 195
           S  +HR +++A TV++K   D F +N+ YA+VGG+   ELN LE + L   ++ +I
Sbjct: 378 SYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 433

>Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}
           similar to Ashbya gossypii ADL075W
          Length = 385

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 65/116 (56%), Gaps = 5/116 (4%)

Query: 85  VTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVS----SVYPT-FTLN 139
           V ++  F  K  P I++ +Y  R+ KY  + + V ++ + Y D ++    ++ P  F ++
Sbjct: 228 VAHVLSFRGKHIPAITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNAMDPQLFVMD 287

Query: 140 SLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRII 195
           S  +HR ++ A TV++K   D F +N+ YA+VGG+   ELN LE +     ++ +I
Sbjct: 288 SYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLHELNRLELQFSILCDFELI 343

>NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa]
           {ON} Anc_7.240
          Length = 448

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 91/192 (47%), Gaps = 33/192 (17%)

Query: 51  FSECSRTDLVILISRMLTFLIQMND-----SSSTSALDS------------VTNLTKFHS 93
            +E     L+ +++ +L  +++ ND     SS++ ++D             V ++  F  
Sbjct: 226 IAEFPTNKLLEMLTALLDKIVKSNDKLNVSSSNSESIDDILRSEDNSNNAYVGSILAFRG 285

Query: 94  KVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSV----------YPT-----FTL 138
           K  P IS++ Y  R+ KY    + V ++ + Y D +S             PT     F +
Sbjct: 286 KHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQLFVM 345

Query: 139 NSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRI-IPR 197
           +S  +HR ++   TV +K   D F +N+ YA+VGGV   ELN LE + L   ++ + IP 
Sbjct: 346 DSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELMIPT 405

Query: 198 DDNIAWCNLESQ 209
           ++   + +L S+
Sbjct: 406 EELQRYADLLSR 417

>KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {ON}
           similar to uniprot|P40186 Saccharomyces cerevisiae
           YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms
           a functional kinase complex with Pho85p which
           phosphorylates Mmr1p and is regulated by Pho81p involved
           in glycogen metabolism expression is cell-cycle
           regulated and weakly similar to YER059W uniprot|P40038
           Saccharomyces cerevisiae YER059W PCL6 Pho85p cyclin of
           the Pho80p subfamily forms the major Glc8p kinase
           together with Pcl7p and Pho85p involved in the control
           of glycogen storage by Pho85p stabilized by Elongin C
           binding
          Length = 409

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 85/174 (48%), Gaps = 37/174 (21%)

Query: 59  LVILISRMLTFLIQMNDS-SSTSALDS--------VTNLTKFHSKVPPGISVYNYLMRLT 109
           L+ +++ +LT +I+ NDS  ST   ++        +  +  F  K  PGI++  Y  R+ 
Sbjct: 199 LLDMLTGLLTKIIKSNDSLGSTPNFETSQGKNIPLMREILSFRGKQVPGITLKQYFQRIQ 258

Query: 110 KY---------SSLDH-------CVLMAAVYYIDLVSSVYPT------------FTLNSL 141
           KY         S L H       C  +A  Y + +VS+   T            F ++S 
Sbjct: 259 KYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDKTTASLAHQSSPQLFVMDSH 318

Query: 142 TVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRII 195
            +HR ++ A TV++K + D F +N+ YA+VGG+   ELN LE + L   ++R+I
Sbjct: 319 NIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILCDFRLI 372

>NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.240
           YER059W
          Length = 503

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 90/190 (47%), Gaps = 33/190 (17%)

Query: 39  VNDVPTVILPKRF--SECSRTDLVILISRMLTFLIQMNDSSSTSALDS------------ 84
           +N+V +  +P  F  +E S  +L+ +++ +L  +++ ND  +TS   +            
Sbjct: 281 INEVNSYHMPDSFNIAEFSTDNLLEMLTALLDKIVKSNDKLNTSQSPTSPPPLNSNSENN 340

Query: 85  -----VTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVS---SVYPT- 135
                  ++  F  K  P I+++ Y  R+ KY    + V ++ + Y D +S   +  PT 
Sbjct: 341 NKNAYYNSILAFKGKHVPQITLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSTPTT 400

Query: 136 ----------FTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECE 185
                     F ++S  +HR ++   TV +K   D F +N+ YA+VGG+   ELN LE +
Sbjct: 401 NSINDNNSQMFVMDSYNIHRLIIAGITVCTKFFSDFFYSNSRYARVGGISLQELNHLELQ 460

Query: 186 LLRRINYRII 195
            L   ++ ++
Sbjct: 461 FLILCDFELM 470

>TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {ON}
           Anc_7.240 YIL050W
          Length = 385

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 92/220 (41%), Gaps = 57/220 (25%)

Query: 28  GPPTTGIRIDNVNDVPTVIL------PKRFSECSRTDLVILISRMLTFLIQMNDSSSTSA 81
           GPP       N  D   V L      P+  +E     L+ ++S +L  ++  ND    + 
Sbjct: 134 GPPEK-----NTQDKKVVALADFAATPENIAEFQTDKLLDMLSTLLDKIVLSNDRLHINT 188

Query: 82  LDS----------VTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSS 131
           +D+          +  ++ F  K  P IS+  Y  R+ KY  + + V ++ + Y D +S 
Sbjct: 189 MDNTIDEHIDSTIIKPVSCFRGKHVPQISLEQYFQRIQKYCPITNDVFLSLLVYFDRISK 248

Query: 132 -----------------------------------VYP-TFTLNSLTVHRFLLTATTVAS 155
                                              V P  F ++S  +HR ++TA TV++
Sbjct: 249 KCNNINLEKENVISNDADESQNNVKQMKDENNSSIVKPQVFVMDSFNIHRLIITAVTVST 308

Query: 156 KGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRII 195
           K   D F +N+ YA+VGG+   ELN LE + L   +++++
Sbjct: 309 KFFSDLFYSNSRYARVGGISLQELNHLELQFLILCDFQLM 348

>ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL050W (PCL7) and
           YER059W (PCL6)
          Length = 207

 Score = 65.9 bits (159), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 61/107 (57%), Gaps = 5/107 (4%)

Query: 85  VTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVS----SVYPT-FTLN 139
           V ++  F  K  P I++ +Y  R+ KY  + + V ++ + Y D ++    ++ P  F ++
Sbjct: 59  VAHVLSFRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMD 118

Query: 140 SLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECEL 186
           S  +HR ++ A TV++K   D F +N+ YA+VGG+   ELN LE + 
Sbjct: 119 SYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQF 165

>KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.240
           YIL050W
          Length = 325

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 59/115 (51%), Gaps = 10/115 (8%)

Query: 91  FHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPT----------FTLNS 140
           FH K  P I++  Y  R+ KY    + V +  +   D ++    T          F ++S
Sbjct: 181 FHGKHVPDITIEKYFNRIQKYCPTTNDVFLLLLIAFDRIAKRCNTDSFGNKSQQLFVMDS 240

Query: 141 LTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRII 195
             +HRF++   TV +K L D F +N+ YAKVGG+   E+N LE + L   ++++I
Sbjct: 241 YNIHRFIIAGVTVCTKFLSDFFYSNSRYAKVGGISVHEMNNLELQFLVLCDFKLI 295

>CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|P40038 Saccharomyces
           cerevisiae YER059w PCL6 cyclin like protein interacting
           with PHO85P
          Length = 457

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 64/131 (48%), Gaps = 15/131 (11%)

Query: 91  FHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSS-----------VYPT---F 136
           F  K  P I++Y Y  R+ KY    + V ++ + Y D +S              P    F
Sbjct: 305 FKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQLF 364

Query: 137 TLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRIIP 196
            ++S  +HR ++   TV +K   D F +N+ YA+VGG+  SELN LE + L   ++ ++ 
Sbjct: 365 VMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELLI 424

Query: 197 RDDNIA-WCNL 206
             D +  + NL
Sbjct: 425 SVDKLQRYANL 435

>KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.240
           YIL050W
          Length = 313

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 57/112 (50%), Gaps = 12/112 (10%)

Query: 88  LTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLV----SSVY--------PT 135
           +  F  K  P I++  Y  R+ KY    + V ++ + Y D +    +S +          
Sbjct: 172 MLSFKGKHIPQINLEQYFKRIQKYCPTTNDVFLSLLIYFDRIFNKCNSKFDNYGHDNPQI 231

Query: 136 FTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELL 187
           F ++S  +HR ++   TV++K L D F +N+ YAKVGG+   ELN LE + L
Sbjct: 232 FVMDSYNIHRLIIAGVTVSTKFLSDFFYSNSRYAKVGGISLKELNYLELQFL 283

>KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7.240
           YIL050W
          Length = 354

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 59/128 (46%), Gaps = 16/128 (12%)

Query: 84  SVTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPT-------- 135
           +V  +  F  K  P I++  Y  R+ KY    + V ++ + Y D +S    +        
Sbjct: 204 AVNAILSFKGKHIPQITLEQYFHRIQKYCPTTNDVFLSLLIYFDRISEKCNSIPRGGDDD 263

Query: 136 --------FTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELL 187
                   F +NS  +HR ++    V++K   D F +N  YAKVGG+   E+N LE + L
Sbjct: 264 KVQDDTLLFVMNSYNIHRLIIAGVAVSTKFSSDFFYSNARYAKVGGISLREMNYLELQFL 323

Query: 188 RRINYRII 195
              ++ ++
Sbjct: 324 VLCDFSLL 331

>TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {ON}
           Anc_7.240 YIL050W
          Length = 363

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 78/181 (43%), Gaps = 44/181 (24%)

Query: 59  LVILISRMLTFLIQMND--SSSTSALDS-----------VTNLTKFHSKVPPGISVYNYL 105
           L+ +++ +L  +I+ ND  +SS   L+            + ++  F  K  P IS+ +Y 
Sbjct: 151 LLEMLTALLDKIIKSNDRLASSNPTLNQERELMNNNNVYLNSVLSFRGKHIPQISLEHYF 210

Query: 106 MRLTKYSSLDHCVLMAAVYYIDLVSS-------------------------------VYP 134
            R+ KY    + V ++ + Y D +S                                   
Sbjct: 211 QRIQKYCPTTNDVFLSLLVYFDRISKRCNSNNNDTTNDNDLQYDMPAKQQQQTQQTQQQQ 270

Query: 135 TFTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRI 194
            F ++S  +HR L+   TV++K   D F +N+ YA+VGG+   ELN LE + L   ++ +
Sbjct: 271 AFVMDSHNIHRLLIAGVTVSTKFFSDFFYSNSRYARVGGISLQELNHLELQFLVLCDFEL 330

Query: 195 I 195
           +
Sbjct: 331 L 331

>ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 405

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 77/192 (40%), Gaps = 55/192 (28%)

Query: 59  LVILISRMLTFLIQMNDS--------SSTSALDSVTN------LTKFHSKVPPGISVYNY 104
           L+ +++ +L  +++ ND               D +TN      +  F  K  P IS+ +Y
Sbjct: 188 LLEMLTALLDKIVKSNDKLIDTSFYHQQQEEHDGITNDSCLRSVLSFRGKHIPQISLEHY 247

Query: 105 LMRLTKYSSLDHCVLMAAVYYIDLVS---------------------------------- 130
             R+ KY    + V ++ + Y D +S                                  
Sbjct: 248 FQRIQKYCPTSNDVFLSLLVYFDRISRKCNSSSRLHHENTSANDAGNNNNGHDNVKQQVH 307

Query: 131 -------SVYPTFTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLE 183
                  +    F ++S  +HR ++  TTV++K   D F +N+ YA+VGG+   ELN LE
Sbjct: 308 NNQQPIPAPQQQFVMDSHNIHRLIIAGTTVSTKFFSDFFYSNSRYARVGGISLQELNYLE 367

Query: 184 CELLRRINYRII 195
            + L   ++ ++
Sbjct: 368 LQFLILCDFELL 379

>TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa]
           {ON} Anc_7.240 YIL050W
          Length = 661

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 37/60 (61%)

Query: 136 FTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRII 195
           F ++S  +HR ++   TVA+K   D F +N  YAKVGG+   ELN LE + L   +++++
Sbjct: 578 FVMDSYNIHRLIIAGVTVATKFFSDYFYSNARYAKVGGITLQELNHLELQFLLLCDFKLL 637

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 57/123 (46%), Gaps = 24/123 (19%)

Query: 29  PPTTGIRIDNVNDVPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTN- 87
           P  +  R+D+ +  P+ +     +E   T L+ +++ +L  +I+ ND  +    D++TN 
Sbjct: 364 PHHSPTRLDSYSVPPSSL---NIAEFPTTKLLEMLTALLNKIIKSNDCLAGIQPDALTNV 420

Query: 88  ------LTKFHSKVP--------------PGISVYNYLMRLTKYSSLDHCVLMAAVYYID 127
                 LT  + +VP              P I+++ Y  R+ KY  + + V ++ + Y D
Sbjct: 421 NTPPQNLTTNNGEVPNYLSSILSFRGKHIPQITLFQYFQRIQKYCPISNDVFLSLLVYFD 480

Query: 128 LVS 130
            +S
Sbjct: 481 RIS 483

>Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON}
           (24019..24951) [933 nt, 311 aa]
          Length = 310

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 60/109 (55%), Gaps = 5/109 (4%)

Query: 100 SVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPT--FTLNSLTVHRFLLTATTVASKG 157
           S++ ++  L K+S++    LMA+  Y+  + S+ P   + + S T HR  L    +A+K 
Sbjct: 44  SIFEFIKGLIKHSNVQTSTLMASTVYLTKLRSILPANVYGIES-TKHRIFLGCLILAAKS 102

Query: 158 LCDSFCTNTHYAKV--GGVHCSELNVLECELLRRINYRIIPRDDNIAWC 204
           L DS   N H+ K   G ++ +++N +E ELL  +N+  I + +++  C
Sbjct: 103 LNDSSPLNKHWTKYTNGLLNLADVNTIERELLAYLNWDTIIKQEDLIGC 151

>Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON}
           (30454..31206) [753 nt, 251 aa]
          Length = 250

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 37/60 (61%)

Query: 136 FTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRII 195
           F ++S  +HR ++   TV++K   D F +N+ YA+VGG+   ELN LE + L   ++ ++
Sbjct: 163 FVMDSYNIHRLIIAGVTVSTKFFSDLFYSNSRYARVGGISLQELNNLELQFLLMCDFHLL 222

>Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W
           (REAL)
          Length = 424

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 38/60 (63%)

Query: 136 FTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRII 195
           F ++S  +HR ++   TV++K L D F +N+ Y++VGG+   ELN LE + L   ++ ++
Sbjct: 334 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 393

>Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W
           (REAL)
          Length = 415

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 38/60 (63%)

Query: 136 FTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRII 195
           F ++S  +HR ++   TV++K L D F +N+ Y++VGG+   ELN LE + L   ++ ++
Sbjct: 325 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 384

>Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W
           (REAL)
          Length = 420

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 47/88 (53%), Gaps = 9/88 (10%)

Query: 136 FTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRII 195
           F ++S  +HR ++   TV++K L D F +N+ Y++VGG+   ELN LE + L   ++ ++
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

Query: 196 PRDDNIA---------WCNLESQHRHFV 214
              + +          W N ++Q +  V
Sbjct: 390 ISVNELQRYADLLYRFWNNAKAQSQALV 417

>YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p
           cyclin of the Pho80p subfamily; forms the major Glc8p
           kinase together with Pcl7p and Pho85p; involved in the
           control of glycogen storage by Pho85p; stabilized by
           Elongin C binding
          Length = 420

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 50/95 (52%), Gaps = 10/95 (10%)

Query: 130 SSVYPT-FTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLR 188
           S  +P  F ++S  +HR ++   TV++K L D F +N+ Y++VGG+   ELN LE + L 
Sbjct: 323 SRAHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLV 382

Query: 189 RINYRIIPRDDNIA---------WCNLESQHRHFV 214
             ++ ++   + +          W N ++Q +  V
Sbjct: 383 LCDFELLISVNELQRYADLLYRFWNNAKAQSQALV 417

>NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7.240
           YER059W
          Length = 303

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 34/57 (59%)

Query: 138 LNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRI 194
           +NS TVHR +L   TV+SK L D   +N  YA+  G+   ELN LE + LR  N+ +
Sbjct: 227 VNSCTVHRLILAGITVSSKFLSDFTYSNKRYAQASGLTLEELNYLEFQFLRLTNFNL 283

>ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {ON}
           some similarities with uniprot|P25693 Saccharomyces
           cerevisiae YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 8/139 (5%)

Query: 70  LIQMNDSSSTSALDSVTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLV 129
           ++Q   S+++S +    N     S  PP   +  ++  L  YS++    LMA   Y+  +
Sbjct: 19  MVQYLASTTSSIIKVKKNSNIVDSPAPP---LMRFIKTLISYSNVQTPTLMATTVYLTKL 75

Query: 130 SSVYPT--FTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVHCSELNVLECE 185
            S+ P   F + + T HR  L    +A+K L DS   N H+A    G +H  E+N +E E
Sbjct: 76  RSIIPANVFGIET-TRHRIFLGCLILAAKTLNDSSPLNKHWASYTDGLLHIREVNTIERE 134

Query: 186 LLRRINYRIIPRDDNIAWC 204
           LL   ++ +    + +  C
Sbjct: 135 LLEYFDWNVCITTEELVAC 153

>NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236
          Length = 473

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 65/149 (43%), Gaps = 10/149 (6%)

Query: 49  KRFSECSRTDLVILISRMLTFLIQMNDS--SSTSALDSVTNLTKFHSKVPPGISVYNYLM 106
           ++F E +  + +  +   +  ++QM++   S    LD +   + F  K PP +S  +++ 
Sbjct: 296 EKFQELNTDEAITNMRESIEEILQMSNRELSIDEPLDEMIAFSNFKMKSPPSLSYADFIQ 355

Query: 107 RLTKYSSLDHCVLMAAVYYIDLVSSVYPT--------FTLNSLTVHRFLLTATTVASKGL 158
           R+      D  V + A Y +  +  +           F      VHR ++    +A+K L
Sbjct: 356 RIQNKCEYDPHVYLIATYLLQTLLLIREEHSRKLKLRFKFEKSDVHRLIIATVRIATKLL 415

Query: 159 CDSFCTNTHYAKVGGVHCSELNVLECELL 187
            D   ++ ++ KV G+    L+ LE  LL
Sbjct: 416 EDHVHSHEYFCKVSGISKKLLSKLEVSLL 444

>CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} similar
           to uniprot|P25693 Saccharomyces cerevisiae YDL127w PCL2
           and similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9
          Length = 297

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 58/118 (49%), Gaps = 6/118 (5%)

Query: 83  DSVTNLTKFHSKVP---PGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLN 139
           +S+  + + HS +    P   +  ++ +L KYS++    LMA   ++  + S+ P     
Sbjct: 28  ESIIQVRETHSMIDVAIPAPKLELFIKKLVKYSNVQTPTLMATTVFLTKLRSIIPANVYG 87

Query: 140 -SLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVHCSELNVLECELLRRINYRI 194
              T HR  L    +++K L DS   N H+A+   G +H  E+N +E ELL   ++ +
Sbjct: 88  IETTRHRIFLGCLILSAKTLNDSSPLNKHWAQYTDGLLHLKEVNTIERELLEYFDWNL 145

>YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 308

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 54/111 (48%), Gaps = 3/111 (2%)

Query: 97  PGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLN-SLTVHRFLLTATTVAS 155
           P   +  ++ RL K+S++    LMA   Y+  + S+ P+       T HR  L    +A+
Sbjct: 45  PAPPLTKFINRLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIETTRHRIFLGCLILAA 104

Query: 156 KGLCDSFCTNTHYAKV--GGVHCSELNVLECELLRRINYRIIPRDDNIAWC 204
           K L DS   N H+A+   G +   E+N +E ELL   ++ +    D++  C
Sbjct: 105 KTLNDSSPLNKHWAEYTDGLLILREVNTIERELLEYFDWDVTISTDDLITC 155

>Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 60/128 (46%), Gaps = 5/128 (3%)

Query: 70  LIQMNDSSSTSALDSVTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLV 129
           +IQ   +S+ S +    N +  H   PP +S++  + ++   S++    LMA   Y++ +
Sbjct: 19  MIQFLATSTASIIQIRKNDSPVHGCPPPELSIF--IKKVVVQSNVQTPTLMATTVYLNKL 76

Query: 130 SSVYPTFTLN-SLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVHCSELNVLECEL 186
            S+ P        T HR  L    +A+K L DS   N H+     G +   E+N +E EL
Sbjct: 77  KSIIPKNVYGIETTRHRIFLGCLILAAKTLNDSSPWNKHWTTYTEGLLKVREVNTIEREL 136

Query: 187 LRRINYRI 194
           L   N+ +
Sbjct: 137 LEYFNWDV 144

>TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa]
           {ON} Anc_7.289 YDL179W
          Length = 368

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 61/127 (48%), Gaps = 7/127 (5%)

Query: 65  RMLTFLIQMNDSSSTSALDSVTNLT-KFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAV 123
            M+ FL     S+      S +NLT +  S +PP   +Y ++  L  +S++    LM  V
Sbjct: 19  EMIQFLSNCAASAIQIRPTSDSNLTNESISNIPP---LYTFIKNLVAHSNVQTPTLMTTV 75

Query: 124 YYIDLVSSVYPTFTLN-SLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVHCSELN 180
            Y+  + ++ P+       T HR  L    +A+K L DS   N H+AK   G +   E+N
Sbjct: 76  VYLKKLKAIIPSNVYGIETTRHRMFLGCLIIAAKTLNDSSPLNKHWAKYTNGLLQLREVN 135

Query: 181 VLECELL 187
            +E E+L
Sbjct: 136 TIEREIL 142

>NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {ON}
           Anc_7.289
          Length = 312

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 54/106 (50%), Gaps = 5/106 (4%)

Query: 103 NYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYP--TFTLNSLTVHRFLLTATTVASKGLCD 160
           N++  L K+S++    LMA   Y+  + S+ P   + + + T HR  L    +A+K L D
Sbjct: 52  NFIKALIKHSNVQTPTLMATTVYLSKLKSIIPCNVYGIET-TRHRIFLGCLILAAKTLND 110

Query: 161 SFCTNTHYAKV--GGVHCSELNVLECELLRRINYRIIPRDDNIAWC 204
           S   N H+A+   G +   E+N +E ELL   ++ +  +  ++  C
Sbjct: 111 SSPMNKHWAQYTDGLLQIREVNTIERELLEYFDWDVTIKTKDLIIC 156

>TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.289
           YDL179W
          Length = 309

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 63/133 (47%), Gaps = 5/133 (3%)

Query: 76  SSSTSALDSVTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYP- 134
           +SST+ +  V N         P  S+ N++  L  +S++    LMA   Y+  + S+ P 
Sbjct: 24  ASSTACIIQVKNSNNLVDVGLPAPSLTNFIKGLVLHSNVQTPTLMATAVYLAKLRSIIPG 83

Query: 135 -TFTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVHCSELNVLECELLRRIN 191
             + + + T HR  L    +A+K L DS   N H+A    G +H  E+N +E ELL   +
Sbjct: 84  NVYGIET-TRHRIFLGCLILAAKTLNDSSPLNKHWALYTDGLLHIHEVNTIERELLEYFD 142

Query: 192 YRIIPRDDNIAWC 204
           + +     ++  C
Sbjct: 143 WNVTVTTKDLITC 155

>Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 54/111 (48%), Gaps = 3/111 (2%)

Query: 97  PGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLN-SLTVHRFLLTATTVAS 155
           P   +  ++ RL K+S++    LMA   Y+  + S+ P+       T HR  L    +A+
Sbjct: 45  PAPPLTEFINRLIKHSNVQTPTLMATSVYLAKLRSLIPSKVYGIETTRHRIFLGCLILAA 104

Query: 156 KGLCDSFCTNTHYAKV--GGVHCSELNVLECELLRRINYRIIPRDDNIAWC 204
           K L DS   N H+A+   G +   E+N +E ELL   ++ +    +++  C
Sbjct: 105 KTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLEYFDWDVTISTEDLITC 155

>TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {ON}
           Anc_7.289 YDL179W
          Length = 247

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 69/136 (50%), Gaps = 13/136 (9%)

Query: 63  ISR-MLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMA 121
           +SR M+ FL+     SST A+  + N+ +  S   P ++  +++  + KYS +    LMA
Sbjct: 15  VSRDMVKFLV-----SSTEAI--IPNIQQSGSLAIPSLT--SFICDVVKYSKVKTPTLMA 65

Query: 122 AVYYIDLVSSVYPTFTLNSLTV-HRFLLTATTVASKGLCDSFCTNTHYAKV--GGVHCSE 178
           +  +++ +  + P +     T  HR  L    +ASK L DS   N H+ K   G +   E
Sbjct: 66  STVFLNRLRCIIPGYVEGIATATHRLFLGCLILASKTLNDSSPFNKHWEKYCRGLLSLME 125

Query: 179 LNVLECELLRRINYRI 194
           +N +E ELL  +++ +
Sbjct: 126 INTIERELLEYMSWNV 141

>Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W
           (REAL)
          Length = 309

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (49%), Gaps = 4/109 (3%)

Query: 97  PGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLN-SLTVHRFLLTATTVAS 155
           P   +  ++ RL K+S++    LMA   Y+  + S+ P+       T HR  L    +A+
Sbjct: 45  PAPPLVKFINRLIKHSNVQTPTLMATSVYLVKLRSIIPSNVYGIETTRHRIFLGCLILAA 104

Query: 156 KGLCDSFCTNTHYAKV--GGVHCSELNVLECELLRRINYRI-IPRDDNI 201
           K L DS   N H+A+   G +   E+N +E ELL   ++ + I  DD I
Sbjct: 105 KTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLGYFDWDVTISTDDLI 153

>TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {ON}
           Anc_7.289 YDL179W
          Length = 363

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 66/133 (49%), Gaps = 10/133 (7%)

Query: 65  RMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVY 124
            M+ FL+     S+T+++  + + T   S+  P ++++  + RL  +S++    LM+ + 
Sbjct: 18  EMIDFLV-----STTNSIIQIESETSSTSQQIPSLALF--IKRLIVHSNVQTPTLMSTLV 70

Query: 125 YIDLVSSVYPTFTLN-SLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVHCSELNV 181
           Y+  +  + P+  +    T HR  +    +A+K L DS   N H+ +   G     E+N 
Sbjct: 71  YLTKLREIIPSDVVGIETTRHRIFIGCLILAAKSLNDSSPLNRHWTQYTNGLFKIQEINT 130

Query: 182 LECELLRRINYRI 194
           +E ELL   N+ +
Sbjct: 131 IERELLEYFNWDV 143

>YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,
           forms a functional kinase complex with Pho85p
           cyclin-dependent kinase (Cdk), expressed in late M/early
           G1 phase, activated by Swi5p
          Length = 304

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 62/129 (48%), Gaps = 7/129 (5%)

Query: 70  LIQMNDSSSTSALDSVTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLV 129
           +IQ   +S+ S +    N        PP +S++  +  +   S++    LMA   Y++ +
Sbjct: 20  MIQFLATSTASIIKIRENNNPIQGCRPPDLSIF--IKNVVIQSNVQTPTLMATSVYLNKL 77

Query: 130 SSVYP--TFTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVHCSELNVLECE 185
            SV P   + +N+ T HR  L    +A+K L DS   N H+     G +   E+N +E E
Sbjct: 78  KSVIPKNVYGINT-TRHRIFLGCLILAAKTLNDSSPWNKHWTTYTEGLLRIREVNTIERE 136

Query: 186 LLRRINYRI 194
           LL  +N+ +
Sbjct: 137 LLEYLNWDV 145

>Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {ON}
           YDL127W (PCL2) - G1 cyclin [contig 12] FULL
          Length = 304

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 66/143 (46%), Gaps = 6/143 (4%)

Query: 65  RMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVY 124
           R+   +I+   +SS S +    + ++   KV   +S+ N++  L   S++    LM+   
Sbjct: 14  RVCMEMIEFLAASSRSVIQVRESDSERSRKV---VSLENFIKGLVVQSNVQTPTLMSTAV 70

Query: 125 YIDLVSSVYPTFTLN-SLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVHCSELNV 181
           Y+  + S+ P   L    T HR  L    +A+K L DS   N H+A    G +   E+N 
Sbjct: 71  YLAKLRSIIPANVLGIETTRHRMFLGCLIIAAKNLNDSSPMNKHWASYTNGLLDTREVNT 130

Query: 182 LECELLRRINYRIIPRDDNIAWC 204
           +E ELL   ++ +      +A C
Sbjct: 131 IERELLEYFDWNLQFSTQELAIC 153

>NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289
          Length = 330

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 49/104 (47%), Gaps = 6/104 (5%)

Query: 94  KVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLN-SLTVHRFLLTATT 152
           ++PP   + N++  L  +S++    LMA   Y+  +  + P        T HR  L    
Sbjct: 49  EIPP---LSNFIKNLVMHSNVQTPTLMATSVYLSKLRLIIPKNVYGMETTRHRIFLGCLI 105

Query: 153 VASKGLCDSFCTNTHYAKV--GGVHCSELNVLECELLRRINYRI 194
           +A+K L DS   N H+ K   G +H  E+N +E ELL    + +
Sbjct: 106 LAAKTLNDSSPLNKHWTKYTDGLLHIREVNTIERELLEYFEWNV 149

>Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 52/96 (54%), Gaps = 3/96 (3%)

Query: 100 SVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPT-FTLNSLTVHRFLLTATTVASKGL 158
           S+  ++ RL +Y+++    L+ AV Y++ +  + P   T    T+HR  L    +++K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAVCYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 159 CDSFCTNTHYAKV--GGVHCSELNVLECELLRRINY 192
            DS   N H+AK   G     ++N++E +LL+ +N+
Sbjct: 114 NDSSPLNKHWAKYTDGLFTLEDINLMERQLLQLLNW 149

>Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON}
           (18215..19105) [891 nt, 297 aa]
          Length = 296

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 97  PGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYP--TFTLNSLTVHRFLLTATTVA 154
           P   +  ++  L   S++    LMA   Y+  + ++ P   + + S T HR  L    +A
Sbjct: 45  PPPPLVKFITNLCLKSNVQTPTLMATTVYLKKLKNIIPPNVYGIES-TRHRIFLGCLILA 103

Query: 155 SKGLCDSFCTNTHYAKV--GGVHCSELNVLECELLRRINYRI-IPRDDNIAWCNLESQHR 211
           SK L DS   N H+A+   G +   E+N +E ELL   ++ I I  DD      L S   
Sbjct: 104 SKTLNDSSPLNKHWARYTSGILQLREVNTIERELLEYFDWNIQITTDD------LVSSLE 157

Query: 212 HFV 214
           HF+
Sbjct: 158 HFI 160

>SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 335

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 51/99 (51%), Gaps = 3/99 (3%)

Query: 99  ISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLN-SLTVHRFLLTATTVASKG 157
           +S+ +++  L  +S++    LM+ V Y+  + S+ P        T HR  L    +A+K 
Sbjct: 42  VSLVDFIKGLITHSNVQTPTLMSTVVYLTRLRSIIPATVYGIETTRHRIFLGCLILAAKN 101

Query: 158 LCDSFCTNTHYAKV--GGVHCSELNVLECELLRRINYRI 194
           L DS   N H+++   G +   E+N +E ELL   ++++
Sbjct: 102 LNDSSPLNKHWSRYTNGLLDIREVNTIERELLEYFDWKL 140

>CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289w PCL1
           cyclin
          Length = 266

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 57/105 (54%), Gaps = 3/105 (2%)

Query: 100 SVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPT-FTLNSLTVHRFLLTATTVASKGL 158
           S+  ++ RL +Y+++    L+A V Y++ +  + P   T    T+HR  L    ++SK  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLATVCYLNKLKRILPKDATGLPSTIHRLFLACLILSSKCH 113

Query: 159 CDSFCTNTHYAKV--GGVHCSELNVLECELLRRINYRIIPRDDNI 201
            DS   N H+A+   G     ++N++E +LL+ +N+ I   +D++
Sbjct: 114 NDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDINVSEDDL 158

>Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 53/109 (48%), Gaps = 4/109 (3%)

Query: 97  PGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLN-SLTVHRFLLTATTVAS 155
           P   +  ++  L K+S++    LMA   Y+  + S+ P+       T HR  L    +A+
Sbjct: 45  PAPPLTKFINGLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIETTRHRIFLGCLILAA 104

Query: 156 KGLCDSFCTNTHYAKV--GGVHCSELNVLECELLRRINYRI-IPRDDNI 201
           K L DS   N H+A+   G +   E+N +E ELL   ++ + I  DD I
Sbjct: 105 KTLNDSSPLNKHWAEYTDGLLVLREVNTIERELLEYFDWDVTISTDDLI 153

>Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W
           (REAL)
          Length = 309

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 70/153 (45%), Gaps = 10/153 (6%)

Query: 70  LIQMNDSSSTSALDSVTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLV 129
           +IQ   +S+ S +    N  + H    P   ++ ++ ++   S++    LMA   Y++ +
Sbjct: 19  MIQFLATSTASIIQIRQNSNQTHGCQLP--ELFTFIKKVVIQSNVQTPTLMATTVYLNKL 76

Query: 130 SSVYPTFTLN-SLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVHCSELNVLECEL 186
            ++ PT       T HR  L    +A+K L DS   N H++    G +   E+N +E EL
Sbjct: 77  KNIIPTNVYGIETTRHRIFLGCLILAAKTLNDSSPWNKHWSTYTEGLLKVREVNTIEREL 136

Query: 187 LRRINYRIIPRDDNIAWCNLESQHRHFVLDTQD 219
           L   N+     D  I   +L +   HF++  ++
Sbjct: 137 LEYFNW-----DVKITSSDLINALAHFLVPIKE 164

>YPL219W Chr16 (136750..138228) [1479 bp, 492 aa] {ON}  PCL8Cyclin,
           interacts with Pho85p cyclin-dependent kinase (Cdk) to
           phosphorylate and regulate glycogen synthase, also
           activates Pho85p for Glc8p phosphorylation
          Length = 492

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 58/140 (41%), Gaps = 10/140 (7%)

Query: 63  ISRMLTFLIQMNDSSSTSALDSV--TNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLM 120
           I  +L    ++ND+++T A+ S        F  K PP +S  +++ R+         V +
Sbjct: 326 IELILQLSKKINDNANTLAISSEDPQKFVNFVMKNPPSLSFRDFIDRIQNKCMFGAVVYL 385

Query: 121 AAVYYIDLV--------SSVYPTFTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVG 172
            A Y + LV          +     L     HR +++   +A+K L D   +  +  KV 
Sbjct: 386 GATYLLQLVFLTRDEMDGPIKLKAKLQEDQAHRIIISTIRIATKLLEDFVHSQNYICKVF 445

Query: 173 GVHCSELNVLECELLRRINY 192
           G+    L  LE   +  +N+
Sbjct: 446 GISKRLLTKLEISFMASVNF 465

>AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL127W
           (PCL2) and YDL179W (PCL9)
          Length = 308

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 53/109 (48%), Gaps = 3/109 (2%)

Query: 99  ISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTV-HRFLLTATTVASKG 157
           +S+ +++  L K S++    LM+ V Y+  + S+ P       T  HR  L    +A+K 
Sbjct: 43  LSLVDFIKGLVKRSNVQTPTLMSTVVYLARLRSIIPANVYGIETSRHRMFLGCLILAAKN 102

Query: 158 LCDSFCTNTHYAKV--GGVHCSELNVLECELLRRINYRIIPRDDNIAWC 204
           L DS   N H+ +   G +   E+N +E ELL   N+ +   + ++  C
Sbjct: 103 LNDSSPMNKHWCRYTDGLLSLREVNTIERELLEYFNWNLRITNQDLISC 151

>Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 90  KFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPT-FTLNSLTVHRFLL 148
           K  +++P   S+  ++ RL +Y+++    L+ A  Y++ +  + P   T    T+HR  L
Sbjct: 47  KHMARLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPSTIHRIFL 103

Query: 149 TATTVASKGLCDSFCTNTHYAKV--GGVHCSELNVLECELLRRINY 192
               +++K   DS   N H+A+   G     ++N++E +LL+ +N+
Sbjct: 104 ACLILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70
           YNL289W
          Length = 262

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 55/108 (50%), Gaps = 5/108 (4%)

Query: 89  TKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFT--LNSLTVHRF 146
           T+   K P   S+  ++ +L +Y+++    L+  V Y++ +  + P     L S T+HR 
Sbjct: 48  TELSGKEPRLPSLRTFITKLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPS-TIHRL 106

Query: 147 LLTATTVASKGLCDSFCTNTHYAKV--GGVHCSELNVLECELLRRINY 192
            L    +++K   DS   N H+AK   G     ++N++E +LL  +N+
Sbjct: 107 FLACLILSAKYHNDSSPLNKHWAKYTDGLFSLEDINLMERQLLNLLNW 154

>YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 279

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 51/96 (53%), Gaps = 3/96 (3%)

Query: 100 SVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPT-FTLNSLTVHRFLLTATTVASKGL 158
           S+  ++ RL +Y+++    L+ A  Y++ +  + P   T    T+HR  L    +++K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPRDATGLPSTIHRIFLACLILSAKFH 113

Query: 159 CDSFCTNTHYAKV--GGVHCSELNVLECELLRRINY 192
            DS   N H+A+   G     ++N++E +LL+ +N+
Sbjct: 114 NDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 51/96 (53%), Gaps = 3/96 (3%)

Query: 100 SVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPT-FTLNSLTVHRFLLTATTVASKGL 158
           S+  ++ RL +Y+++    L+ A  Y++ +  + P   T    T+HR  L    +++K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 159 CDSFCTNTHYAKV--GGVHCSELNVLECELLRRINY 192
            DS   N H+A+   G     ++N++E +LL+ +N+
Sbjct: 114 NDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70
           YNL289W
          Length = 289

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 59/114 (51%), Gaps = 8/114 (7%)

Query: 92  HSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSL--TVHRFLLT 149
            SK+P   S+  ++ +L +Y+++    L+    Y+  +  + P    N L  T+HR  L 
Sbjct: 52  ESKLP---SLKTFITKLVRYTNVYTSTLLTTACYLKKLQRILPK-DANGLPSTIHRIFLA 107

Query: 150 ATTVASKGLCDSFCTNTHYAKV--GGVHCSELNVLECELLRRINYRIIPRDDNI 201
              +++K   DS   N H+A+   G     ++N++E +LL  +N+ I  +++++
Sbjct: 108 CLILSAKFHNDSSPLNKHWAEYTDGLFSLEDVNLMEVQLLALLNWDIRIKEEDL 161

>KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.289
           YDL179W
          Length = 312

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 61/132 (46%), Gaps = 8/132 (6%)

Query: 66  MLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAA-VY 124
           M+ +L ++ +S  T     V +     S  PP  ++  ++  L   S +    LMA+ VY
Sbjct: 19  MIKYLAKVTESIVTHLRPEVRS-----SDKPPIPTLVEFIAGLVTNSKVGTPTLMASTVY 73

Query: 125 YIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGG--VHCSELNVL 182
            + L   + P       T HR  L    +A+K L D+   N H++K     +   E+N++
Sbjct: 74  LVRLKDILPPNIIGIETTRHRLFLGCLIIAAKTLNDNSPLNKHWSKHTNNLLPNREINII 133

Query: 183 ECELLRRINYRI 194
           E ELL  + +R+
Sbjct: 134 ERELLSYLRWRV 145

>KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 301

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 51/109 (46%), Gaps = 3/109 (2%)

Query: 99  ISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLN-SLTVHRFLLTATTVASKG 157
           +S+ +++  L   S++    LM+   Y+  + S+ P        T HR  L    +A+K 
Sbjct: 43  VSLVDFIKGLVVQSNVQTPTLMSTAVYLSKLRSIIPANVHGMETTRHRVFLGCLIIAAKN 102

Query: 158 LCDSFCTNTHYAKV--GGVHCSELNVLECELLRRINYRIIPRDDNIAWC 204
           L DS   N H+A    G ++  E+N +E ELL   ++ +     ++  C
Sbjct: 103 LNDSSPMNKHWASYTNGLLNTREVNTIERELLEYFDWNLRISTQDLVTC 151

>Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON}
           similar to Ashbya gossypii AFR159C
          Length = 314

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 53/111 (47%), Gaps = 3/111 (2%)

Query: 97  PGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLN-SLTVHRFLLTATTVAS 155
           P +S+ +++  L   S++    LM+ V Y+  + S+ P        T HR  L    +AS
Sbjct: 41  PILSLVDFIKGLINKSNVQTPTLMSTVVYLTRLRSIIPPNVHGIETTRHRIFLGCLILAS 100

Query: 156 KGLCDSFCTNTHYAKVGG--VHCSELNVLECELLRRINYRIIPRDDNIAWC 204
           K L DS   N H+ +     +   E+N +E ELL   N+ ++  + ++  C
Sbjct: 101 KNLNDSSPMNKHWCQYTNSLLSLREVNTVERELLEYFNWDLLITNKDLITC 151

>Suva_16.87 Chr16 (146154..147659) [1506 bp, 501 aa] {ON} YPL219W
           (REAL)
          Length = 501

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 68/177 (38%), Gaps = 19/177 (10%)

Query: 50  RFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISVYNYLMRLT 109
           RF E    DL++ +S+     I  N +    + +       F  K PP +S  +++ R+ 
Sbjct: 330 RFRE--NIDLILQLSKK----IDENANILAISAEDPQKFVNFTMKNPPSLSFKDFIDRIQ 383

Query: 110 KYSSLDHCVLMAAVYYIDLV--------SSVYPTFTLNSLTVHRFLLTATTVASKGLCDS 161
                   V + A Y + LV          +     L     HR +++   +A+K L D 
Sbjct: 384 NKCMFGAIVYLGATYLLQLVFLTRDELDGPIKLKAKLQEDQTHRIIISTIRIATKLLEDF 443

Query: 162 FCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQ 218
             +  +  KV G+    L  LE   L  +N+     D  +  C    +  H + DT+
Sbjct: 444 VHSQNYICKVFGISKRLLTKLEISFLASVNF-----DGLMITCEKLEKTSHILDDTR 495

>CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9 or uniprot|P25693 Saccharomyces cerevisiae
           YDL127w
          Length = 314

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 62/133 (46%), Gaps = 13/133 (9%)

Query: 65  RMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVY 124
            MLTFLI        S  +S+  + K +S  P  +S++  +  L   S +    LMA   
Sbjct: 29  EMLTFLI--------SKTNSMIKIKKTNSPKPVELSLF--VEELVASSKVQASTLMATAV 78

Query: 125 YIDLVSSVYPTFTLN-SLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVHCSELNV 181
           Y+D +S + P+       T HR  L    ++SK L DS   N H+ K   G +   E+N 
Sbjct: 79  YLDRLSRIIPSNVCGIETTKHRMFLGCLILSSKSLDDSSLFNKHWTKYCNGLLTLKEVNS 138

Query: 182 LECELLRRINYRI 194
           +E ELL   N+ I
Sbjct: 139 IERELLSYFNWDI 151

>TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3.70
           YNL289W
          Length = 361

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 58/127 (45%), Gaps = 15/127 (11%)

Query: 95  VPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLN-SLTVHRFLLTATTV 153
           +P   S+  ++ R+ +Y+++    L+  V Y++ +  + P   +    T+HR  L    +
Sbjct: 55  IPKLPSLMTFITRIVRYTNVQVSTLLMTVCYLNKLKKLLPADAVGIPSTIHRLFLACLIL 114

Query: 154 ASKGLCDSFCTNTHYAKV--GGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHR 211
           ++K   DS   N H+A    G     ++N++E +LL  +++            NL+    
Sbjct: 115 SAKFHNDSSPLNVHWANYTNGLFSVKDVNLMERQLLSLLDW------------NLQLTEH 162

Query: 212 HFVLDTQ 218
             +LD Q
Sbjct: 163 EIILDLQ 169

>NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON}
           Anc_5.347 YHR071W
          Length = 226

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 5/107 (4%)

Query: 94  KVP-PGISVYNYLMRLTKYS-SLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVH---RFLL 148
           KVP    S+  YLM + K S S  + V++A+ Y+  L +SV      N   VH   R  L
Sbjct: 80  KVPNEKSSIKTYLMEILKRSQSSRNNVIVASFYFQKLYNSVQLNQDPNPEFVHCSKRIFL 139

Query: 149 TATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRII 195
           +   ++ K L D   +   ++ + G+   +L++LE   L R+NY ++
Sbjct: 140 SCLILSHKFLNDKTFSMKAWSLISGISKRDLSILERWCLMRLNYHLV 186

>KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} similar
           to uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 282

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 58/120 (48%), Gaps = 7/120 (5%)

Query: 90  KFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLN-SLTVHRFLL 148
           K H+ VP   S+  ++ RL +Y+++    L+  V Y++ +  + P+       T HR  L
Sbjct: 51  KNHNGVP---SLMTFISRLVRYTNVYTSTLLTTVVYLNRLRELLPSDAAGLPTTCHRIFL 107

Query: 149 TATTVASKGLCDSFCTNTHYAKV--GGVHCSELNVLECELLRRINYRIIPRDDNIAWCNL 206
               +++K   DS   N H+ K   G     ++N++E +LL+   + +    + + W NL
Sbjct: 108 ACLILSAKYHNDSSPLNKHWTKYTDGMFTLRDVNLMERQLLQLFEWDLRVESEEL-WDNL 166

>TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.289
           YDL179W
          Length = 289

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 59/121 (48%), Gaps = 12/121 (9%)

Query: 83  DSVTNLTKFHSKV-----PPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPT-- 135
           +S+ N+   +S V     PP ++   ++  +   S++    LMA    ++ +  + P+  
Sbjct: 28  ESIINIKNSNSMVSIALPPPPLA--KFIKNICVKSNVQTPTLMATTVLLEKLKKIIPSNV 85

Query: 136 FTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVHCSELNVLECELLRRINYR 193
           + + S T HR  L    +++K L DS   N H+AK     +H  E+N +E ELL   ++ 
Sbjct: 86  YGIES-TRHRIFLGCLILSAKSLNDSSPLNKHWAKYTESYIHLREVNTIERELLNYFDWN 144

Query: 194 I 194
           +
Sbjct: 145 V 145

>Skud_16.60 Chr16 (110205..111707) [1503 bp, 500 aa] {ON} YPL219W
           (REAL)
          Length = 500

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 44/110 (40%), Gaps = 8/110 (7%)

Query: 91  FHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLV--------SSVYPTFTLNSLT 142
           F  K PP +S  +++ R+         V + A Y + LV          V     L    
Sbjct: 364 FIMKNPPSLSFKDFIDRIQNKCMFGSVVYLGATYLLQLVFLTRDEMNGPVKLKAKLQEDQ 423

Query: 143 VHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINY 192
            HR +++A  + +K L D   +  +  KV G+    L  LE   +  +N+
Sbjct: 424 AHRVIISAIRITTKLLEDFVHSQNYICKVFGISKRLLTKLEISFMASVNF 473

>ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {ON}
           similar to uniprot|P24867 Saccharomyces cerevisiae
           YNL289W PCL1 Pho85 cyclin of the Pcl1 2-like subfamily
           involved in entry into the mitotic cell cycle and
           regulation of morphogenesis localizes to sites of
           polarized cell growth
          Length = 330

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 62/116 (53%), Gaps = 8/116 (6%)

Query: 90  KFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYP--TFTLNSLTVHRFL 147
           K  SK+P   S+ +++ RL +++++    L+    Y++ +  + P     L S T+HR  
Sbjct: 80  KQASKLP---SLMSFISRLVRHTNVYTSTLLVTACYLNRLKCILPKDASGLPS-TIHRMF 135

Query: 148 LTATTVASKGLCDSFCTNTHYAKV--GGVHCSELNVLECELLRRINYRIIPRDDNI 201
           L    +++K   DS   N H+AK   G     ++N++E +L++ +N+ +   +D++
Sbjct: 136 LACLILSAKFHNDSSPLNKHWAKYTDGLFSVEDVNLMERQLVQLLNWDLRVTNDDL 191

>Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 37.0 bits (84), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 50/103 (48%), Gaps = 7/103 (6%)

Query: 96  PPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYP--TFTLNSLTVHRFLLTATTV 153
           PP +S +  +  +   S++    LMA   Y++ + ++ P   + + + T HR  L    +
Sbjct: 47  PPDLSTF--IKNVVIQSNVQTPTLMATSVYLNKLRNIIPRNVYGIET-TRHRIFLGCLIL 103

Query: 154 ASKGLCDSFCTNTHYAKV--GGVHCSELNVLECELLRRINYRI 194
           A+K L DS   N H+     G +   E+N +E ELL   N+ +
Sbjct: 104 AAKTLNDSSPWNKHWTTYTEGLLRVREVNTIERELLEYFNWDV 146

>Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON}
           complement(33477..34325) [849 nt, 283 aa]
          Length = 282

 Score = 36.6 bits (83), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 48/96 (50%), Gaps = 3/96 (3%)

Query: 100 SVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPT-FTLNSLTVHRFLLTATTVASKGL 158
           S+  ++ +L +Y+++    L+    Y+  +  + P   T    T+HR  L    +++K  
Sbjct: 54  SLMTFITKLVRYTNVYTSTLLTTTCYLKKLQRILPKDATGLPSTIHRMFLACLIISAKYH 113

Query: 159 CDSFCTNTHYAKV--GGVHCSELNVLECELLRRINY 192
            DS   N H+A+   G     ++N++E +LL  +N+
Sbjct: 114 NDSSPLNKHWAEYTDGLFSLEDVNLMEMQLLALLNW 149

>Smik_6.424 Chr6 complement(686097..687575) [1479 bp, 492 aa] {ON}
           YPL219W (REAL)
          Length = 492

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 44/110 (40%), Gaps = 8/110 (7%)

Query: 91  FHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLV--------SSVYPTFTLNSLT 142
           F  K PP +S  +++ R+         V + A Y + LV          +     L    
Sbjct: 356 FVMKNPPSLSFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLTRDEMNGPIKLKTKLQEDQ 415

Query: 143 VHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINY 192
            HR +++   +A+K L D   +  +  KV G+    L  LE   +  +N+
Sbjct: 416 AHRIIISTIRIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFMACVNF 465

>KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 55/123 (44%), Gaps = 8/123 (6%)

Query: 99  ISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLN-SLTVHRFLLTATTVASKG 157
           +S+ +++  L ++S++    LMA   Y+  + S+ P        T HR  +    +A+K 
Sbjct: 44  VSLVDFIKSLIRHSNVQTPTLMATTVYLTKLRSILPHDVCGIETTRHRIFIGCLILAAKN 103

Query: 158 LCDSFCTNTHYAKV--GGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVL 215
           L DS   N H+     G     ++N +E ELL   ++ +     N +   L     HF++
Sbjct: 104 LNDSSPLNKHWTNYTDGLFTLEDVNTIERELLSLFSWNL-----NFSMQELVQALSHFLV 158

Query: 216 DTQ 218
             Q
Sbjct: 159 PIQ 161

>YHR071W Chr8 (237004..237693) [690 bp, 229 aa] {ON}  PCL5Cyclin,
           interacts with and phosphorylated by Pho85p
           cyclin-dependent kinase (Cdk), induced by Gcn4p at level
           of transcription, specifically required for Gcn4p
           degradation, may be sensor of cellular protein
           biosynthetic capacity
          Length = 229

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 75/158 (47%), Gaps = 29/158 (18%)

Query: 56  RTDLVILISRMLTFLIQMNDSSSTSALDSVT-NLTKFHSKVPPGISVYNYLMRLTKYSSL 114
           +T+L I+IS    FL +++   S   +++ T N+ KF           N +++ +K S  
Sbjct: 50  KTNLAIIIS---NFLSEISRPLSNGKINNSTHNILKF----------LNEVLKRSKCSK- 95

Query: 115 DHCVLMAAVYYIDLV--------SSVYPTFTLNSLTVHRFLLTATTVASKGLCDSFCTNT 166
           ++ VL  A +Y   +         S  P F+  S    R  L    ++ K L D+  +  
Sbjct: 96  ENAVL--ATFYFQKIHQSRGVRDESSLPEFSHCS---RRIFLCCLILSHKFLNDNTYSMK 150

Query: 167 HYAKVGGVHCSELNVLECELLRRINYRI-IPRDDNIAW 203
           ++  + G+H  +L+++E   L ++NY + IP D+ + W
Sbjct: 151 NWQIISGLHAKDLSLMERWCLGKLNYELAIPYDEFLLW 188

>TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70
           YNL289W
          Length = 254

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 54/108 (50%), Gaps = 12/108 (11%)

Query: 96  PPG-------ISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYP--TFTLNSLTVHRF 146
           PPG        S+ +++ RL +++++    L+    Y++ +  + P     L S TVHR 
Sbjct: 40  PPGSPKGNKLPSLMSFISRLVRHTNVYTSTLLTTACYLNKLKCILPKDASGLPS-TVHRI 98

Query: 147 LLTATTVASKGLCDSFCTNTHYAKVGG--VHCSELNVLECELLRRINY 192
            L    +++K   DS   N H+AK         ++N++E +L++ +N+
Sbjct: 99  FLACLILSAKFHNDSSPLNRHWAKYTDELFTLEDINLMERQLIQLLNW 146

>SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa]
           {ON} similar to gnl|GLV|CAGL0E02233g Candida glabrata
           CAGL0E02233g and some similarites with YNL289W
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 314

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 54/106 (50%), Gaps = 3/106 (2%)

Query: 100 SVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPT-FTLNSLTVHRFLLTATTVASKGL 158
           S+  ++ +L +Y+++    L+  V Y+  + ++ P   T    T HR  L    +++K  
Sbjct: 55  SLMTFITKLVRYTNVYTSTLLTTVCYLSKLKTILPRDATGLPSTTHRIFLACLILSAKFH 114

Query: 159 CDSFCTNTHYAKV--GGVHCSELNVLECELLRRINYRIIPRDDNIA 202
            DS   N H+++   G     ++N++E +LL+ +++ +    D +A
Sbjct: 115 NDSSPLNAHWSRYTDGLFSLEDVNLMERQLLQLLHWDLRINQDALA 160

>CAGL0E05918g Chr5 complement(585960..587405) [1446 bp, 481 aa] {ON}
           similar to uniprot|Q08966 Saccharomyces cerevisiae
           YPL219w PCL8
          Length = 481

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 36/166 (21%), Positives = 68/166 (40%), Gaps = 15/166 (9%)

Query: 37  DNVNDVPTVILPK-----RFSECSRTDLVILISRMLTFLIQM--NDSSSTSALDSVTNLT 89
           D V+D   V+L K        E S  D +   +  L  L+++  N++  +   D+  N  
Sbjct: 285 DIVHDNTCVLLSKYQHNNEIFEYSVEDTMHNYTETLDILLRLSENENMISEKADNNENYH 344

Query: 90  KFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLV--------SSVYPTFTLNSL 141
            F  K  P IS ++++ R+         + + A Y + ++          +     L   
Sbjct: 345 YFSMKSAPSISHHDFIQRIQNKCMFGSIIYLGATYLLQILFLTREYNDGPLRLKHKLQQN 404

Query: 142 TVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELL 187
            VHR ++    +A+K L D   ++ +  KV G+    +  LE  L+
Sbjct: 405 EVHRVIVGTIRIATKLLEDFVHSHQYICKVCGISKKLMTKLELALI 450

>Skud_16.147 Chr16 complement(271583..272935) [1353 bp, 450 aa] {ON}
           YPL133C (REAL)
          Length = 450

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 36/61 (59%), Gaps = 4/61 (6%)

Query: 322 IGLEQGTSSRKRNLDTDVYESGNESYGKDITGCENTLRNGDRGTSGNLNKR-HFNRQKKD 380
           + LE G+ S +  L+   Y++ N   G ++ G E+ + +   G+S N +KR H N+QK++
Sbjct: 165 VHLENGSQSTQSPLE---YQNDNRGDGSEVVGQEHNVTDAITGSSKNTSKRDHQNQQKEE 221

Query: 381 S 381
           S
Sbjct: 222 S 222

>NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {ON}
           Anc_3.70
          Length = 294

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 43/87 (49%), Gaps = 3/87 (3%)

Query: 100 SVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPT-FTLNSLTVHRFLLTATTVASKGL 158
           S+  ++ RL +Y+++    L+  V Y++ +  + P   T    T+HR  L    +++K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 159 CDSFCTNTHYAKV--GGVHCSELNVLE 183
            DS   N H+ K   G     ++N++E
Sbjct: 114 NDSSPLNKHWVKYTDGLFTLEDVNLME 140

>KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {ON}
           Anc_3.70 YNL289W
          Length = 241

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/112 (21%), Positives = 50/112 (44%), Gaps = 13/112 (11%)

Query: 96  PPGISVYN----------YLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLN-SLTVH 144
           PP   +Y+          ++ +L +Y+ +    L+  + Y++ +  + P        T+H
Sbjct: 41  PPSSPLYDEEDELPTLREFICKLVEYTHVYTPTLLMTISYLNRLRRILPKGAAGIPSTLH 100

Query: 145 RFLLTATTVASKGLCDSFCTNTHYAKV--GGVHCSELNVLECELLRRINYRI 194
           R  L    +++K   DS   N H+ K   G     ++N++E  LL  +N+ +
Sbjct: 101 RIFLACLIISAKNHNDSSPLNRHWTKYTDGLFTLEDVNLMERHLLDLLNWNL 152

>KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON}
           Anc_3.70 YNL289W
          Length = 267

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 46/94 (48%), Gaps = 5/94 (5%)

Query: 94  KVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFT--LNSLTVHRFLLTAT 151
           K P   S+  ++ RL +Y+++    L+  V Y++ +  + P     L S T+HR  L   
Sbjct: 53  KQPRLPSLRTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPS-TIHRLFLACL 111

Query: 152 TVASKGLCDSFCTNTHYAKV--GGVHCSELNVLE 183
            +++K   DS   N H+ +   G     ++N++E
Sbjct: 112 IISAKFHNDSSPLNKHWTRYTDGLFSLEDINLME 145

>AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL289W (PCL1)
          Length = 237

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 52/108 (48%), Gaps = 9/108 (8%)

Query: 100 SVYNYLMRLTKYSSLDHCVLMA-AVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGL 158
           S++ ++ RL +Y+++    L+  AVY   L   +    T    T HR  L    +++K  
Sbjct: 53  SIHMFITRLVRYTNVYTATLLTTAVYLERLRLLLPRDATGIPSTAHRIFLACLILSAKFH 112

Query: 159 CDSFCTNTHYAKV--GGVHCSELNVLECELLR------RINYRIIPRD 198
            DS   N H+ K   G     ++N++E +LLR      R+ +R + RD
Sbjct: 113 NDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNVRVGHRDLCRD 160

>Skud_8.129 Chr8 (210309..210971) [663 bp, 220 aa] {ON} YHR071W
           (REAL)
          Length = 220

 Score = 30.4 bits (67), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 48/111 (43%), Gaps = 11/111 (9%)

Query: 101 VYNYLMRLTKYSSLDHCVLMAAVYYIDLV-------SSVYPTFTLNSLTVHRFLLTATTV 153
           +  +L  + K S       + A +Y   +        S  P F+  S    R  L    +
Sbjct: 80  ILKFLNEVFKRSKCSKENAILATFYFQRIYRSRAQNESSLPEFSRCS---KRIFLCCLIL 136

Query: 154 ASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRI-IPRDDNIAW 203
           + K L D+  +  ++  + G+H  +L+++E   L ++NY + IP  D + W
Sbjct: 137 SHKFLNDNTYSMKNWQIISGLHAKDLSLMERWCLGKLNYELAIPCSDLLLW 187

>YDR103W Chr4 (658350..661103) [2754 bp, 917 aa] {ON}
           STE5Pheromone-response scaffold protein that controls
           the mating decision; binds Ste11p, Ste7p, and Fus3p
           kinases, forming a MAPK cascade complex that interacts
           with the plasma membrane and Ste4p-Ste18p; allosteric
           activator of Fus3p
          Length = 917

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 76/173 (43%), Gaps = 10/173 (5%)

Query: 30  PTTGIRIDNVNDVPTVILPKRFS----ECSRTDLVILISRMLT----FLIQMNDSSSTSA 81
           P   + + NV+D  TVI+ + F+    ECSR   V  I  +LT     L    +     A
Sbjct: 552 PNKVVEVGNVHDNDTVIIRRGFTLNSGECSRQSTVDSIQSVLTTISSILSLKREKPDNLA 611

Query: 82  LDSVTNLTKFHSKVPPGISVYNYLMRLT-KYSSLDHCVLMAAVYYIDLVSSVYPTFTLNS 140
           +    + TK   +    I VYN L  LT K++ L  C +    Y +D  S ++   +L+S
Sbjct: 612 IILQIDFTKLKEE-DSLIVVYNSLKALTIKFARLQFCFVDRNNYVLDYGSVLHKIDSLDS 670

Query: 141 LTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYR 193
           ++  +   ++T  +   L ++      +  +G V  S  N+   + +   +YR
Sbjct: 671 ISNLKSKSSSTQFSPIWLKNTLYPENIHEHLGIVAVSNSNMEAKKSILFQDYR 723

>NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {ON}
           Anc_3.70
          Length = 286

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 47/97 (48%), Gaps = 6/97 (6%)

Query: 90  KFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPT-FTLNSLTVHRFLL 148
           ++  ++P   S+  ++  L +Y+++    L+  V Y++ +  + P   T    T+HR  L
Sbjct: 47  EYQPRLP---SLMTFITNLVRYTNVYTPTLLTTVCYLNKLKRLLPKDATGLPSTIHRIFL 103

Query: 149 TATTVASKGLCDSFCTNTHYAKV--GGVHCSELNVLE 183
               +++K   DS   N H+ K   G     ++N++E
Sbjct: 104 ACLILSAKFHNDSSPLNKHWVKYTDGLFTLEDVNLME 140

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,218,581
Number of extensions: 1528911
Number of successful extensions: 5355
Number of sequences better than 10.0: 110
Number of HSP's gapped: 5426
Number of HSP's successfully gapped: 115
Length of query: 382
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 271
Effective length of database: 40,753,473
Effective search space: 11044191183
Effective search space used: 11044191183
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)