Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07612g6.27ON31931916230.0
NCAS0H015106.27ON31329210771e-148
SAKL0E01474g6.27ON31129210761e-147
KNAG0M012406.27ON31430710501e-143
CAGL0E02519g6.27ON31528210491e-143
Kwal_56.224546.27ON31529710141e-138
Kpol_1032.96.27ON31827510061e-137
KAFR0G026506.27ON3212919981e-135
KLTH0C11044g6.27ON3152739961e-135
Ecym_30316.27ON3282939931e-134
TBLA0E030606.27ON3192919911e-134
NDAI0F017406.27ON3132939881e-134
TDEL0G044206.27ON3222979681e-131
YOL002C (IZH2)6.27ON3172919321e-125
Smik_15.1686.27ON3272789291e-125
Skud_15.1606.27ON3272759191e-123
ACL002C6.27ON3292749181e-123
TPHA0M002906.27ON3273079151e-123
KLLA0D01331g6.27ON3082909111e-122
Suva_15.1736.27ON3272918871e-118
SAKL0C09218g3.90ON3142977661e-100
Kwal_56.227043.90ON3202857661e-100
KLTH0C09504g3.90ON3192807551e-98
TPHA0A006403.90ON3272847481e-97
Kpol_1053.263.90ON3242767254e-94
YDR492W (IZH1)3.90ON3162957227e-94
Suva_2.6683.90ON3152997228e-94
Smik_4.7693.90ON3163057202e-93
CAGL0G04631g3.90ON3162947192e-93
Skud_4.7663.90ON3163057174e-93
ZYRO0B06556g3.90ON3182797132e-92
AFR337W3.90ON3172946983e-90
TDEL0D053403.90ON3163046966e-90
KLLA0C12441g3.90ON3152996853e-88
TBLA0B022903.90ON3262986576e-84
NCAS0I025703.90ON3142786514e-83
KAFR0A081303.90ON3192966515e-83
Ecym_35883.90ON3052776443e-82
NDAI0A071603.90ON3302936342e-80
KNAG0K021603.90ON3232826046e-76
TBLA0B082553.90ON2962894112e-47
NCAS0C049203.90ON3263043653e-40
NDAI0G043003.90ON3182753452e-37
CAGL0I07491g3.90ON3012982645e-26
Suva_15.643.90ON3122911874e-15
Skud_15.533.90ON3122971812e-14
Smik_15.563.90ON3122431741e-13
YOL101C (IZH4)3.90ON3122431672e-12
AAL153C5.197ON4193231503e-10
TPHA0E031205.197ON5692401504e-10
KAFR0J006705.197ON5091781488e-10
KNAG0B051005.197ON5383261488e-10
Ecym_71095.197ON5682371416e-09
Kpol_2002.945.197ON5772781344e-08
KLLA0F15510g5.197ON6222831344e-08
SAKL0G12980g5.197ON5632521344e-08
TBLA0C060505.197ON4372391291e-07
NCAS0D026005.197ON5432391264e-07
YLR023C (IZH3)5.197ON5432401248e-07
NDAI0I023305.197ON5782781248e-07
Kwal_33.151225.197ON5662411231e-06
TDEL0E043205.197ON4502431192e-06
KLTH0B03498g5.197ON5462061167e-06
Skud_12.915.197ON5422361167e-06
Suva_10.1045.197ON5412401122e-05
Smik_12.865.197ON5422411104e-05
CAGL0D03322g5.197ON5452361104e-05
ZYRO0B10538g5.197ON5312381061e-04
KNAG0K006703.90ON321213830.072
TDEL0H038307.68ON1582102703.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C07612g
         (319 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {O...   629   0.0  
NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON...   419   e-148
SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar...   419   e-147
KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.2...   409   e-143
CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {O...   408   e-143
Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C...   395   e-138
Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON} (22700..2...   392   e-137
KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON...   389   e-135
KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...   388   e-135
Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...   387   e-134
TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27...   386   e-134
NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27      385   e-134
TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON...   377   e-131
YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}  ...   363   e-125
Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {O...   362   e-125
Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {O...   358   e-123
ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON} Sy...   358   e-123
TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27 ...   357   e-123
KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar...   355   e-122
Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {O...   346   e-118
SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar...   299   e-100
Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W...   299   e-100
KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {O...   295   1e-98
TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON...   292   1e-97
Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON...   283   4e-94
YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membr...   282   7e-94
Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W...   282   8e-94
Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W...   281   2e-93
CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar...   281   2e-93
Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W...   280   4e-93
ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar...   279   2e-92
AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic h...   273   3e-90
TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90...   272   6e-90
KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa] ...   268   3e-88
TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON...   257   6e-84
NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON...   255   4e-83
KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3....   255   5e-83
Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar ...   252   3e-82
NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {...   248   2e-80
KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.9...   237   6e-76
TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}             162   2e-47
NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {...   145   3e-40
NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90    137   2e-37
CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {O...   106   5e-26
Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON...    77   4e-15
Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON} ...    74   2e-14
Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON} ...    72   1e-13
YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}  ...    69   2e-12
AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syn...    62   3e-10
TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {O...    62   4e-10
KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5....    62   8e-10
KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.1...    62   8e-10
Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}...    59   6e-09
Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON} (2295...    56   4e-08
KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some...    56   4e-08
SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]...    56   4e-08
TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON} Anc_5...    54   1e-07
NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.1...    53   4e-07
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    52   8e-07
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     52   8e-07
Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023...    52   1e-06
TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {O...    50   2e-06
KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {...    49   7e-06
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    49   7e-06
Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {...    48   2e-05
Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {O...    47   4e-05
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    47   4e-05
ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {...    45   1e-04
KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {O...    37   0.072
TDEL0H03830 Chr8 (646726..651474) [4749 bp, 1582 aa] {ON} Anc_7....    32   3.6  

>ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/319 (96%), Positives = 307/319 (96%)

Query: 1   MSNLKKRXXXXXXXXXXXXNLEVNQEQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVG 60
           MSNLKKR            NLEVNQEQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVG
Sbjct: 1   MSNLKKRSSLSTTTSDSQTNLEVNQEQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVG 60

Query: 61  GYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMA 120
           GYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMA
Sbjct: 61  GYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMA 120

Query: 121 IDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSN 180
           IDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSN
Sbjct: 121 IDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSN 180

Query: 181 KLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFH 240
           KLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFH
Sbjct: 181 KLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFH 240

Query: 241 ETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHL 300
           ETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHL
Sbjct: 241 ETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHL 300

Query: 301 VALMNSYELVHTNLLSNST 319
           VALMNSYELVHTNLLSNST
Sbjct: 301 VALMNSYELVHTNLLSNST 319

>NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON}
           Anc_6.27
          Length = 313

 Score =  419 bits (1077), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 190/292 (65%), Positives = 233/292 (79%)

Query: 23  VNQEQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNE 82
           ++ +  +IK     T  + LYTW+EIP+WQKDNEHI+ GYVRETNS R C  SL Y+HNE
Sbjct: 22  IDDDNVSIKHTKKTTTIRKLYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNE 81

Query: 83  SINIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFK 142
           + N+Y+H +PG+ F  T +FDK+AI +F+TTT+ DY+ I+ FF GAF+CLILSSTFHCFK
Sbjct: 82  TGNVYSHLVPGVVFFLTMLFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFK 141

Query: 143 SHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASF 202
           SHS +++ FGNKLDYLGIV+LIV SMISIL+Y F+D+   FY F+L+   FG +C I S 
Sbjct: 142 SHSLKIATFGNKLDYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSL 201

Query: 203 DDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGA 262
            D FRSREWRPYRAGLFVAFGLSA+LPI+ G++ YG HETWTRIQ+KWV+LEG+FYIFGA
Sbjct: 202 KDKFRSREWRPYRAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGA 261

Query: 263 FLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314
           FLY IRFPE+   G FD  GHSHQIFH+LVV+AA CHL AL+ SYELVH NL
Sbjct: 262 FLYGIRFPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313

>SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 311

 Score =  419 bits (1076), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 191/292 (65%), Positives = 230/292 (78%), Gaps = 1/292 (0%)

Query: 26  EQTTIKIEPVNTQK-KLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESI 84
           ++ T+    +N ++ + LY+W EIPDWQKDNEHI  GYVRETNS   C  SL Y+HNES+
Sbjct: 19  KEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESV 78

Query: 85  NIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSH 144
           NIYTH LPGLCF    +FDK AIK FDTTT++DY+ +D FF GAF+CLILSSTFHC K+H
Sbjct: 79  NIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTH 138

Query: 145 SSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDD 204
           S R+++ GNKLDYLGIV LIV SMISI+YY F DS K FY F+ +   FG++C IAS  D
Sbjct: 139 SLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSD 198

Query: 205 TFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFL 264
           TFRSREWRPYRA LFVAFGLSA+LPI  G+  YGF ETW ++Q+KWV+L G+FYI GA L
Sbjct: 199 TFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALL 258

Query: 265 YSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNLLS 316
           Y++R PER++PG FD  GHSHQIFH+LVVIAALCHL A++NSYELVH  L S
Sbjct: 259 YALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKLAS 310

>KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.27
           YOL002C
          Length = 314

 Score =  409 bits (1050), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 190/307 (61%), Positives = 234/307 (76%), Gaps = 13/307 (4%)

Query: 25  QEQTTIKIEPV-----------NTQK--KLLYTWNEIPDWQKDNEHIVGGYVRETNSIRE 71
           Q QT    EPV            T+K  K +YTWNEIP+WQKDNEHI+ GYVRETNS  +
Sbjct: 6   QRQTVTITEPVVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLK 65

Query: 72  CLQSLLYLHNESINIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSC 131
           C+ SL YLHNES+N+Y+H +P LCF +    +K+ +K+F+TT+ +DY+ ID FF GAF+C
Sbjct: 66  CVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTC 125

Query: 132 LILSSTFHCFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIF 191
           LILSSTFHCFKSHS +V+ FGNKLDYLGIV+LIV SMISILYY F+DS+ +FY F+ +  
Sbjct: 126 LILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTL 185

Query: 192 CFGVSCTIASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWV 251
            FG +C + S  D FRSREWRPYRAGLFVAFGLSA+LPI+ G+  YG  E + RIQ+KW+
Sbjct: 186 SFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWI 245

Query: 252 ILEGIFYIFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVH 311
           ILEG+FYI GAFLY IRFPE+ +PG +D  GHSHQ+FH+LVV+AALCHL  LM SYELVH
Sbjct: 246 ILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVH 305

Query: 312 TNLLSNS 318
             L S +
Sbjct: 306 KGLSSAT 312

>CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002c
          Length = 315

 Score =  408 bits (1049), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 189/282 (67%), Positives = 225/282 (79%), Gaps = 1/282 (0%)

Query: 30  IKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTH 89
           IK+      +KL YTW EIP+WQKDNEHI  GYVRET+S+ EC++SL YLHNE++NIY+H
Sbjct: 27  IKLRKKTVVRKL-YTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSH 85

Query: 90  FLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVS 149
            +P + F +T  F+K+ +  + TTT IDY+ ID FF GAFSCLILSSTFHC KSHS RV+
Sbjct: 86  LIPAIAFFSTIFFNKYVVPTYSTTTLIDYLIIDIFFLGAFSCLILSSTFHCLKSHSLRVA 145

Query: 150 VFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSR 209
           VFGNKLDYLGIV LIV SM+SILYY FH +   F  F+LI   FG +C + S  DTFRSR
Sbjct: 146 VFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSR 205

Query: 210 EWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRF 269
           EWRPYRA LFV FGLSA+LPI+ G+ KYG  ETWTRIQ+KWVILEG+FYIFGAFLY IRF
Sbjct: 206 EWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRF 265

Query: 270 PERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVH 311
           PE+++PG+FD  GHSHQIFH+LVV+AALCHL AL+ SY LVH
Sbjct: 266 PEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVH 307

>Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C -
           Hypothetical ORF [contig 185] FULL
          Length = 315

 Score =  395 bits (1014), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 182/297 (61%), Positives = 228/297 (76%), Gaps = 6/297 (2%)

Query: 23  VNQEQTTI----KIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLY 78
           + +E TT+    +IE     ++ LY W+EIP+WQKDNEHI+ GY+ ET S+  CL+SLLY
Sbjct: 20  MTEETTTLLNGSRIE--ERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLY 77

Query: 79  LHNESINIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTF 138
           LHNES+NIYTH +PG CFL   +F++ AI+ ++TT  IDY+ ID FF G F+CL++SSTF
Sbjct: 78  LHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTF 137

Query: 139 HCFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCT 198
           HCFK HS  V+V GNKLDYLGIV L+V SM+SIL+Y FHD+N  FY F+ +   FG++CT
Sbjct: 138 HCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACT 197

Query: 199 IASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFY 258
           I S  D FRSR+WRPYRA LFVAFGLSAL P++ GI  YGF  TWTRIQ+KWV LEG+FY
Sbjct: 198 IVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFY 257

Query: 259 IFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNLL 315
           I GA LY +RFPER+APG FD  G SHQ+FHVLVVIAA CHL AL+ +Y+ VH+ +L
Sbjct: 258 ILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQML 314

>Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON}
           (22700..23656) [957 nt, 319 aa]
          Length = 318

 Score =  392 bits (1006), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 173/275 (62%), Positives = 218/275 (79%)

Query: 42  LYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLATCI 101
           L TW  +PDWQKDNEHI+ GYV+ETNSI+ CL SLL++HNES+NI++H +P  CF+ T I
Sbjct: 41  LVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTII 100

Query: 102 FDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYLGIV 161
           FDK+ ++ + TTT  DY+ +D F FGAF+CL++SS FHC K+HS  VS FGNKLDYLGIV
Sbjct: 101 FDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYLGIV 160

Query: 162 ILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLFVA 221
           +LIV SM SILYY F+D++ L+++F+ I F FG+SC + S  + FR+REWRPYRA +FVA
Sbjct: 161 VLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFVA 220

Query: 222 FGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGAFDFV 281
           FGLSALLPI  G + YG  ET  R+Q+KWV+LEG+FYIFGA LY +RFPERL PG FD  
Sbjct: 221 FGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDIW 280

Query: 282 GHSHQIFHVLVVIAALCHLVALMNSYELVHTNLLS 316
           GHSHQ+FH+LVV+AALCHL  L+ SY +VHT L S
Sbjct: 281 GHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSS 315

>KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON}
           Anc_6.27 YOL002C
          Length = 321

 Score =  389 bits (998), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 181/291 (62%), Positives = 221/291 (75%), Gaps = 4/291 (1%)

Query: 21  LEVNQEQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLH 80
           +E N+ +T   +E +      LY WNEIPDWQKDNEHI+ GYV+ETNS   C++SL YLH
Sbjct: 23  VEQNKGETIRSLEKIIQ----LYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLH 78

Query: 81  NESINIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHC 140
           NES+N+Y+H +P +CFL T + +K  +  F TTT +DY+ ID FF GAF+CLILSSTFHC
Sbjct: 79  NESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHC 138

Query: 141 FKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIA 200
           FKSHS R++ FGNKLDYLGIV+LI  SMIS+LYY F+D+  LFY F  I   FG++C   
Sbjct: 139 FKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATV 198

Query: 201 SFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIF 260
           S  D FRSRE R YRA LFV FGLSA+LP++ G+  YGF+ TW RIQ+KWV+LEG+FYIF
Sbjct: 199 SLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIF 258

Query: 261 GAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVH 311
           GAFLY IRFPE+  PG +D  GHSHQ+FH+LVVIAALCH  ALM SYE VH
Sbjct: 259 GAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHVH 309

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  388 bits (996), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 173/273 (63%), Positives = 216/273 (79%)

Query: 39  KKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLA 98
           K+ LYTW+EIP+WQ+DNEHIVGGY+ ET S  ECL+SLLYLHNES+NIYTH LPG CFL 
Sbjct: 38  KRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLL 97

Query: 99  TCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYL 158
             +F++  I+ F+TT  IDY+ ID FF G F+CL++SS FHCFK HS  V++ GNKLDYL
Sbjct: 98  VAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYL 157

Query: 159 GIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGL 218
           GIV L+V S++SIL+Y FHD +  F+ F+ +   FG++C   S  + FRSREWRPYRA L
Sbjct: 158 GIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASL 217

Query: 219 FVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGAF 278
           FVAFGLSALLP++ G + YG  ETWTRIQ++WV+L G+FYI GA LY IRFPER+APG F
Sbjct: 218 FVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCF 277

Query: 279 DFVGHSHQIFHVLVVIAALCHLVALMNSYELVH 311
           D  GHSHQ+FH+LVV+AALCHL AL+ +Y+L H
Sbjct: 278 DIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score =  387 bits (993), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 175/293 (59%), Positives = 223/293 (76%), Gaps = 5/293 (1%)

Query: 22  EVNQEQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHN 81
           ++NQ  TTI ++P +     L++W+EIP+WQ+DNEHI+GGYV+ETNS +E L SLLYLHN
Sbjct: 33  DLNQA-TTIPLKPASK----LFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHN 87

Query: 82  ESINIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCF 141
           ES+NIYTH +PG+CF      +K+ I  F TTTW DY  ID FF GAF+CL++S T+HC 
Sbjct: 88  ESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCL 147

Query: 142 KSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIAS 201
           KSHS  VS+ GN+LDY+GIVILI  SM S+LYY F++S+K+FY F+ +    G  CT+ +
Sbjct: 148 KSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVT 207

Query: 202 FDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFG 261
            D  FRSR WRPYRA +FVAFGLS++LPI+  I+ YG  ETW  +Q+ W+ILEG+ YIFG
Sbjct: 208 LDSRFRSRLWRPYRASIFVAFGLSSILPILASILYYGSEETWNSVQLGWIILEGVLYIFG 267

Query: 262 AFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314
           AF+Y IRFPE +APG+FD  GHSHQ+FHVLVVIAALCH  A+  SYELVH  L
Sbjct: 268 AFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRL 320

>TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27
           YOL002C
          Length = 319

 Score =  386 bits (991), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 180/291 (61%), Positives = 219/291 (75%), Gaps = 4/291 (1%)

Query: 24  NQEQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNES 83
           NQ+Q    +    +  K LYTW+EIP WQ DNE+I  GYVRETNS++E   SL Y+HNES
Sbjct: 25  NQQQ----LNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNES 80

Query: 84  INIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKS 143
           +NIYTH +P  CFL+  +F+ + +K   TTT+ DY+AID FF GAF+CL LSSTFHCFKS
Sbjct: 81  VNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKS 140

Query: 144 HSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFD 203
           HS ++SVFGNKLDYLGIVILI  S+IS+LY+ +HD   +FY F+ I  CFG++C IAS  
Sbjct: 141 HSLKISVFGNKLDYLGIVILISTSLISVLYFGYHDDPFIFYIFSGITLCFGIACGIASLK 200

Query: 204 DTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAF 263
           D FR+REWRPYRA LFV FGLS +LPI+ GI+KYG  E + R+Q+KW+I EG+ YIFGAF
Sbjct: 201 DKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLYIFGAF 260

Query: 264 LYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314
           LY  RFPE+  PG  D  G SHQIFHVLVVIAALCHL  L+ SYELVH  L
Sbjct: 261 LYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQKL 311

>NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27
          Length = 313

 Score =  385 bits (988), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 181/293 (61%), Positives = 220/293 (75%), Gaps = 1/293 (0%)

Query: 23  VNQEQTTIKIEPVNTQKKL-LYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHN 81
           +N       IE V  +    LY W+EIP+WQKDNEHI+ GYVRETNS + CL SL Y+HN
Sbjct: 21  INNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGCLHSLFYVHN 80

Query: 82  ESINIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCF 141
           ES N+Y+H LPG+ F  T + +K+ I  + TT+ +DY+ ID FFFGAF CLILSS FHCF
Sbjct: 81  ESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCF 140

Query: 142 KSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIAS 201
           KSHS +V+  GNKLDYLGIVILIV SMISI+Y+ F D+   FY F+ + F FG +C   S
Sbjct: 141 KSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPLFFYFFSSLTFLFGGACATVS 200

Query: 202 FDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFG 261
             D FRSREWRPYRAGLFVAFGLSA+LPI+ G   YG  ET+ RIQ+KW+ILEG FYIFG
Sbjct: 201 LKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGFFYIFG 260

Query: 262 AFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314
           AFLY +RFPE+  PG+FD  GHSHQIFH+LVV+AA CHL  L++SYE+VH+ L
Sbjct: 261 AFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVHSRL 313

>TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON}
           Anc_6.27 YOL002C
          Length = 322

 Score =  377 bits (968), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 175/297 (58%), Positives = 221/297 (74%), Gaps = 5/297 (1%)

Query: 23  VNQEQTT-----IKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLL 77
           V +E+T+      K + ++ +K+ LYTW+EIP WQ+DNEHI+ GYV ET S+ +C  SL 
Sbjct: 21  VTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLF 80

Query: 78  YLHNESINIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSST 137
           YLHNES+NIYTH LPG+ FL    FDKFA+  F+TTT IDY+ ID F   +F+CL LSS 
Sbjct: 81  YLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSI 140

Query: 138 FHCFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSC 197
           FHC K+HS  V+ FGNKLDYLGIV+L+V SM+SI+YY F ++  LFY F+ I   FG +C
Sbjct: 141 FHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAAC 200

Query: 198 TIASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIF 257
            + S  + FR+REWRPYRA +FVAFGLSA+LPI+ GI  YGF E + RIQ+KWV+L GIF
Sbjct: 201 AVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIF 260

Query: 258 YIFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314
           YI GA LY +RFPE+ APG +D  GHSHQ+FHVLVV+AALCHL  L+ SY LVH  +
Sbjct: 261 YITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHVLVVVAALCHLYGLIKSYNLVHLKM 317

>YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}
           IZH2Plasma membrane protein involved in zinc homeostasis
           and osmotin-induced apoptosis; transcription regulated
           by Zap1p, zinc and fatty acid levels; similar to
           mammalian adiponectins; deletion increases sensitivity
           to elevated zinc
          Length = 317

 Score =  363 bits (932), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 170/291 (58%), Positives = 213/291 (73%), Gaps = 3/291 (1%)

Query: 27  QTTIKIEPVNTQKKLL---YTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNES 83
           +T+     V   KK+L   Y+W+EIP+WQ+DN+ I+ GYV+ET+S  E  +SL YLHNES
Sbjct: 21  KTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNES 80

Query: 84  INIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKS 143
           +NIY+H +P L F    + DK  IK F TTTW+D+M ID F+ GAF+CLILSS+FHC KS
Sbjct: 81  VNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKS 140

Query: 144 HSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFD 203
           HS R++  GNKLDYLGI ILIV SM+SILYY + +   LF  F LI   FG++C+I S  
Sbjct: 141 HSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLK 200

Query: 204 DTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAF 263
           D FR REWRPYRAGLFV FGLS+++PI  G+  Y F E WT+IQ+ WV+L G+ YI GA 
Sbjct: 201 DKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAV 260

Query: 264 LYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314
           LY +RFPE++ PG FD  GHSHQ+FH LVVIAALCHL  L+NSYELVH  +
Sbjct: 261 LYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVHIKM 311

>Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  362 bits (929), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 167/278 (60%), Positives = 209/278 (75%)

Query: 40  KLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLAT 99
           K LY+W+EIP+WQ+DN+ I+ GYVRET+S  E  +SL YLHNES+NIY+H +P L F   
Sbjct: 47  KRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTV 106

Query: 100 CIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYLG 159
            + DK  IK F+TTTW D++ ID F+ GAF+CLILSS+FHC KSHS R++  GNKLDYLG
Sbjct: 107 LLLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLG 166

Query: 160 IVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLF 219
           I ILIV SM+SIL+Y +++   LF  F LI   FGV+C+I S  D FR REWRPYRAGLF
Sbjct: 167 ICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLF 226

Query: 220 VAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGAFD 279
           V FGLS+++PI  G+  Y F E WT+IQ+ WV+L G+ YI GA LY +RFPE++ PG FD
Sbjct: 227 VCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFD 286

Query: 280 FVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNLLSN 317
             GHSHQ+FH LVVIA+LCHL  L+NSYELVH  + S 
Sbjct: 287 IWGHSHQLFHFLVVIASLCHLRGLLNSYELVHIKMESG 324

>Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  358 bits (919), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 164/275 (59%), Positives = 206/275 (74%)

Query: 40  KLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLAT 99
           K LY+W+EIP+WQ+DN++I+ GYVRET S  E  +SL Y+HNES+NIY+H +P L F   
Sbjct: 47  KRLYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTV 106

Query: 100 CIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYLG 159
            + DK  IK F+TTTW D+M ID F+ GAF+CLILSS+FHC KSHS R++  GNKLDYLG
Sbjct: 107 LLLDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLG 166

Query: 160 IVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLF 219
           I ILIV SM SILYY +++   LF  F LI   FG++C+I +  D FR REWRPYRAGLF
Sbjct: 167 ICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLF 226

Query: 220 VAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGAFD 279
           V FGLS+++PI  G+  Y F E WT+IQ+ WV+L G+ YI GA LY +RFPE++ PG FD
Sbjct: 227 VCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFD 286

Query: 280 FVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314
             GHSHQ+FH LVVIA+ CHL  L+NSYELVH  +
Sbjct: 287 IWGHSHQLFHFLVVIASFCHLRGLLNSYELVHLKM 321

>ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL002C
          Length = 329

 Score =  358 bits (918), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 161/274 (58%), Positives = 204/274 (74%)

Query: 42  LYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLATCI 101
           L +W+++PDWQKDNEHI+ GYVRETNS R+  +SL YLHNES+NIY+H +PG+CFL   +
Sbjct: 52  LCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIAL 111

Query: 102 FDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYLGIV 161
           F+K+ + ++ TTTW DY+ ID F  GA  CL LS  +HC KSHS  VSVFGNKLDY+GIV
Sbjct: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIV 171

Query: 162 ILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLFVA 221
            LI CSMIS +YY F+DS  +F  F+ +     ++C + S    FRSREWR YRA +F A
Sbjct: 172 ALISCSMISQMYYGFYDSTAMFSLFSTVTLSLALACAVVSLSPHFRSREWRKYRAAIFTA 231

Query: 222 FGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGAFDFV 281
           FGLS LLP++     YG  E ++RIQ+KW+ LEG+ YI GA LY +RFPE+L PG+FD  
Sbjct: 232 FGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIW 291

Query: 282 GHSHQIFHVLVVIAALCHLVALMNSYELVHTNLL 315
           GHSHQ+FHVLVVIAALCHL AL++ Y+ VHTN L
Sbjct: 292 GHSHQLFHVLVVIAALCHLRALLSCYKNVHTNAL 325

>TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27
           YOL002C
          Length = 327

 Score =  357 bits (915), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 216/307 (70%), Gaps = 13/307 (4%)

Query: 23  VNQEQTTIKIEPVNTQKKLLYT-------------WNEIPDWQKDNEHIVGGYVRETNSI 69
           V +E+ TI  + V + KKL+               W+++PDWQKDNEHI  GYV+ETNS 
Sbjct: 21  VTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYVKETNSF 80

Query: 70  RECLQSLLYLHNESINIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAF 129
             C +SL +LHNES+NIY+H +PGLC L   + D   IK F TTT++DY  ID F  GAF
Sbjct: 81  INCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTFVDYFMIDLFLAGAF 140

Query: 130 SCLILSSTFHCFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLI 189
           SCLILSS FH  KSHS  V+++GNKLDYLGIVILIV SMISILYY F+D+   F+ F+ I
Sbjct: 141 SCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTI 200

Query: 190 IFCFGVSCTIASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMK 249
              FG++C   S  + FRSREWRPYRA LFV FGLSA+ P++ GI  YG  +T+ RIQ+K
Sbjct: 201 TILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLK 260

Query: 250 WVILEGIFYIFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYEL 309
           W++ EG FYIFGAFLY++R+PER+ PGAFD  GHSHQIFHV VVIAA  H   L+++YE 
Sbjct: 261 WIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGLLSAYEY 320

Query: 310 VHTNLLS 316
            H  L+ 
Sbjct: 321 AHEMLIK 327

>KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 308

 Score =  355 bits (911), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 171/290 (58%), Positives = 206/290 (71%), Gaps = 1/290 (0%)

Query: 26  EQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESIN 85
           E+T    + V   ++ +Y+W+EIPDWQKDNEHI+ GYVRET S +E   SL YLHNES+N
Sbjct: 17  EETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELFHSLFYLHNESVN 76

Query: 86  IYTHFLPGLCFLATCIF-DKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSH 144
           IYTH +P +      +F     I  + TT+ IDY  I+ FFFG  +CL +SS FH  K H
Sbjct: 77  IYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKCH 136

Query: 145 SSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDD 204
           S  ++ FGNKLDYLGIV+LI  SMISIL+Y FHDS+ LFY F  +   FG+ C   S  D
Sbjct: 137 SLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKD 196

Query: 205 TFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFL 264
            FRSREWRPYRA +FV FGLSA+ PI+ G I YG  ETW R+Q+ WVI EG+ YIFGAFL
Sbjct: 197 KFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGVLYIFGAFL 256

Query: 265 YSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314
           Y +RFPERLAPG FD  GHSHQ+FHVLVV+AALCHL AL+ SY LVH  L
Sbjct: 257 YGVRFPERLAPGKFDIWGHSHQLFHVLVVVAALCHLKALVVSYGLVHQAL 306

>Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  346 bits (887), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 161/291 (55%), Positives = 211/291 (72%)

Query: 24  NQEQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNES 83
           N      ++       K +Y+W+EIP+WQ+DN++I+ GYV+ET+S  +  +SL Y+HNES
Sbjct: 31  NTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNES 90

Query: 84  INIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKS 143
           +NIY+H +P + FL   + DK  I  F+TTTW+D+M ID FF GAF+CLILSS+FHCFKS
Sbjct: 91  VNIYSHLIPAVGFLTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKS 150

Query: 144 HSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFD 203
           HS +++  GNKLDYLGI ILIV SM+SILYY ++D    F  F LI   FG++C+I S  
Sbjct: 151 HSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLK 210

Query: 204 DTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAF 263
           D FR REWRPYRAGLFV FGLS+++PI  G+  Y F E W +IQ+ WV+L G  YI GA 
Sbjct: 211 DKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAV 270

Query: 264 LYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314
           LY +RFPE++ PG FD  GHSHQ+FH LVVIA+LCH+  ++NSYELVH  +
Sbjct: 271 LYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVHIKM 321

>SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 314

 Score =  299 bits (766), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 148/297 (49%), Positives = 197/297 (66%), Gaps = 6/297 (2%)

Query: 24  NQEQTTIKI--EPVNTQK--KLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYL 79
            + +TT K   E + T K  K L T+ E+PDWQKDNE I+ GYVRET S+ EC +SLLY 
Sbjct: 9   QRRKTTQKASAESIATAKGRKRLCTFEELPDWQKDNELILDGYVRETRSVSECFKSLLYF 68

Query: 80  HNESINIYTHFLPGLCFLATCIF--DKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSST 137
           HNE++NIYTH +PG+ +L   +F  D   I  F ++T  DY+ I+FF  GAF CL+ SS 
Sbjct: 69  HNETVNIYTHLVPGVTYLLMLMFLTDFILIPKFPSSTMTDYIIINFFLLGAFVCLMCSSC 128

Query: 138 FHCFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSC 197
           FHC K HS   S   +K+DY+GI++LI CSM+SILYY FHD    F  FT++    G  C
Sbjct: 129 FHCLKQHSEEHSDIWSKVDYMGIIVLISCSMVSILYYGFHDHLFHFKIFTVVTVILGSCC 188

Query: 198 TIASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIF 257
                +D F S+ +R +RA  FV+FG S L+PI+ G++K+G  E+  R+Q+K+V LE +F
Sbjct: 189 AAFVLNDRFNSKNFRVFRASFFVSFGFSGLVPIIFGLVKFGISESVHRVQLKYVGLEAVF 248

Query: 258 YIFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314
           YI GA  Y  R PE   PG FD VGHSHQIFHV+VV+ +LCHL A++ SY  +HT +
Sbjct: 249 YIGGAVFYGFRIPENFGPGKFDLVGHSHQIFHVMVVLGSLCHLRAVVGSYIFMHTGV 305

>Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W -
           Hypothetical ORF [contig 184] FULL
          Length = 320

 Score =  299 bits (766), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 140/285 (49%), Positives = 193/285 (67%), Gaps = 2/285 (0%)

Query: 36  NTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLC 95
            T+K  L  + E+P+WQ+DNE I+ GYVRET S+R+CL+SL Y HNE++NIYTH +P   
Sbjct: 29  QTKKSALCRFEELPEWQRDNEKILAGYVRETRSMRKCLESLTYFHNETLNIYTHLIPSGT 88

Query: 96  FLATCIF--DKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGN 153
           +L   +F  D F I +F +TT  DY+ I+F+  GAF CL+ S+ FHC K HS   S   +
Sbjct: 89  YLVLLMFFTDVFLIPHFPSTTMSDYIMINFYLLGAFLCLLCSTCFHCLKQHSEAQSNIWS 148

Query: 154 KLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRP 213
           K+DY+GI++LI CS +S+LYY FHD    F  FT+ +   G  C     +D F ++ WR 
Sbjct: 149 KVDYMGIIVLISCSTVSLLYYGFHDYLFHFKIFTIAVVVLGSCCAAFVLNDRFNAKNWRA 208

Query: 214 YRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERL 273
            RAG FV FG S ++PI+ G++K+G  E+  R+Q+++V+LE  FYI GA +Y  R PE L
Sbjct: 209 CRAGFFVTFGFSGIVPIIMGLVKFGVAESSKRVQLRFVLLEAFFYIGGAIIYGFRIPETL 268

Query: 274 APGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNLLSNS 318
            PG FDFVGHSHQIFH+LVV+ +LCH  AL+ SY  +HT + S+S
Sbjct: 269 IPGKFDFVGHSHQIFHILVVLGSLCHFRALIGSYFFMHTGISSSS 313

>KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {ON}
           similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  295 bits (755), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 138/280 (49%), Positives = 189/280 (67%), Gaps = 2/280 (0%)

Query: 39  KKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLA 98
           K  L  + E+PDWQ+DN+ I+ GYVRETNS+++C +SL Y HNE++NIYTH +P   +L 
Sbjct: 31  KNGLCCFEELPDWQRDNDKILAGYVRETNSMKKCFESLTYFHNETVNIYTHLIPSGTYLV 90

Query: 99  TCIF--DKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLD 156
             +F  D F I  F TTT  DY+ I+FF  GAF CL+ S+ FHC K HS   S   +K+D
Sbjct: 91  MLMFFTDLFLIPQFPTTTMSDYIMINFFLLGAFLCLMCSTCFHCLKQHSEAQSNIWSKVD 150

Query: 157 YLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRA 216
           Y+GI++LI CS +S+LYY F+D    F  FT+ +   G  C     +D F ++ WR  RA
Sbjct: 151 YMGIIVLISCSTVSLLYYGFYDYLFHFKMFTIAVVVLGSCCAAFVLNDRFNAKNWRACRA 210

Query: 217 GLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPG 276
           G FV FG S ++PI+ G++K+G  E+  R+Q+++V+LE +FYI GA +Y  R PE L PG
Sbjct: 211 GFFVTFGFSGIVPIVVGLVKFGIAESSKRVQLRFVLLEALFYISGAVIYGFRIPETLLPG 270

Query: 277 AFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNLLS 316
            FDFVGHSHQIFH+LVV+ +LCH  AL+ SY  +HT + S
Sbjct: 271 KFDFVGHSHQIFHILVVLGSLCHFRALLGSYFFMHTGISS 310

>TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON}
           Anc_3.90 YOL101C
          Length = 327

 Score =  292 bits (748), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 145/284 (51%), Positives = 189/284 (66%), Gaps = 2/284 (0%)

Query: 33  EPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLP 92
           E V T  K LY+++E+P+WQKDNE I+ GYVRETNS  +C  SL Y HNESINIYTH +P
Sbjct: 36  EIVETYSKKLYSFHELPEWQKDNELIIQGYVRETNSWFKCFHSLSYFHNESINIYTHLIP 95

Query: 93  GLCFLATCIF--DKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSV 150
           GL +    +F  D   + +F +TT +DY+ IDF+  GAF CL+ SS FHC K HS   S 
Sbjct: 96  GLVYFIMLLFYTDLLVVPSFPSTTIMDYIVIDFYLLGAFICLVGSSCFHCLKQHSEDQSN 155

Query: 151 FGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSRE 210
           F +K+DY+GI+ LI CS+IS+LYY + D    F  FTLI       CT+   D+ F ++ 
Sbjct: 156 FWSKIDYVGIICLISCSLISLLYYGYFDHFIYFKVFTLITLILATICTVCVLDERFNAKN 215

Query: 211 WRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFP 270
           +RP RAG FV F  SA++PI  G+IK+ + E   RIQ+++V  E  FY+ GA LY  R P
Sbjct: 216 FRPIRAGFFVVFATSAVIPICTGLIKFDYVEVINRIQLRFVGWETFFYVVGALLYGYRIP 275

Query: 271 ERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314
           E  APG FD VG SHQIFHV+VVI +L HL A++ SYE +H +L
Sbjct: 276 EIFAPGRFDLVGSSHQIFHVMVVIGSLFHLKAVIGSYEFMHKSL 319

>Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON}
           complement(40099..41073) [975 nt, 325 aa]
          Length = 324

 Score =  283 bits (725), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 136/276 (49%), Positives = 185/276 (67%), Gaps = 2/276 (0%)

Query: 45  WNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLATCIF-- 102
           ++E+PDWQKDNE I+ GYVRETNSI++CL+SL   +NESINIY+H +  + +    +F  
Sbjct: 44  FHELPDWQKDNEFILTGYVRETNSIKKCLRSLGCFNNESINIYSHLIAAISYFVVLLFYT 103

Query: 103 DKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYLGIVI 162
           D   I +F +TT++DYM ID +  GAF+CLI SS FHC K HS   S   +K+DY+GI+ 
Sbjct: 104 DILCIPSFPSTTFVDYMVIDLYLLGAFTCLIGSSLFHCMKQHSESHSDMWSKVDYIGIIC 163

Query: 163 LIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLFVAF 222
           LI CS+IS+LYY + D    F  FT+I       CTI   D  F S+ +RP RAG F+ F
Sbjct: 164 LITCSLISLLYYGYMDHFIYFKVFTVITLVLATICTICVLDQRFNSKNFRPIRAGFFILF 223

Query: 223 GLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGAFDFVG 282
            +SA++PI  G  K+GF E   RIQ+++V  E  FY+ GA LY  R PE L PG FD VG
Sbjct: 224 SMSAVIPIGAGFSKFGFTEVLQRIQLRFVAWETFFYVVGALLYGFRIPETLYPGNFDLVG 283

Query: 283 HSHQIFHVLVVIAALCHLVALMNSYELVHTNLLSNS 318
            SHQIFH++V++ ++ HL A++ SY  +H+N+ SNS
Sbjct: 284 SSHQIFHIMVILGSVFHLKAVLGSYTFMHSNISSNS 319

>YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membrane
           protein involved in zinc ion homeostasis, member of the
           four-protein IZH family; transcription is regulated
           directly by Zap1p, expression induced by zinc deficiency
           and fatty acids; deletion increases sensitivity to
           elevated zinc
          Length = 316

 Score =  282 bits (722), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 136/295 (46%), Positives = 195/295 (66%), Gaps = 7/295 (2%)

Query: 27  QTTIKIEPVNTQ-----KKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHN 81
           + +IK+E V+ Q     +KLL+ ++E+P+WQKDN+ I+ GYVRET S ++CL SL Y +N
Sbjct: 20  RASIKVEAVSGQTVFEKQKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNN 79

Query: 82  ESINIYTHFLPGLCFL--ATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFH 139
           E++NIYTH +P + +   A  + + F I  F +T+W DY  I+ F  GAFSCL+ SS FH
Sbjct: 80  ETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFH 139

Query: 140 CFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTI 199
           C K HS + S F +KLDYLGI+ LI CSMI I+Y+ + D    F  FT++       CT+
Sbjct: 140 CMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTV 199

Query: 200 ASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYI 259
               D F +  +RP+RA  F+ FG S LLP+  G  K+G      RI++ +V  E +FYI
Sbjct: 200 CVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYI 259

Query: 260 FGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314
            GA +Y  R PE LAPG FDF G SHQIFH++VV+ ++CHL A+++SY+L+H+++
Sbjct: 260 SGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMHSHI 314

>Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W
           (REAL)
          Length = 315

 Score =  282 bits (722), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 136/299 (45%), Positives = 195/299 (65%), Gaps = 7/299 (2%)

Query: 25  QEQTTIKIEPVNTQ-----KKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYL 79
           +  T+IK+E + ++     +KLL+ ++E+PDWQ+DN+ I+ GYVRET S ++CL SL Y 
Sbjct: 17  KTSTSIKVEALKSKVTLRKEKLLHDFHELPDWQRDNDKILTGYVRETLSWKKCLYSLFYW 76

Query: 80  HNESINIYTHFLPGLCFL--ATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSST 137
           +NE++NIYTH +P + +      + + F I  F +TTW DY  I+ F  GAF CL+ SS 
Sbjct: 77  NNETVNIYTHLVPAIVYFVFGVTLTNYFLIPVFPSTTWSDYTVINIFLMGAFLCLMCSSC 136

Query: 138 FHCFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSC 197
           FHC K HS + S F +KLDYLGI+ LI CSMI I+Y+ + D    F  FT++       C
Sbjct: 137 FHCMKQHSEKQSDFWSKLDYLGIISLISCSMIPIIYFGYFDHASYFSLFTIVTLVLATFC 196

Query: 198 TIASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIF 257
           TI    D F +  +RP+RA  F+ FG S LLP+  G+ K+G      RI++ +V  E +F
Sbjct: 197 TICVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGLFKFGLQGVLNRIRVSFVFWEALF 256

Query: 258 YIFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNLLS 316
           YI GA +Y  R PE LAPG FDF G SHQIFH++VV+ ++CHL A+++SY+L+H++  S
Sbjct: 257 YISGALIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMHSHFHS 315

>Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  281 bits (720), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 138/305 (45%), Positives = 198/305 (64%), Gaps = 14/305 (4%)

Query: 24  NQEQT-------TIKIEPVNT-----QKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRE 71
           NQE         +IK+E V++     +KKLL+ ++E+P+WQKDN+ I+ GYVRET S ++
Sbjct: 10  NQESVCCSVTTGSIKVEAVSSTTVSEKKKLLHNFDELPEWQKDNDKILTGYVRETLSWKK 69

Query: 72  CLQSLLYLHNESINIYTHFLPGLCFL--ATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAF 129
           CL SL Y +NE++NIYTH +P + +   A  + + F I  F +T+W DY  I+ F  GAF
Sbjct: 70  CLYSLFYWNNETVNIYTHLVPAVIYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAF 129

Query: 130 SCLILSSTFHCFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLI 189
           SCL+ SS FHC K HS + S F +KLDYLGI+ LI CSMI I+Y+ + D    F  FT++
Sbjct: 130 SCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIV 189

Query: 190 IFCFGVSCTIASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMK 249
                  CT+    + F +  +RP+RA  F+ FG S LLP+  G  K+G      RI++ 
Sbjct: 190 TLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVS 249

Query: 250 WVILEGIFYIFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYEL 309
           +V  E +FYI GA +Y  R PE LAPG FDF+G SHQIFH++VV+ ++CHL A++ SY+L
Sbjct: 250 FVFWEALFYISGAVIYGFRIPETLAPGKFDFLGSSHQIFHIMVVLGSICHLKAIIGSYKL 309

Query: 310 VHTNL 314
           +H+++
Sbjct: 310 MHSHI 314

>CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar to
           uniprot|Q03419 Saccharomyces cerevisiae YDR492w
          Length = 316

 Score =  281 bits (719), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 132/294 (44%), Positives = 190/294 (64%), Gaps = 2/294 (0%)

Query: 24  NQEQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNES 83
            +   +I        +KLL+ +NE+P+WQKDN+ I+ GYVRETNS + CLQSLLYL+NES
Sbjct: 20  GRNDGSIHAHGEEKSEKLLWHFNELPEWQKDNDKILRGYVRETNSFKRCLQSLLYLNNES 79

Query: 84  INIYTHFLPGLCFLATCIF--DKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCF 141
           +NIYTH +P + +++  ++  + F I  + +T+ +DY+ I+ FF GAF CL+ SS FHC 
Sbjct: 80  VNIYTHLIPAVFYISLSLYLANVFLIPVYPSTSSVDYVIINVFFLGAFFCLLCSSCFHCM 139

Query: 142 KSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIAS 201
           K HS       +KLDYLGI+ LI CS + ++YY + D    F  FT I     + C++  
Sbjct: 140 KQHSESQCNVWSKLDYLGIICLISCSTVPMIYYGYFDHISEFTIFTGITLLLAIGCSVFV 199

Query: 202 FDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFG 261
             D F + E+RP RA  F  FG S ++P+  G +K+G      RI + ++ LE +FYI G
Sbjct: 200 LTDKFNTTEYRPIRASFFTLFGFSGIIPLGAGFLKFGAEGVLQRISLPFIGLEALFYISG 259

Query: 262 AFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNLL 315
           A +Y  RFPE +APG FDF G SHQIFH++VV+ ++CHL A++ SY L+H+N L
Sbjct: 260 AIIYGFRFPETIAPGKFDFFGSSHQIFHIMVVLGSICHLFAMVESYHLIHSNFL 313

>Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  280 bits (717), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 137/305 (44%), Positives = 197/305 (64%), Gaps = 14/305 (4%)

Query: 24  NQEQ-------TTIKIEPVNTQ-----KKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRE 71
           NQE         +IK+E V ++     +KLL+ ++E+P+WQKDN+ I+ GYVRET S ++
Sbjct: 10  NQESVCCKATTASIKVEAVQSKTASEKEKLLHNFDELPEWQKDNDKILTGYVRETLSWKK 69

Query: 72  CLQSLLYLHNESINIYTHFLPGLCFL--ATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAF 129
           CL+SL Y +NE++NIYTH +P + +   A  + + F I  F +T+W DY  I+ F  GAF
Sbjct: 70  CLRSLFYWNNETVNIYTHLVPAIIYFLFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAF 129

Query: 130 SCLILSSTFHCFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLI 189
           SCL+ SS FHC K HS   S F +KLDYLGI+ LI CSMI I+Y+ + D    F  FT +
Sbjct: 130 SCLMCSSCFHCLKQHSEEQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHVSYFSLFTTV 189

Query: 190 IFCFGVSCTIASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMK 249
                  CT+    + F +  +RP+RA  F+ FG S LLP+  G  K+G      RI++ 
Sbjct: 190 TLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVS 249

Query: 250 WVILEGIFYIFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYEL 309
           +V  E +FYI GA +Y  R PE +APG FDF+G SHQIFH++VV+ +LCHL A+++SY+L
Sbjct: 250 FVFWEALFYISGAVIYGFRIPETIAPGKFDFLGSSHQIFHIMVVLGSLCHLKAIIDSYKL 309

Query: 310 VHTNL 314
           +H+++
Sbjct: 310 MHSHI 314

>ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 318

 Score =  279 bits (713), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 188/279 (67%), Gaps = 2/279 (0%)

Query: 38  QKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCF- 96
           ++K LY ++E+P+WQ+DN+ I+ GY+RET S+ +C++SL   +NE++NIYTH +  + + 
Sbjct: 28  EEKTLYDFHELPEWQQDNDKILTGYIRETKSVLKCVRSLFIWNNETVNIYTHLVSAVSYF 87

Query: 97  -LATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKL 155
            L   I D   + +F T+T+ DY  I+F+  GAF CL+ SS FH FK HS   S   +K+
Sbjct: 88  LLMLGITDLVMVPHFPTSTFTDYSVINFYLLGAFGCLMCSSCFHTFKQHSGPHSDAWSKV 147

Query: 156 DYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYR 215
           DY+GI++LI CSMIS++YY F D  + F  FT++      +CT+    D F  +++RP R
Sbjct: 148 DYMGIIVLITCSMISLIYYGFFDHMEYFRLFTVLTLTLATACTVCVLSDKFNHKDFRPLR 207

Query: 216 AGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAP 275
           AG F+AFGLS + P+  GIIK+G      R+Q+K++ LE IFYI GA +Y  R PE + P
Sbjct: 208 AGFFIAFGLSGVFPVAAGIIKFGIQGGVQRVQLKYLGLEAIFYIAGALIYGFRIPETMFP 267

Query: 276 GAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314
           G FDF GHSHQIFHVLVVIA+  HL A+M SY   H++L
Sbjct: 268 GRFDFWGHSHQIFHVLVVIASFLHLKAVMGSYIFKHSHL 306

>AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR492W (IZH1) and
           YOL101C (IZH4)
          Length = 317

 Score =  273 bits (698), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 133/294 (45%), Positives = 185/294 (62%), Gaps = 2/294 (0%)

Query: 22  EVNQEQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHN 81
           E+ QE      E +  + + LYT++E+P WQKDNE I+ GYVRETNS++ECL+++ Y +N
Sbjct: 14  EMAQEMAHTTSEGLKKRIRKLYTFDELPAWQKDNELILSGYVRETNSVKECLRAMTYFNN 73

Query: 82  ESINIYTHFLPGLCFLAT-CIFDKFAIKNF-DTTTWIDYMAIDFFFFGAFSCLILSSTFH 139
           ESINIYTH +PG+ +L    IF    +          ++  + F+  GAF+CL  SS FH
Sbjct: 74  ESINIYTHLIPGVAYLVLFLIFADLVLAQLLPGLDAGEHRMLRFYLLGAFTCLACSSCFH 133

Query: 140 CFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTI 199
           C K HS   S   +K+DYLGI+  I CS IS+LYY +H     F  F+ +      +C +
Sbjct: 134 CLKQHSEPHSRLWSKVDYLGILAQITCSTISLLYYGYHSYPSHFVFFSTLTVALCSACAV 193

Query: 200 ASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYI 259
              +D+F +  +RP RA LF+AFGLS ++P++ G  ++GF E   RIQ+K+V+ E +FYI
Sbjct: 194 LVLNDSFNTVAFRPLRAFLFMAFGLSGVIPVLAGSYQFGFAEWAARIQLKYVLYEAVFYI 253

Query: 260 FGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTN 313
            GA +Y  R PER APG FD VGHSHQIFH+LVV+  LCH  A+  SY  + T 
Sbjct: 254 TGALVYGFRIPERFAPGKFDMVGHSHQIFHLLVVLGTLCHFRAVTGSYIFICTG 307

>TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90
           YOL101C
          Length = 316

 Score =  272 bits (696), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 134/304 (44%), Positives = 194/304 (63%), Gaps = 16/304 (5%)

Query: 23  VNQEQTTIKIEPVNTQK----------KLLYTWNEIPDWQKDNEHIVGGYVRETNSIREC 72
           + Q +TT++     TQK          K LY +NE+P+WQ+DN+ I+ GYVRET S+  C
Sbjct: 7   IRQRKTTVQ----ETQKARDSKDGIMGKKLYHFNELPEWQQDNDKILTGYVRETKSVLRC 62

Query: 73  LQSLLYLHNESINIYTHFLPGLCFLATCIF--DKFAIKNFDTTTWIDYMAIDFFFFGAFS 130
           L SL Y +NES+NIYTH L  + +    +F  D   I +F +TT  DY+ I+F+  GAF 
Sbjct: 63  LDSLSYWNNESVNIYTHLLSAVAYFVLLLFFTDILLIPSFPSTTMTDYIIINFYLLGAFV 122

Query: 131 CLILSSTFHCFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLII 190
           CL+ SS FHCFK HS+  S   +K+DY+GI+ LI CS+IS+LYY + D    F  F++I 
Sbjct: 123 CLMCSSCFHCFKQHSNSQSDAWSKVDYMGIIGLISCSVISLLYYGYFDHVFYFKLFSVIT 182

Query: 191 FCFGVSCTIASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKW 250
               ++C++    D F + + RP RA  F+ F  S+++PI  G+ K+G+ E + R+Q+++
Sbjct: 183 VVLAMACSVCVLSDRFNTSDMRPLRASFFITFAFSSVIPIATGMFKFGWTEVFHRVQLRF 242

Query: 251 VILEGIFYIFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELV 310
           V  E  FY+ GA LY  R PE +APG FDF+G SHQ+FHVLVV+ + CHL A+M SY  +
Sbjct: 243 VGWEAFFYLSGALLYGYRIPETIAPGKFDFIGSSHQLFHVLVVLGSFCHLRAVMGSYMFM 302

Query: 311 HTNL 314
           H ++
Sbjct: 303 HAHI 306

>KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa]
           {ON} similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  268 bits (685), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 132/299 (44%), Positives = 197/299 (65%), Gaps = 2/299 (0%)

Query: 22  EVNQEQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHN 81
            ++++   +    +++  K LY ++E+P+WQ+DN+ I+ GY+RET S++EC++SL   HN
Sbjct: 12  SISEKLEQLTPVAISSTIKRLYRYSELPEWQQDNDKIITGYIRETKSVKECVKSLFLFHN 71

Query: 82  ESINIYTHFLPGLCFLATCI--FDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFH 139
           ESINIY+H +P + +L   +   D F +  F  +T +  + I FF  G+  CL  SS FH
Sbjct: 72  ESINIYSHLVPTITYLVLLVGLADMFLVPQFPNSTMMQSVMIHFFLLGSVLCLGCSSFFH 131

Query: 140 CFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTI 199
           C K HS       +K+DY+GI+I+I CS+IS+LYY FHD    F  FT+     G  CT+
Sbjct: 132 CLKQHSESHCHIWSKVDYMGIIIMITCSIISLLYYGFHDHIFHFKCFTVFTVILGTICTV 191

Query: 200 ASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYI 259
            +  D F S+ +RP+RA  +V FGLS ++PI+ G  K+G +E   R+Q+K+V+LE +FYI
Sbjct: 192 FALHDKFNSKTFRPFRAMFYVTFGLSGIVPIVTGFWKFGAYEAIRRVQLKYVLLEAMFYI 251

Query: 260 FGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNLLSNS 318
            GA +Y  RFPE LAPG FDFVGHSHQIFH++VV+ ++CH  A++ SY  +HT +  +S
Sbjct: 252 AGAVIYGFRFPEVLAPGKFDFVGHSHQIFHIMVVLGSICHFRAILGSYVFMHTGMHHSS 310

>TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON}
           Anc_3.90 YOL101C
          Length = 326

 Score =  257 bits (657), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 129/298 (43%), Positives = 187/298 (62%), Gaps = 6/298 (2%)

Query: 23  VNQEQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNE 82
           ++Q    +K +  +T   LLYT+ E+P WQ+DNE I+ GY+RETNS + CL+SL + HNE
Sbjct: 27  LSQAAEDVKQKITDT---LLYTYEELPSWQQDNEMILTGYIRETNSWKLCLRSLTFFHNE 83

Query: 83  SINIYTHFLPGLCFLATCIF---DKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFH 139
           +INIY+H +    +L   +F   +   + +F TTT  DY+ +D +  GA +CL LSS FH
Sbjct: 84  TINIYSHGISAAIYLLLLVFFFTNLIYLPSFPTTTLHDYLVLDIYLLGAATCLTLSSCFH 143

Query: 140 CFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTI 199
           C K HS   S   +K+DY+GI+ LI CS IS+LY+ + D    F  F +  F   ++CT+
Sbjct: 144 CLKQHSQSQSDIWSKMDYIGIICLITCSTISLLYFGYRDHFNYFKFFAISTFILAITCTV 203

Query: 200 ASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYI 259
               + F +R+W+  RA  F+AF  S L+P++ GI  +GF E W R+Q+  + LE I Y+
Sbjct: 204 FVTMEKFNTRDWKHVRALFFIAFAGSGLIPLITGINIFGFPEVWQRVQLPSLTLELICYV 263

Query: 260 FGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNLLSN 317
            GA LY  R PE  APG FD +G+SHQ FH+ VV+ +L HL AL+ SY  +H+ LL+ 
Sbjct: 264 IGALLYGYRIPEVFAPGKFDNIGNSHQWFHIFVVLGSLLHLRALVGSYYFMHSFLLAT 321

>NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON}
           Anc_3.90 YDR492W
          Length = 314

 Score =  255 bits (651), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 128/278 (46%), Positives = 186/278 (66%), Gaps = 2/278 (0%)

Query: 39  KKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFL- 97
           K+ L+ +NE+P+WQ+DN+ I+ GYVRET S ++CLQSLLY +NE+INIYTH +P L +L 
Sbjct: 36  KRRLFNFNELPEWQRDNDKILTGYVRETKSFKQCLQSLLYWNNETINIYTHLIPALFYLT 95

Query: 98  -ATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLD 156
            +  + +   + +F TT+ +DY  I+ F  GAF CLILSS FHC K HSSR     +KLD
Sbjct: 96  ISVTLINYVVVPHFPTTSIMDYFVINVFLMGAFVCLILSSCFHCLKQHSSRQCTLWSKLD 155

Query: 157 YLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRA 216
           Y+GI+ILI CS+I ++Y+ + D       F ++ F F   C+I   ++ F    +RP+RA
Sbjct: 156 YMGIIILISCSLIPMIYFGYFDHLYYVNFFIILTFSFATLCSICVLNEKFNVPHYRPFRA 215

Query: 217 GLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPG 276
            +F+ F  S  +PI+ G   +GFH  + R+ +K+V  E +FYI GA LY  R PE   PG
Sbjct: 216 IVFMLFSFSGFIPILTGFYLFGFHGVFERVALKFVAWEALFYITGATLYGFRIPECFKPG 275

Query: 277 AFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314
            FDF+G SHQIFH+LVV+ ++CH  A++ SY L+H+++
Sbjct: 276 DFDFLGSSHQIFHILVVLGSICHFRAVIKSYILMHSSM 313

>KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3.90
           YOL101C
          Length = 319

 Score =  255 bits (651), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 128/296 (43%), Positives = 185/296 (62%), Gaps = 11/296 (3%)

Query: 24  NQEQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNES 83
            +  ++IKIE     K++LY ++E+P WQ+DN+ I+GGYVRETNS  +C++SL YL+NES
Sbjct: 26  TRSDSSIKIE-----KRILYHFHELPTWQQDNDKILGGYVRETNSFTKCIESLFYLNNES 80

Query: 84  INIYTHFLPGLCFLATCIF-----DKFA-IKNFDTTTWIDYMAIDFFFFGAFSCLILSST 137
           INIY+H +P L +L   +      D+F  I  + TTT  D++ I+ F  GAF CL+ S  
Sbjct: 81  INIYSHLIPSLIYLTIAVMLLIEIDQFLNIPIYPTTTKYDFIFINIFLVGAFLCLLGSGC 140

Query: 138 FHCFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSC 197
           FH  K HS     F +++DY+GI++LI CSM+ +LYY F D   LFY F  +   F   C
Sbjct: 141 FHLLKQHSELQCNFWSRIDYMGIIVLISCSMMPVLYYGFFDHIVLFYCFITLTLAFASVC 200

Query: 198 TIASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIF 257
           +I    +TF   ++R  RA +F AFG S L+P++ G  K+G    + RI +K++  E +F
Sbjct: 201 SIIVMSETFNLSKYRLLRACVFAAFGFSGLIPMIVGFSKFGLSGVFQRISLKFIFWESVF 260

Query: 258 YIFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTN 313
           Y+ GA LY  R PE + PG FD  G SHQ+FH  VVI ++ H  A++ SY L+H+ 
Sbjct: 261 YLVGATLYGFRIPESILPGKFDLFGSSHQLFHCFVVIGSVLHFKAVIESYILMHSR 316

>Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR337W
          Length = 305

 Score =  252 bits (644), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 123/277 (44%), Positives = 177/277 (63%), Gaps = 2/277 (0%)

Query: 39  KKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLA 98
            + LY+++E+P+WQKDNE I  GYVRETNS  ECL+S+ Y +NES+NIYTH +P + +  
Sbjct: 19  NRRLYSFDELPEWQKDNELIRMGYVRETNSFLECLKSMTYFNNESVNIYTHLVPSVTYFI 78

Query: 99  TCIFDKFAIKN--FDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLD 156
             +     +    F  TT  +Y+ IDF+ FG F CL+ S+ FHC K HS   +   +K+D
Sbjct: 79  LLLLFVDLVVTPMFPGTTMREYIMIDFYLFGVFVCLMCSTCFHCLKQHSESHNRIWSKVD 138

Query: 157 YLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRA 216
           Y+GI++ I  S++SILYY F+D        +++    GV C     +D F + ++R  RA
Sbjct: 139 YIGIIVQITSSIVSILYYGFYDHISHIKWLSVLTLTLGVCCVTFVLNDRFNAIDYRLLRA 198

Query: 217 GLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPG 276
             F  FG S ++P++ GI ++G  E   RIQ+K+V+   IFYIFGA +Y  R PE LAPG
Sbjct: 199 IFFTVFGFSGVVPVLIGIYQFGLIEWLARIQLKFVLAGTIFYIFGALIYGFRIPEALAPG 258

Query: 277 AFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTN 313
            FDF+GHSHQIFH+LVV+ ++CH  A++ SY  + T 
Sbjct: 259 KFDFIGHSHQIFHLLVVLGSICHFRAVIGSYVFMRTG 295

>NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {ON}
           Anc_3.90
          Length = 330

 Score =  248 bits (634), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 134/293 (45%), Positives = 188/293 (64%), Gaps = 6/293 (2%)

Query: 25  QEQTTIKIEPVNTQKKLLY--TWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNE 82
           ++  T +    N +K+ ++   ++E+P+WQKDN+ I+ GYVRETNS   C QSL YL+NE
Sbjct: 34  EDNDTSQKPKTNRRKRKIHLSKFDELPEWQKDNDKILTGYVRETNSFIHCFQSLFYLNNE 93

Query: 83  SINIYTHFLPGLCFLA---TCIFDKF-AIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTF 138
           +INIYTH +P + +L    T IF  F AI  F TT+ IDY+ I+ F  GAF+CL+LSS F
Sbjct: 94  TINIYTHLIPSIIYLIVSLTFIFINFIAIPKFPTTSVIDYIVINIFILGAFTCLLLSSCF 153

Query: 139 HCFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCT 198
           HC K HS +     +KLDY+GI+ILI CS+I ILY+ + D    F  FT++ F F + C+
Sbjct: 154 HCLKQHSFKQCTLWSKLDYIGIIILISCSIIPILYFGYFDRLSYFKFFTILTFSFAIVCS 213

Query: 199 IASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFY 258
           I   ++ F    +RP RAGLF+ F  + L+P++ G   +G+     RI + +V+LE IFY
Sbjct: 214 IIVLNEKFDLPSYRPLRAGLFMLFSFTGLIPMITGFYIFGYKGVMERISLNFVLLEAIFY 273

Query: 259 IFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVH 311
           I G  LY  R PE   PG FD  G SHQIFH+ VV+ ++CH  A++ SY L+H
Sbjct: 274 IIGTLLYGFRIPETFKPGNFDMFGSSHQIFHIFVVLGSICHFGAVIKSYCLMH 326

>KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.90
           YOL101C
          Length = 323

 Score =  237 bits (604), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 120/282 (42%), Positives = 176/282 (62%), Gaps = 3/282 (1%)

Query: 36  NTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLC 95
           + Q+  L  + E+P WQ+DN+ I  GYVRET S+R CL SLLY +NES+N+Y+H +P + 
Sbjct: 41  SGQRGRLCRYEELPAWQQDNDCIRTGYVRETLSVRRCLGSLLYWNNESVNMYSHLVPAVL 100

Query: 96  FLA--TCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGN 153
           ++A  T    ++ +  F TTTW DY+ I+ F  GA +CL+ SS FHC K HS R     +
Sbjct: 101 YIAGATLALSQWGVPRFPTTTWSDYLIINTFLVGAGACLLCSSLFHCLKQHSERHCEAWS 160

Query: 154 KLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCT-IASFDDTFRSREWR 212
           ++DY+GI++LI CS I ++Y+ + D       FT +    GV+C+ +  F+  F S  ++
Sbjct: 161 RMDYMGIILLIACSTIPMIYFGYFDYMGHCLLFTAVTVALGVACSGVVLFNKQFNSSSFK 220

Query: 213 PYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPER 272
             RA  F+AF  + L+P+  G +K+G      RI +K+V  E +FYI GA LY  R PE 
Sbjct: 221 LVRAAFFIAFAFNGLIPMATGFVKFGIPGVLDRISLKYVWFEAVFYIAGAMLYGFRVPEI 280

Query: 273 LAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314
             PG  D  G+SHQ+FHV+VV  +LCHL A++ SY L+H +L
Sbjct: 281 WIPGKVDLWGNSHQMFHVMVVFGSLCHLKAVLESYSLMHRHL 322

>TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}
          Length = 296

 Score =  162 bits (411), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 99/289 (34%), Positives = 145/289 (50%), Gaps = 34/289 (11%)

Query: 42  LYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLATCI 101
           L  +N++PDWQKDN  IV  YVRETNS+ + L S+   H+ES+NI+TH +P L      +
Sbjct: 8   LCNFNDLPDWQKDNPLIVNYYVRETNSLFKSLCSIFLFHSESMNIFTHLIPAL------L 61

Query: 102 FDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYLGIV 161
           + KF      T   + Y  I F+      C +LSS FH FK  S + + F  KLDY+GI 
Sbjct: 62  YAKFTYNAITTLEQVSY-PIVFYLISVIICFLLSSLFHLFKCTSVQSNEFWGKLDYVGIS 120

Query: 162 ILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIA------------------SFD 203
           +LI  +++S+    F++S    Y+     F    SC  A                    D
Sbjct: 121 LLINATIVSMALLGFNESR---YTIMKNTFVTQTSCLTAYVIILAIKSHPKQGENEDDND 177

Query: 204 DTFRSREW------RPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIF 257
            T    +       +  RA LF + GLS L+P++ G+  YG    + +I +  VI   + 
Sbjct: 178 GTLSEDDDCCCDDHKGTRAKLFASLGLSGLIPVITGLYIYGPKVVYYKINIPMVIASVLC 237

Query: 258 YIFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNS 306
           YI G  +Y  + PE+  PG FD VG SHQ+FH+ +V   +CH  A+  +
Sbjct: 238 YIVGTLIYVFKIPEKFYPGRFDLVGSSHQLFHIFIVFGTVCHYHAIQTA 286

>NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {ON}
           Anc_3.90
          Length = 326

 Score =  145 bits (365), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 99/304 (32%), Positives = 158/304 (51%), Gaps = 20/304 (6%)

Query: 27  QTTIKIEPVNTQK---------KLLYTWNEIPDWQKD--NEHIVGGYVRETNSIRECLQS 75
           Q   K+ P N  K         K+L    E+P WQK   N  I+ GYVRETNS+ +CL +
Sbjct: 17  QDADKLTPFNAPKYSVTFPRRPKVLPILKELPQWQKQYSNSKIINGYVRETNSLIKCLHT 76

Query: 76  LLYLHNESINIYTHFLPGLCFLATCIF--DKFAIKNFDTTTWIDYMAIDFFFFGAFSCLI 133
           + Y +N+++NI  + +    +    +F  D + I +   TT  DY+ ++F+ FGAF    
Sbjct: 77  VTYWNNQTVNIILNTVFSTVYFTLLLFFTDLYLIPSSPATTMSDYIMVNFYLFGAFQYFA 136

Query: 134 LSSTFHCFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCF 193
           L+S F+  +SHS        KL +L  +  I  S+I+ LYY F D+  +FY   L I   
Sbjct: 137 LNSIFYLLESHSLAKCHLWFKLSHLAFINYISTSIITQLYYTFFDN--VFYFKFLTISTL 194

Query: 194 GVSCTIASF--DDTFRSREWRPYRAGLFVAFGLSAL-LPIMGGIIKYGFHETWTRIQMKW 250
            +S   A F   + F  R+ R  R  + + F +S L LP    + K+       R++ K 
Sbjct: 195 LISSIFAIFTLSEQFL-RKNRSQRNMVSITFIVSLLILPTASLMFKFNTFRILRRVEGKA 253

Query: 251 VILEGIFYIFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELV 310
           ++LE   Y+F   L +++ PER +   FDF+G+S  I+H+ +++ +L H   L+NSY  +
Sbjct: 254 ILLELSLYLFSMTLKAVQVPERFSEN-FDFIGNSENIYHICIILGSLLHFKMLLNSYFFM 312

Query: 311 HTNL 314
           H+ L
Sbjct: 313 HSGL 316

>NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90
          Length = 318

 Score =  137 bits (345), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 81/275 (29%), Positives = 151/275 (54%), Gaps = 7/275 (2%)

Query: 43  YTWNEIPDWQKD--NEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLATC 100
           Y   E+P+WQ++  +  ++ G+++ETNS ++CL S +Y HN SINI  + +    +    
Sbjct: 34  YKLKELPEWQREFNSGKVITGFLKETNSFKKCLWSTMYWHNSSINISLNGIAATVYFMLL 93

Query: 101 IF--DKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYL 158
            F  D + I +F +TT  DY+ ++ +   A    ++ + F+  KSHS + +    KL+ +
Sbjct: 94  FFFTDCYLIPSFPSTTMSDYIVLNLYLLTATQNFMVGTIFYIMKSHSKQQAFLWYKLNNI 153

Query: 159 GIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGL 218
           G++  I  S++++LYY + D    F  FT++        T +   D+F ++  R  +  L
Sbjct: 154 GLINHIASSVVTLLYYHYFDYVFYFKFFTIVTLLLITLFTCSIISDSF-NKMTRIRKNFL 212

Query: 219 FVAF-GLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGA 277
            +A+  L  L+P +  I+++G  +   RI +  +ILE   Y FG  + + + PER    +
Sbjct: 213 LLAYIILLTLMPSLFAILRFGLAKVLERISLNLIILEIFIYAFGLTIRTSQLPERFF-NS 271

Query: 278 FDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHT 312
           FDF+G+S  ++ + +++ +  H   LMNSY L+H+
Sbjct: 272 FDFLGNSENVYQLSIIVCSFIHFKILMNSYCLMHS 306

>CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {ON}
           similar to uniprot|Q03419 Saccharomyces cerevisiae
           YDR492w
          Length = 301

 Score =  106 bits (264), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 87/298 (29%), Positives = 145/298 (48%), Gaps = 21/298 (7%)

Query: 32  IEPVNTQKKLLYTWNEIPDWQK--DNEHIVGGYVRETNSI-RECLQSLLYLHNESINIYT 88
           +E    Q K++ T  ++P W +   N  I  GY   TN+    CLQ L+  +N+SI+IY 
Sbjct: 1   MEKKTVQSKIV-TLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYM 59

Query: 89  HFLPGLCFLATCIF--DKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSS 146
           + + GL      +F  D   I +  +TT  DY+ I+ F     +     +     K HS 
Sbjct: 60  NLVCGLISGVMLLFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLGQLLKGHSE 119

Query: 147 RVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCT-IASFDDT 205
                 N+   L +V+L+ CS++++LYYAF D   LF  F +I  C  +S T I   +D 
Sbjct: 120 YQGKLWNQAKQLALVLLLTCSIVTLLYYAFFDHVFLFKLF-VIWTCLLMSITSIVIINDQ 178

Query: 206 FRSREWRPYRAGLFVAFG-LSALLPIMGGIIKYGFHETWTRIQMKWVIL--EGIFYIFGA 262
           ++    R  +    V FG LS  LPI   IIK+G  +++ + ++ + +L  E + Y   A
Sbjct: 179 YK----RVQKLSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSA 234

Query: 263 FLYSIRFPERLAPG------AFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314
            L   R PE             D++G+S Q+  ++ + A + H   ++ +YE+VH ++
Sbjct: 235 MLQLTRLPELTLSTLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVHASI 292

>Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 76.6 bits (187), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 78/291 (26%), Positives = 131/291 (45%), Gaps = 30/291 (10%)

Query: 32  IEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFL 91
           +E   T+K   + ++++  WQK          +  +S  E L +L+YL           +
Sbjct: 34  VETKETKKG--FPFHDLAKWQKQ--------YKNKSSRSESLVALIYLLGS--------M 75

Query: 92  PGLCFLATCIF--DKFAIKNFDTTTWI-DYMAIDFFFFGAFSCLILSSTFHCFKSHSSRV 148
              C L   IF  D + I  F TTT + DY+  +F+    F   ++   +H  K+ S + 
Sbjct: 76  SSFCLL---IFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMIHFIYHFIKNISLQQ 132

Query: 149 SV-FGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFR 207
            +    K  YL  + L++ S I+ILYY F+D    F  FTL++   G++       D   
Sbjct: 133 HIEIWQKFSYLANINLLISSQITILYYLFYDYVFFFKIFTLLMTFIGLAAYFVILTDKLN 192

Query: 208 SREWRPYRAGLFVAFGLSAL-LPIMGGIIKY-GFHETWTRIQMKWVILEGIFYIFGAFLY 265
           S + R  +   F++  +    LP++  II + G      RI++  +  E +  +  + +Y
Sbjct: 193 SYK-RFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKDRIKLNAITWELVTLVVASMIY 251

Query: 266 SIRFPERLAPGAFDFVG--HSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314
             RFPE L        G  HS   FH+L+   A  H   L+ SY L+H++L
Sbjct: 252 VTRFPESLCRRNEKEEGWNHSEYFFHLLISGTAFYHFFILIQSYILMHSSL 302

>Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 74.3 bits (181), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/297 (25%), Positives = 133/297 (44%), Gaps = 28/297 (9%)

Query: 26  EQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESIN 85
           E T   ++    + K  + ++++  WQ+          R  +S  E L +L+YL      
Sbjct: 26  ETTNSNVDAETKEIKKGFPFHDLAKWQQQ--------YRNKSSRNESLVALIYLLGS--- 74

Query: 86  IYTHFLPGLCFLATCIF--DKFAIKNFDTTTWI-DYMAIDFFFFGAFSCLILSSTFHCFK 142
                +   C L   IF  D + I  F TTT + DY+  +F+    F   ++   +H  K
Sbjct: 75  -----MSSFCLL---IFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFVYHFIK 126

Query: 143 SHSSRVSV-FGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIAS 201
           + S +  +    K  YL  + L++ S I+ILYY F+D    F  FTL++   G+      
Sbjct: 127 NISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFI 186

Query: 202 FDDTFRSREWRPYRAGLFVAFGLSAL-LPIMGGIIKY-GFHETWTRIQMKWVILEGIFYI 259
             D   S + R  +   F++  +    LP++  II + G      RI++K +  E +  +
Sbjct: 187 LTDKLNSSK-RFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVKAITCELVALV 245

Query: 260 FGAFLYSIRFPERL--APGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314
             + +Y  RFPE L       +   HS  +FH+++   A  H   L+ SY L+H++L
Sbjct: 246 AASIIYVTRFPESLFRRNKKEESWNHSEYLFHLVISGTAFYHFFILIQSYILMHSSL 302

>Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 113/243 (46%), Gaps = 9/243 (3%)

Query: 80  HNESINIYTHFLPGLCFLATCIF--DKFAIKNFDTTTWI-DYMAIDFFFFGAFSCLILSS 136
            NES+    + L  +      IF  D + I  F TTT + DY+  +F+    F   ++  
Sbjct: 61  RNESVVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHF 120

Query: 137 TFHCFKSHSSRVSV-FGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGV 195
            +H  K+ S +  +    K  YL  + L++ S I+ILYY F+D    F  FTL++   G+
Sbjct: 121 IYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGL 180

Query: 196 SCTIASFDDTFRSREWRPYRAGLFVAFG-LSALLPIMGGIIKY-GFHETWTRIQMKWVIL 253
                   D   S + R  +   F++   +   LP++  II + G      RI++  +  
Sbjct: 181 VAYFFILTDKLISSK-RFNKTVFFISVSVICCSLPLLTAIITFDGLENLKERIKVNAITW 239

Query: 254 EGIFYIFGAFLYSIRFPERLAPGAFDFVG--HSHQIFHVLVVIAALCHLVALMNSYELVH 311
           E +  +  + +Y  RFPE    G     G  HS  +FH+++  AA  H   L+ SY L+H
Sbjct: 240 ELVALVAASIIYVTRFPELFLRGKKKEEGWNHSEYLFHLIISGAAFYHFFILIQSYILMH 299

Query: 312 TNL 314
           ++L
Sbjct: 300 SSL 302

>YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}
           IZH4Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by fatty acids and altered zinc levels; deletion
           reduces sensitivity to excess zinc; possible role in
           sterol metabolism
          Length = 312

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 112/243 (46%), Gaps = 9/243 (3%)

Query: 80  HNESINIYTHFLPGLCFLATCIF--DKFAIKNFDTTTWI-DYMAIDFFFFGAFSCLILSS 136
            NES+    + L  +      IF  D + I  F TTT + DY+  +F+    F   ++  
Sbjct: 61  RNESLVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHF 120

Query: 137 TFHCFKSHSSRVSV-FGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGV 195
            +H  K+ S +  +    K  YL  + L++ S I+ILYY F+D    F  FTL++   G+
Sbjct: 121 IYHFVKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGL 180

Query: 196 SCTIASFDDTFRSREWRPYRAGLFVAFGLSAL-LPIMGGIIKY-GFHETWTRIQMKWVIL 253
                   D   S + R  +   F++  +    LP++  II + G      RI++  +  
Sbjct: 181 VAYFFILTDKLISSK-RFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVNAITW 239

Query: 254 EGIFYIFGAFLYSIRFPERLAPGAFDFVG--HSHQIFHVLVVIAALCHLVALMNSYELVH 311
           E +  +  + +Y  RFPE L        G  HS  +FH+L+   A  H   L+ SY L+H
Sbjct: 240 ELVALVAASIIYVTRFPESLFRRNKKEEGWNHSEYLFHLLISGTAFYHFFILIQSYILMH 299

Query: 312 TNL 314
           ++L
Sbjct: 300 SSL 302

>AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR023C
          Length = 419

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 78/323 (24%), Positives = 134/323 (41%), Gaps = 66/323 (20%)

Query: 40  KLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYL---HNESINIYTHFLPG--L 94
           + L+ W E+P   ++N +I+ G+ R  +S R+ L S+L     HNE+INI++H +    L
Sbjct: 103 RHLHYW-ELPYAWRENRYIIYGH-RFYHSHRKSLLSVLNAYGWHNETINIWSHLVGAAVL 160

Query: 95  CFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKS--HSSRVSVFG 152
            +L    + +  +        +   AI  F      C+  S  +H F    H    S F 
Sbjct: 161 AYLLCWGWPRSDVYRAAQVPRLAKWAIGAFLACGVKCMASSVAWHTFNGTCHLKLRSRF- 219

Query: 153 NKLDYLGIVILIVCSMISILYYAFHD-SNKLFYSFTLIIFCFGVSCTIASFDDTFRSREW 211
             +DY GI +L+  S+++ +    +  S  L Y++ +     G +  + ++   F   E 
Sbjct: 220 VCVDYTGITLLVTASVVTTVAVTLYGLSRPLMYAYMVASIGLGTAAGVMNWSPHFDRPEA 279

Query: 212 RPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKW---------VILEGIFYIFGA 262
           RP R  ++V  GL+AL     G++   F   W  +Q++W         V    ++Y  G 
Sbjct: 280 RPLRIAVYV--GLAAL-----GLVS--FVHVW--MQVRWASAHLMAPLVYKSLVWYGIGV 328

Query: 263 FLYSIRFPER------------------------LAPGA-----------FDFVGHSHQI 287
             Y+   PER                        L P A            D+  HSH +
Sbjct: 329 VFYATLVPERWRSDVTLDCCSGPVHEAACRQFRDLPPVARKDRQFWSLWWVDYFCHSHFL 388

Query: 288 FHVLVVIAALCHLVALMNSYELV 310
           +HV VV+  + H  A++    +V
Sbjct: 389 WHVFVVLGVVGHYRAVLQMSRIV 411

>TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {ON}
           Anc_5.197 YLR023C
          Length = 569

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 106/240 (44%), Gaps = 23/240 (9%)

Query: 47  EIPDWQKDNEHIVGGYVRETNSIRECLQSLLY---LHNESINIYTHFLPG--LCFLATCI 101
           E+P   ++N++I+ GY R  +   + + S+     +HNE+ NI+TH L    L +L T  
Sbjct: 248 ELPFPWRENKYIIHGY-RFHDKFYQLILSVFNWYGVHNETTNIWTHMLAAFYLIYLLTVD 306

Query: 102 FDK-FAIKNFD----TTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSS-RVSVFGNKL 155
           F K F + + +    TT +I YM    F      C+  S  +H F   +S R+      +
Sbjct: 307 FQKTFIVLDTEHVPATTKYIIYM----FLGAGIKCMFASVFWHTFNGTTSIRLRPKFCCV 362

Query: 156 DYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYR 215
           DY GI +LI  S++S  Y   +D  K    + ++   F V     ++   F S E RP R
Sbjct: 363 DYTGITLLISASIMSAEYITLYDYPKAMSFYMILSGIFAVFGLYLNWSPKFDSPEARPLR 422

Query: 216 AGLFVAFGLSALLPIMGGIIKYGFHET---WTRIQMKWVILEGIFYIFGAFLYSIRFPER 272
              FV       L  +  +   G       ++ +  K V    I+YI G F Y    PER
Sbjct: 423 IKFFVLLAAVGGLSFVNLVCLEGLSRAIWLFSPVTNKSV----IYYIIGVFFYGSFIPER 478

>KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5.197
           YLR023C
          Length = 509

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 86/178 (48%), Gaps = 6/178 (3%)

Query: 47  EIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLATCIFDKFA 106
           ++P   ++N +I+  Y R  +S ++ L S+  LHNE+ NI++H L  + FL   +F    
Sbjct: 197 QLPFPYRENRYIINNY-RFYDSHKKSLLSIFKLHNEATNIWSHLLGAIYFLY-VLFHDLP 254

Query: 107 IKNFDTTTWIDYMAIDF---FFFGAFSCLILSSTFHCFKSHSS-RVSVFGNKLDYLGIVI 162
                +++ +   A  F   F F +  C++ S+ +H F   S  ++      +DY GI I
Sbjct: 255 NSIIVSSSMVPTTAKLFLYLFVFASLKCMLSSTFYHTFNGTSMLKLRRKFMCVDYSGISI 314

Query: 163 LIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLFV 220
           LI  S++SI + + +D   +   +    F  GV     ++   F S E RP R   F+
Sbjct: 315 LITSSILSIQFISLYDYPNILKFYMCASFMLGVLGIFMNWSPLFDSPEARPLRIKFFI 372

>KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.197
           YLR023C
          Length = 538

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 73/326 (22%), Positives = 130/326 (39%), Gaps = 63/326 (19%)

Query: 38  QKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYL--HNESINIYTHFLP--G 93
           ++KLL+ + E+P   ++N +I+  Y    ++++  L ++ +   HNE+ NI++HFL    
Sbjct: 213 REKLLHYY-ELPFPWRENRYIIHNYRFYDSNVKSLLSAINWYGWHNETSNIWSHFLGFFY 271

Query: 94  LCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHS-SRVSVFG 152
           + +LA   F +  +   D         +  F F A  CLI S+ +H F   +  ++    
Sbjct: 272 VVYLAVYEFPQSVVFQSDRIPSSAKFVVYIFLFAAMKCLIASAFWHTFNGTAFLKMRRRF 331

Query: 153 NKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWR 212
             +DY GI ILI  S+++  +   +D   +   +  I    G+     +    F + E R
Sbjct: 332 ACVDYSGISILITASILTAEFVTLNDHRPMMILYMTISLTLGIIGVFLNCSPQFDTPEAR 391

Query: 213 PYRAGLFVAFGLSALLPIMG--GIIKYGFHETWT-RIQMKWVILEG--IFYIFGAFLYSI 267
           P R   F+      LL  MG    I   + E+W   + +   I     ++Y+ G   Y  
Sbjct: 392 PLRIRFFM------LLAAMGVLSFINASYLESWAYAVDLLSPITNKSIVWYLVGVVFYGS 445

Query: 268 RFPERLA---------PGAF-------------------------------------DFV 281
             PER           P  F                                     D+V
Sbjct: 446 FIPERFRTDVVVDDRIPTTFQLGTDLDIITKDKEIHFRHKPTCCHHPRKGIFSCWWVDYV 505

Query: 282 GHSHQIFHVLVVIAALCHLVALMNSY 307
           G SH  +H+ VV+  + H  A+++ +
Sbjct: 506 GCSHTFWHIFVVLGVVGHYKAIIDMF 531

>Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AAL153C
          Length = 568

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 105/237 (44%), Gaps = 17/237 (7%)

Query: 47  EIPDWQKDNEHIVGGYVRETNSIRECLQSLLYL---HNESINIYTHFLPGLCFLATCI-- 101
           E+P   ++N +I+ G+ R  +S ++ L S+L +   HNE+INI++H    +  L   +  
Sbjct: 244 ELPQPWRENPYIIYGH-RFYHSHKKSLLSILNVYGWHNETINIWSHIAGAIILLYIMLRG 302

Query: 102 FDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKS--HSSRVSVFGNKLDYLG 159
           F    + N      +   AI  F      C++ S  +H F    H    S F + +DY G
Sbjct: 303 FPNSDVFNSTQVPKVAKGAIYVFLLCGIKCMVSSVMWHTFSGTCHLPLRSRF-SCVDYTG 361

Query: 160 IVILIVCSMISILYYAFHD-SNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGL 218
           I ILI  S+++   +  +  + K  Y +  I  C GV     ++   F   + R +R   
Sbjct: 362 ITILITASVMTTEAFTLYRLAPKAMYLYMGISLCLGVFAAFTNWSRRFDGPDSRIFRVAF 421

Query: 219 FVAFGLSALLPIMGGIIKYGFHETW--TRIQMKWVILEGI-FYIFGAFLYSIRFPER 272
           +V      L+      +    H  W  +R+ +  +I + I +Y+ G   Y+   PER
Sbjct: 422 YVILAGLGLI----SFVHLTVHSDWSSSRLMITPLINKSIVWYLIGVVFYATLVPER 474

>Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON}
           (229517..231250) [1734 nt, 578 aa]
          Length = 577

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 66/278 (23%), Positives = 123/278 (44%), Gaps = 42/278 (15%)

Query: 47  EIPDWQKDNEHIVGGYVRETNSIRECLQSLLY---LHNESINIYTHFLPGLCFLATCIFD 103
           ++P   ++N +I+ GY R  +   + L S+      HNE+ NI++H L  + F    +F+
Sbjct: 255 QLPFPWRENRYIINGY-RFYHKNSKLLLSVFNWYGFHNETANIWSHLLGAIYFAYIVLFE 313

Query: 104 ---KFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSS-RVSVFGNKLDYLG 159
               F +++ +      Y+ +  F      C++ S  +H F    S ++      +DY G
Sbjct: 314 FPKSFIVQSPEVPPSAKYI-VYLFLLAGIKCMLASVFWHTFNGTCSIKLRPKYCCVDYSG 372

Query: 160 IVILIVCSMISILYYAFHDSNKL---FYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRA 216
           I ILI  S+++  + + +D   +   + S +L+  CFG+     ++   F S E RP R 
Sbjct: 373 ITILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGL---YLNWSPKFDSPEARPLRI 429

Query: 217 GLFVAFGLSALLPIMGGI-------IKYGFHETW--TRIQMKWVILEGIFYIFGAFLYSI 267
             F+      LL  +GG+       ++   +  W  + +  K +    ++Y+ G F Y  
Sbjct: 430 KFFI------LLAALGGLAFFHVAYLEGMAYAAWLYSPVTSKSI----VWYLIGVFFYGS 479

Query: 268 RFPERLAPGAFDFV-----GHSHQIFHVLVVIAALCHL 300
             PER      DFV      +S Q+   + +I    H+
Sbjct: 480 FIPERFRS---DFVIDKSIPNSKQLASDVTIITKHKHV 514

>KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some
           similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 622

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 60/283 (21%), Positives = 112/283 (39%), Gaps = 35/283 (12%)

Query: 47  EIPDWQKDNEHIVGGYVRETNSIRECLQSLLYL--HNESINIYTHFLPGLCFLATCIFDK 104
           E+P   ++N +I+ GY    + ++  L  + +   HNE++NI++H   G  +LA  +F +
Sbjct: 303 ELPFPWRENRYIIHGYRFYDSHVKSVLSVVNWYGWHNETLNIWSHLF-GAVYLAYLLFIQ 361

Query: 105 FAIKNF---DTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSS-RVSVFGNKLDYLGI 160
                            + I  F      CL+ SS +H         +      +DY GI
Sbjct: 362 LPTTKVFMSQDVPLFGKLIIQVFLIAGVKCLLSSSVWHTLNGTCCLPLRCKFACIDYTGI 421

Query: 161 VILIVCSMISILYYAFHD--SNKLFYSFTLII---FCFGVSCTIASFDDTFRSREWRPYR 215
            +LI  S++S  + + ++  +  L  S T+ +    C G+  +  ++   F   E RP+R
Sbjct: 422 TVLITASILSTEFVSVYNLATQSLSTSMTVYMSLSLCLGIFGSFMNWSPRFDRPESRPFR 481

Query: 216 AGLFVAFGLSALLPIMGGIIKYG-------FHETWTRIQMKWVILEGIFYIFGAFLYSIR 268
              +V      ++  +   I  G       F   W R          I+Y+ G   Y   
Sbjct: 482 IAFYVLLAGLGMISFLHLTISRGIDHSSQFFKPVWNR--------SLIWYLIGVVFYGSF 533

Query: 269 FPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVH 311
            PER             ++ + +   A LC  + ++  ++ VH
Sbjct: 534 IPERWRTDV--------ELDYTIPTDAELCSNLDILTKHKHVH 568

>SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]
           {ON} some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 563

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 70/252 (27%), Positives = 113/252 (44%), Gaps = 40/252 (15%)

Query: 47  EIPDWQKDNEHIVGGYVRETNSIRECLQSLLYL---HNESINIYTHFLPGLCFLATCIFD 103
           E+P   ++N  I+ GY R  +S  + L S+L     HNE+ NI+TH   G  ++A   F 
Sbjct: 236 ELPFPWRENRFIIHGY-RFYHSHTKSLLSILNWYGWHNETTNIWTHLF-GSLYIAYLAFY 293

Query: 104 KFAIKNF----DTTTWIDYMAIDFFFFGA-FSCLILSSTFHCF----KSH-SSRVSVFGN 153
           +F   +     D   +  YM   + F GA F CL+ S T+H F    K H  S+ +    
Sbjct: 294 EFPQSSVYLSGDVPQFAKYMV--YLFLGAGFKCLVSSVTWHTFNGTCKLHLRSKFAC--- 348

Query: 154 KLDYLGIVILIVCSMIS---ILYYAFHDSNKLFYSFTLIIF--------CFGVSCTIASF 202
            +DY GI +LI  S+++   +  Y   D+     +F+LI +        CFGV     ++
Sbjct: 349 -MDYTGITVLITASIMTAEFVSLYGNGDNPNSPVTFSLIFYMAVSSVLCCFGV---FMNW 404

Query: 203 DDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGF-HETWTRIQMKWVILEGI-FYIF 260
              F   E RP R   ++       L  +   +   F H +W    ++ V+ + + +Y+ 
Sbjct: 405 SPRFDRPESRPLRIAFYLLLAGMGFLAFLHLTLITNFAHSSWL---IRPVLDKSVCWYLI 461

Query: 261 GAFLYSIRFPER 272
           G   Y    PER
Sbjct: 462 GVIFYGSFIPER 473

>TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON}
           Anc_5.197 YLR023C
          Length = 437

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 102/239 (42%), Gaps = 22/239 (9%)

Query: 47  EIPDWQKDNEHIVGGYVRETNSIRECLQSLLYL---HNESINIYTHFLPG---LCFLATC 100
           ++P   ++N +I+ GY R  +S  +CL S++     HNE++NI++H L G   L ++A  
Sbjct: 118 QLPFPWRENRYIIKGY-RFYDSNVKCLLSVVNYYGWHNETLNIWSH-LGGFLTLLYIAVF 175

Query: 101 IFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNK---LDY 157
           ++    +   +       M +  F      C++ S  +H F    S       K   +DY
Sbjct: 176 VYPNTEVYQSELIPTTAKMLLFVFLIAGMKCMLASVFWHTFDGTCSYT--LRPKFCCVDY 233

Query: 158 LGIVILIVCSMISILYYAFHDSNK---LFYSFTLIIFCFGVSCTIASFDDTFRSREWRPY 214
            GI ILI  S+++  Y +   +     ++ S +L +  FGV     ++   F   E RP 
Sbjct: 234 TGITILITASILTAEYVSLSHAPIWMFIYMSLSLALGTFGV---YINWSPKFDGPEARPL 290

Query: 215 RAGLFVAFGLSALLPIMGGIIKYGF-HETWTRIQMKWVILEGIFYIFGAFLYSIRFPER 272
           R   FV       L  +  I      H  W    +  +    I+Y+ G F Y    PE+
Sbjct: 291 RIKFFVTLSAMGCLSFVHLIFTTSLRHACWLLAPI--ISKSTIWYVIGVFFYGSFIPEK 347

>NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.197
           YLR023C
          Length = 543

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 98/239 (41%), Gaps = 22/239 (9%)

Query: 47  EIPDWQKDNEHIVGGYVRETNSIRECLQSLLYL---HNESINIYTHFLPGLCFLATCIFD 103
           ++P   ++N +I+  Y R  +S ++ L S+      HNE+ NI+TH + GL  +   ++D
Sbjct: 220 QLPFPWRENRYIIYNY-RFYDSHKKSLLSIFNWYGWHNETSNIWTHLIGGLYLIYMAVYD 278

Query: 104 --KFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSS-RVSVFGNKLDYLGI 160
             +  I   D       + +  F F A  CL  S  +H F    + ++      +DY GI
Sbjct: 279 FPRSEIFLSDKIPTTAKLIVYLFLFAAIKCLFASVFWHSFNGTCTLKLRSKFACVDYSGI 338

Query: 161 VILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLFV 220
            ILI  S+++  +   + S +    +  I    G+     ++   F   E RP R   FV
Sbjct: 339 SILITASILTTEFVTLYSSYRAMCVYMAISLSLGIFGVFMNWSPKFDRPEARPLRIKFFV 398

Query: 221 AFGLSALLPIMG--GIIKYGFHETWTRIQMKWVILEG-----IFYIFGAFLYSIRFPER 272
                 LL  MG    +   F   W      W++        ++Y  G   Y    PER
Sbjct: 399 ------LLASMGVLSFLHLTFLTDWK--YATWLLAPVTNKSIVWYCIGVVFYGSFIPER 449

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 99/240 (41%), Gaps = 24/240 (10%)

Query: 47  EIPDWQKDNEHIVGGYVRETNSIRECLQSLLYL---HNESINIYTHFLPGLCFLATCIFD 103
           ++P   ++N +I+ GY R  N+  + L S+      HNE+ NI++H L  +  +   I+D
Sbjct: 220 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAIYIIYLAIYD 278

Query: 104 KFAIKNFDTTT------WIDYMAIDFFFFGAFSCLILSSTFHCFKSHS--SRVSVFGNKL 155
               + +  +       WI +M    F   A  C++ S  +H F   S     S F   +
Sbjct: 279 FPQSEVWRNSQVPPQARWIVFM----FLAAALKCMLSSVFWHTFNGTSFLKLRSKFAC-V 333

Query: 156 DYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYR 215
           DY GI ILI  S+++  +   +      Y++  I    GV     ++   F   E RP R
Sbjct: 334 DYSGITILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLR 393

Query: 216 AGLFVAFGLSALLPIMGGIIKYGFHETWT---RIQMKWVILEGIFYIFGAFLYSIRFPER 272
              F+      +L  +  I     H   T    +  K V    ++Y+ G   Y    PER
Sbjct: 394 IRFFILLATMGVLSFLHLIFLTDLHYAATLFSPVTYKSV----VWYLVGVVFYGSFIPER 449

>NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197
          Length = 578

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 69/278 (24%), Positives = 111/278 (39%), Gaps = 38/278 (13%)

Query: 24  NQEQTTIKIEPVNTQKKLLYTWN----------------EIPDWQKDNEHIVGGYVRETN 67
           N E  T   EP    K ++Y++N                ++P   ++N +I+  Y R  +
Sbjct: 215 NLEHFTPLSEPSEELKNVIYSFNHPTAFQLGKNDHLHYYQLPFPWRENRYIIYNY-RFYD 273

Query: 68  SIRECLQSLLYL---HNESINIYTHFLPGLCFLATCIFD-----KFAIKNFDTTTWIDYM 119
           S ++ L S+      HNES NI+TH L  +  +   I+D      F  +   TT     +
Sbjct: 274 SHKKSLLSIFNWYGWHNESSNIWTHLLGAIYLIYLSIYDFPNSEIFQSEKVPTTA---KL 330

Query: 120 AIDFFFFGAFSCLILSSTFHCFKSHS--SRVSVFGNKLDYLGIVILIVCSMISILYYAFH 177
            +  F F A  CL+ S  +H F   S     S F   +DY GI ILI  S+++  +   +
Sbjct: 331 IVYLFLFAAIKCLLASVFWHTFNGTSFLKLRSKFAC-VDYSGITILITASILTTEFVTMY 389

Query: 178 DSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKY 237
            S      +  I    G+     ++   F   E RP R   F+      +L  +      
Sbjct: 390 SSFFAMCIYMTISLSLGMFGVFMNWSPKFDRPEARPLRIKFFILLASMGVLSFLHLTYLT 449

Query: 238 GF-HETW--TRIQMKWVILEGIFYIFGAFLYSIRFPER 272
              + TW  T +  K +    ++Y+ G   Y    PER
Sbjct: 450 NLQYATWLLTPVTNKSI----VWYLVGVVFYGSFIPER 483

>Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023C -
           Hypothetical ORF [contig 94] FULL
          Length = 566

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 103/241 (42%), Gaps = 21/241 (8%)

Query: 47  EIPDWQKDNEHIVGGYVRETNSIRECLQSLLYL---HNESINIYTHFLPGLCFLATCIFD 103
           E+P   ++N  I+ GY R  NS ++ L S+      HNE++NI+TH L G  +LA  +F 
Sbjct: 239 ELPFPWRENRFIIHGY-RFYNSYKKSLLSIFNWYGWHNETVNIWTH-LGGALYLAYLLFR 296

Query: 104 KFAIKNFDTTTWIDYMA--IDF-FFFGAFSCLILSSTFHCFKS--HSSRVSVFGNKLDYL 158
            F+      +  +   A  + F F      C + S  +H F    H  + S     +DY 
Sbjct: 297 GFSQTAVYQSELVPTAAKCMAFVFLLSGLECFLFSVVWHTFNGICHLQQRSNCAC-VDYT 355

Query: 159 GIVILIVCSMISILYYAFHDSNKLFYSFTLIIFC-----FGVSCTIASFDDTFRSREWRP 213
           GI IL+  S+++  +     + +  ++++L+ F       GV     ++   F   E RP
Sbjct: 356 GITILVTASILTTEFVTLSGAAEAPFTWSLLFFTTTSSILGVIGVYMNWSPKFDRPESRP 415

Query: 214 YRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEG--IFYIFGAFLYSIRFPE 271
            R   ++          +   I   FH + +  ++   +L     +Y+ G   Y    PE
Sbjct: 416 LRIAFYLLLASFGFFSYLHSRI---FHTSISSSELIKPVLSKSLAWYLIGVVFYGTFIPE 472

Query: 272 R 272
           R
Sbjct: 473 R 473

>TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {ON}
           Anc_5.197 YLR023C
          Length = 450

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 106/243 (43%), Gaps = 30/243 (12%)

Query: 47  EIPDWQKDNEHIVGGYVRETNSIRECLQSLLYL---HNESINIYTHFLPGLCFLATCIFD 103
           ++P   ++N  I+ GY R  +S  + L S++     HNE+ NI+TH    L  L   ++D
Sbjct: 136 QLPFPWRENRFIIHGY-RFYDSHYKSLLSIVNWYGWHNETANIWTHLGGALYVLWLAVYD 194

Query: 104 --KFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHS--SRVSVFGNKLDYLG 159
             + ++   +    +    +  F   A  C++ S   H F      +  S F   +DY G
Sbjct: 195 FPRTSVWESEQVPMVAKCIVYVFLAAALKCMLASVFGHTFNGTCCLALRSKFAC-VDYSG 253

Query: 160 IVILIVCSMIS---ILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRA 216
           I +LI  S+++   +  Y +  S + + + + ++  FGV   I ++   F   E RP R 
Sbjct: 254 ITMLITASILTTEFVTMYNYPWSLRFYLAVSTVLGIFGV---IMNWSPKFDRPEARPLRI 310

Query: 217 GLFVAFGLSALLPIMGGI--IKYGFHETWTRIQMKWVILEG-----IFYIFGAFLYSIRF 269
             F+      LL  MGG+  ++ G    W      W++        ++Y+ G   Y    
Sbjct: 311 KFFI------LLAAMGGLSFMQLGLLGGWK--YASWLMAPVTHKSLVWYLLGVAFYGSFV 362

Query: 270 PER 272
           PER
Sbjct: 363 PER 365

>KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 546

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 90/206 (43%), Gaps = 23/206 (11%)

Query: 35  VNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYL---HNESINIYTHFL 91
           +  Q+ L Y   E+P   ++N  I+ GY R  NS  + L S+      HNE++NI+TH L
Sbjct: 209 LGQQRHLHYY--ELPFPWRENRFIIHGY-RFYNSYSKSLLSIFNWYGWHNETVNIWTH-L 264

Query: 92  PGLCFLATCIFDKFAIKNFDTT----TWIDYMAIDFFFFGAFSCLILSSTFHCFKS--HS 145
            G  + A  IF  F+      +    T   +MA  F   G   C + S  +H F    H 
Sbjct: 265 CGALYFAFLIFKGFSQTTVYQSELVPTAAKFMAFVFLTAG-LECFLFSVVWHTFNGICHL 323

Query: 146 SRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIF-----CFGVSCTIA 200
            + S     +DY GI +L+  S+++  +     S+   ++++L+ F       G      
Sbjct: 324 KQRSNCAC-VDYTGITVLVTASILTTEFVTLSGSSDATFTWSLLFFTGASAALGAVGVFM 382

Query: 201 SFDDTFRSREWRPYRAG---LFVAFG 223
           ++   F   E RP R     L  +FG
Sbjct: 383 NWSPKFDRPESRPLRIAFYLLLASFG 408

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 98/236 (41%), Gaps = 16/236 (6%)

Query: 47  EIPDWQKDNEHIVGGYVRETNSIRECLQSLLYL---HNESINIYTHFLPGLCFLATCIFD 103
           ++P   ++N +I+ GY R  N+  + L S++     HNE+ NI++H L  +  +   I+D
Sbjct: 219 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIINWYGWHNETSNIWSHLLGAMYIIYLAIYD 277

Query: 104 ---KFAIKNFDT---TTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHS-SRVSVFGNKLD 156
                  +N +      WI +M    F   A  C++ S  +H F   S  R+      +D
Sbjct: 278 FPQSEVWRNPNVPQQARWIVFM----FLAAALKCMLSSVFWHTFNGTSFLRLRSKFACVD 333

Query: 157 YLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRA 216
           Y GI ILI  S+++  +   +       ++  I    GV     ++   F   E RP R 
Sbjct: 334 YSGITILITASILTTEFVTMYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRPEARPLRI 393

Query: 217 GLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPER 272
             F+      +L  +  I     +   +R+         ++Y+ G   Y    PER
Sbjct: 394 RFFILLATMGVLSFLHLIFLTDIYYA-SRLFGPVTYKSVVWYLVGVVFYGSFIPER 448

>Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {ON}
           YLR023C (REAL)
          Length = 541

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 98/240 (40%), Gaps = 24/240 (10%)

Query: 47  EIPDWQKDNEHIVGGYVRETNSIRECLQSLLYL---HNESINIYTHFLPGLCFLATCIFD 103
           ++P   ++N +I+ GY R  N+  + L S++     HNE+ NI+TH L  +  +   ++D
Sbjct: 219 QLPFPWRENRYIIHGY-RFYNTHYKSLLSVINWYGWHNETSNIWTHLLGAMYIVYLAVYD 277

Query: 104 ---KFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNK-----L 155
                  +N +      ++   F    A  C++ S  +H F       S  G +     +
Sbjct: 278 FPHSEVWQNPEVPQQARWIVFAFLA-AALKCMLSSVFWHTFNG----TSFLGLRSKFACV 332

Query: 156 DYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYR 215
           DY GI ILI  S+++  +   +       ++  I    GV     ++   F   E RP R
Sbjct: 333 DYSGITILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPEARPLR 392

Query: 216 AGLFVAFGLSALLPIMGGIIKYGFH-ETW--TRIQMKWVILEGIFYIFGAFLYSIRFPER 272
              F+      +L  +  I     H   W  + +  K V    ++Y+ G   Y    PER
Sbjct: 393 IRFFILLATMGVLSFLHLIFLTDLHYAIWLFSPVTNKSV----VWYLVGVVFYGSFIPER 448

>Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 97/241 (40%), Gaps = 26/241 (10%)

Query: 47  EIPDWQKDNEHIVGGYVRETNSIRECLQSLLYL---HNESINIYTHFLPGLCFLATCIFD 103
           ++P   ++N +I+ GY R  N+  + L S+      HNE+ NI++H L  +  +   I+D
Sbjct: 219 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAMYLIYLAIYD 277

Query: 104 ---KFAIKNFDTTT---WIDYMAIDFFFFGAFSCLILSSTFHCFKSHS--SRVSVFGNKL 155
                  KN        WI +M    F   A  C++ S  +H F   S     S F   +
Sbjct: 278 FPQSEVWKNPKVPPQARWIVFM----FLAAALKCMLSSVFWHTFNGTSFLKLRSKFAC-V 332

Query: 156 DYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYR 215
           DY GI ILI  S+++  +   +       ++  I    G+     ++   F   E RP R
Sbjct: 333 DYSGITILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDRPEARPLR 392

Query: 216 AGLFVAFGLSALLPIMGGI----IKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPE 271
              F+      +L  +  I    ++Y       R+         ++Y+ G   Y    PE
Sbjct: 393 IRFFILLATMGVLSFLHLIFLTDLRYA-----ARLFSPVTYKSVVWYLVGVAFYGSFIPE 447

Query: 272 R 272
           R
Sbjct: 448 R 448

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 98/236 (41%), Gaps = 16/236 (6%)

Query: 47  EIPDWQKDNEHIVGGYVRETNSIRECLQSLLYL---HNESINIYTHFLPGLCFLATCIFD 103
           E+P   ++N  I+ GY R  NS ++ L S++     HNE+ NI+TH L G  ++   +F 
Sbjct: 218 ELPFPWRENRCIINGY-RFYNSHKKSLLSIVNWYGWHNETSNIWTHLL-GGLYILYLMFY 275

Query: 104 KFAIKNFDTTTWIDYMA---IDFFFFGAFSCLILSSTFHCFKSHSS-RVSVFGNKLDYLG 159
           +F       +  +   A      F   A  CL  S  +H F   S  R+      +DY G
Sbjct: 276 QFPSSEVFMSEQVPKAAKLITYVFLIAAAKCLFSSVFWHTFNGTSLLRLRCKFACVDYSG 335

Query: 160 IVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLF 219
           I ILI  S+++  +   +       S+  +    G+     ++   F   E RP R   F
Sbjct: 336 ISILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEARPLRIKFF 395

Query: 220 VAFGLSALLPIMG-GIIKYGFHETW--TRIQMKWVILEGIFYIFGAFLYSIRFPER 272
           +      +L  +    I    H TW  + I  K V    ++Y+ G   Y    PER
Sbjct: 396 ILLASMGILSFLHLTFITSLSHSTWLLSPITKKSV----VWYLVGVVFYGSFIPER 447

>ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 531

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 99/238 (41%), Gaps = 20/238 (8%)

Query: 47  EIPDWQKDNEHIVGGYVRETNSIRECLQSLLYL---HNESINIYTHFLPGLCFLATCIFD 103
           ++P   ++N++I+ GY R   S ++   S++     HNE+ NI+TH L GL  +    + 
Sbjct: 209 QLPFPYRENKYIIHGY-RFYASHKKSFLSIINWYGWHNETSNIWTHLLGGLYLIYLAFY- 266

Query: 104 KFAIKNFDTTTWIDYMA---IDFFFFGAFSCLILSSTFHCFK-SHSSRVSVFGNKLDYLG 159
            F   N   +  +   A   +  F   A  C+  S  +H F  +H  R+      +DY G
Sbjct: 267 HFPHSNIWLSDRVPKPAKCIVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFACVDYTG 326

Query: 160 IVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLF 219
           I ILI  S++++ +   +D       + +     G+     ++   F   E RP R   F
Sbjct: 327 ITILITASILTVEFVTMYDYKISLLFYMICSLALGIIGVSMNWSPKFDRPEARPLRIKFF 386

Query: 220 VAFGLSALLPIMG--GIIKYGFHETWTRIQMKWVILEG---IFYIFGAFLYSIRFPER 272
           +      LL  +G    I+  F   W         L     ++Y+ G F Y    PER
Sbjct: 387 I------LLATVGCSSFIRLVFLTNWRYAADLLTPLTNKSVVWYLIGVFFYGSFIPER 438

>KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 36.6 bits (83), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 92/213 (43%), Gaps = 24/213 (11%)

Query: 103 DKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYLGIVI 162
           D + +    +TT  DY+ ++ F   AF C        CF + +      G+ L  + ++ 
Sbjct: 115 DVYLVPRHVSTTMTDYVLLNVFLATAFQCAACH-MVQCFTTTA------GSVLSTITMLN 167

Query: 163 LIVCSMISILYYAFHDSNKLFYSFTLIIFCFG-----VSCTIASFDDTFRSREWRPYRAG 217
              CS +++LYY+++D+  +FY   L +F         + T+ S       R+W   R  
Sbjct: 168 HWACSAVTLLYYSYYDN--VFYFKLLALFTANWTLVVAAVTVTSTASNSPKRQWWSRRTL 225

Query: 218 LFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGA 277
           L V   +   +P++ G++++G  +   R+  + ++ E   Y+     Y     + L    
Sbjct: 226 LLVYVVVLVSVPLVVGLLRFGTAKVLRRLDWRLLLAELAVYLISGVFYGGTEKDTLPKLP 285

Query: 278 FDFVGHSHQIFHVLVVIAALCHLVALMNSYELV 310
           F    H+          A+L HL  L+N++ L+
Sbjct: 286 FYVAFHT----------ASLIHLQLLLNAFHLM 308

>TDEL0H03830 Chr8 (646726..651474) [4749 bp, 1582 aa] {ON} Anc_7.68
            YAL029C
          Length = 1582

 Score = 31.6 bits (70), Expect = 3.6,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 5/102 (4%)

Query: 128  AFSCLILSSTFHCFKSHSSRV--SVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYS 185
            A   +I+S +   FK+   +   ++FG+  +Y    IL   +MI     +FH  N++F  
Sbjct: 1319 AVPAVIVSESLPGFKNDPGKFLSNLFGSSPEYNMDDILTFFNMIYWCMKSFHVENEIFRE 1378

Query: 186  FTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLFVAFGLSAL 227
              LI+  F  S     F+D    R +  ++ GL + + ++ L
Sbjct: 1379 TVLILLNFVDSIC---FNDLIMRRNFLSWKRGLQLNYNVTRL 1417

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.143    0.458 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,167,150
Number of extensions: 1414410
Number of successful extensions: 4220
Number of sequences better than 10.0: 77
Number of HSP's gapped: 4253
Number of HSP's successfully gapped: 77
Length of query: 319
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 209
Effective length of database: 40,868,139
Effective search space: 8541441051
Effective search space used: 8541441051
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 66 (30.0 bits)