Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07546g6.28ON37737720200.0
Kpol_1037.236.28ON37837912771e-176
TDEL0G044106.28ON38137812711e-175
Suva_15.1726.28ON39837812201e-167
NCAS0D021406.28ON37637912151e-167
CAGL0E02497g6.28ON37637811971e-164
Ecym_30326.28ON37737811891e-163
Skud_15.1596.28ON37937911861e-162
Smik_15.1676.28ON37837811771e-161
YOL003C (PFA4)6.28ON37837811761e-161
SAKL0E01518g6.28ON37938011691e-160
NDAI0C026506.28ON38938911661e-159
TPHA0J003906.28ON38037911031e-149
KLTH0C10978g6.28ON37737910581e-143
ACL003C6.28ON37537810451e-141
KLLA0C06204g6.28ON37737810321e-139
Kwal_56.224596.28ON3833799961e-133
KNAG0F029306.28ON3863869931e-133
KAFR0A051306.28ON3963969661e-128
TBLA0B004806.28ON3774154936e-58
NDAI0G013403.12ON3351422114e-18
NCAS0E013003.12ON3271412115e-18
KAFR0A085903.12ON3311322053e-17
CAGL0D02508g3.12ON3321462053e-17
Kpol_1014.293.12ON3262402036e-17
KNAG0K025703.12ON3281382001e-16
Kwal_55.221263.12ON3601341992e-16
TBLA0H001503.12ON3452101931e-15
KLTH0F19580g3.12ON3421411912e-15
KLLA0E02069g3.12ON325931912e-15
TDEL0F051308.389ON3591531861e-14
TPHA0P015603.12ON331731851e-14
TDEL0A003103.12ON329511851e-14
Smik_14.63.12ON3341751842e-14
SAKL0C13596g3.12ON333681842e-14
SAKL0H13860g8.389ON3521571842e-14
ZYRO0C03410g3.12ON3272071823e-14
Skud_14.153.12ON3361891823e-14
YNL326C (PFA3)3.12ON3361891824e-14
NCAS0C029208.389ON3741461815e-14
Ecym_41788.389ON368941798e-14
Suva_14.153.12ON3301941798e-14
Skud_12.3218.389ON3561511762e-13
Smik_12.3068.389ON359841762e-13
Ecym_20143.12ON339571753e-13
KNAG0A027108.389ON354721753e-13
Skud_4.3878.286ON336631743e-13
ZYRO0C04092g8.389ON366681753e-13
KLLA0D18370g8.389ON3551451753e-13
TPHA0C023608.389ON404611754e-13
YLR246W (ERF2)8.389ON359841744e-13
ADL197C3.12ON3901081745e-13
AGL125C8.389ON3671041735e-13
Suva_2.2898.286ON335751718e-13
KAFR0H019808.389ON361811711e-12
Suva_10.3428.389ON356841701e-12
TBLA0D040408.286ON329861691e-12
KLTH0F08668g8.389ON358631701e-12
NCAS0B035908.286ON329481672e-12
ZYRO0D06600g8.286ON330481663e-12
KAFR0B053708.286ON329661664e-12
Kpol_1033.168.286ON3211161654e-12
Kwal_23.33028.389ON3531321647e-12
Ecym_42828.286ON3401081638e-12
NDAI0G022508.389ON389731631e-11
SAKL0H16434g8.286ON555621632e-11
YDR126W (SWF1)8.286ON336751612e-11
CAGL0B01991g8.286ON330911593e-11
TBLA0H009208.389ON360801585e-11
TDEL0F041308.286ON328911566e-11
KLTH0G13112g8.286ON3491931568e-11
NDAI0J010008.286ON3391081568e-11
CAGL0G08217g8.389ON326501559e-11
KLLA0F19690g8.286ON324661513e-10
Smik_4.3728.286ON335481495e-10
NCAS0F013905.579ON3742981471e-09
TPHA0C010708.286ON333621461e-09
YDR459C (PFA5)5.579ON3742961407e-09
Ecym_41145.579ON3722281409e-09
Smik_4.7375.579ON3782281381e-08
AGR065W8.286ON326441353e-08
Kwal_56.236978.286ON338571292e-07
KAFR0I011105.579ON370731282e-07
Skud_4.7345.579ON3802541283e-07
KNAG0H031108.286ON331841264e-07
TDEL0A044405.579ON3652291231e-06
Kpol_1004.575.579ON3622151221e-06
TBLA0E028305.579ON3862361212e-06
ZYRO0D13860g5.579ON3652401212e-06
KNAG0C028305.579ON354621202e-06
SAKL0G06160g5.579ON3641721184e-06
NDAI0H018905.579ON406701176e-06
Kwal_47.183665.579ON356781141e-05
KLTH0G04972g5.579ON367611132e-05
Smik_4.5155.626ON7641031097e-05
Suva_2.6345.579ON3881121087e-05
CAGL0K06347g5.579ON352641033e-04
KLLA0D06149g5.579ON349651024e-04
Suva_8.875.626ON7301671016e-04
NDAI0H008505.626ON786961000.001
KNAG0C062305.626ON752103970.002
TPHA0C003705.626ON75975960.003
Suva_2.4325.626ON76371950.003
Skud_4.5275.626ON76470950.004
TDEL0A049205.626ON750187940.005
ABR203W5.579ON35960930.005
NCAS0C052805.626ON75790900.014
KLTH0E02420g5.626ON73456890.019
Smik_15.2135.626ON74483890.021
YDR264C (AKR1)5.626ON764141880.027
ZYRO0C11132g5.626ON75954870.040
TBLA0J008305.626ON739100860.046
CAGL0M08712g5.626ON763113860.048
SAKL0G07326g5.626ON73784850.056
KNAG0B031405.626ON68285850.067
YOR034C (AKR2)5.626ON74976840.091
KAFR0H005705.626ON75767840.091
Kpol_526.325.626ON77771820.14
AER388C5.626ON72481820.16
Skud_15.1995.626ON74183800.22
Ecym_13305.626ON73954760.84
KAFR0G021756.128ON147123711.1
TDEL0F046408.340ON1237107751.2
KAFR0F031704.97ON59260741.4
KLLA0E16721g5.626ON75251704.2
TBLA0H022505.102ON55736694.9
NCAS0A017304.97ON784143687.1
Smik_5.921.444ON48188677.8
Ecym_22872.613ON82168678.8
Kpol_513.185.36ON21460659.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C07546g
         (377 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...   782   0.0  
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...   496   e-176
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...   494   e-175
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...   474   e-167
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...   472   e-167
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...   465   e-164
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...   462   e-163
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...   461   e-162
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...   457   e-161
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...   457   e-161
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...   454   e-160
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28     453   e-159
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...   429   e-149
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...   412   e-143
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...   407   e-141
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...   402   e-139
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...   388   e-133
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...   387   e-133
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...   376   e-128
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...   194   6e-58
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      86   4e-18
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    86   5e-18
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    84   3e-17
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    84   3e-17
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    83   6e-17
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    82   1e-16
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    81   2e-16
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    79   1e-15
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    78   2e-15
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    78   2e-15
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    76   1e-14
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    76   1e-14
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    76   1e-14
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    75   2e-14
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    75   2e-14
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    75   2e-14
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    75   3e-14
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    75   3e-14
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    75   4e-14
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     74   5e-14
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    74   8e-14
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    74   8e-14
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    72   2e-13
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    72   2e-13
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    72   3e-13
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    72   3e-13
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...    72   3e-13
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    72   3e-13
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    72   3e-13
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    72   4e-13
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    72   4e-13
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    72   5e-13
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    71   5e-13
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...    70   8e-13
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    70   1e-12
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    70   1e-12
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...    70   1e-12
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    70   1e-12
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}      69   2e-12
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...    69   3e-12
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...    69   4e-12
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....    68   4e-12
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    68   7e-12
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...    67   8e-12
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     67   1e-11
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...    67   2e-11
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...    67   2e-11
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...    66   3e-11
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    65   5e-11
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...    65   6e-11
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...    65   8e-11
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....    65   8e-11
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    64   9e-11
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...    63   3e-10
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...    62   5e-10
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    61   1e-09
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...    61   1e-09
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    59   7e-09
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    59   9e-09
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    58   1e-08
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...    57   3e-08
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...    54   2e-07
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    54   2e-07
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    54   3e-07
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...    53   4e-07
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    52   1e-06
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    52   1e-06
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    51   2e-06
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    51   2e-06
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    51   2e-06
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    50   4e-06
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    50   6e-06
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    49   1e-05
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    48   2e-05
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    47   7e-05
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    46   7e-05
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    44   3e-04
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    44   4e-04
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    44   6e-04
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    43   0.001
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    42   0.002
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    42   0.003
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    41   0.003
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    41   0.004
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    41   0.005
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    40   0.005
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    39   0.014
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    39   0.019
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    39   0.021
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    39   0.027
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    38   0.040
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    38   0.046
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    38   0.048
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    37   0.056
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    37   0.067
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    37   0.091
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    37   0.091
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    36   0.14 
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    36   0.16 
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    35   0.22 
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    34   0.84 
KAFR0G02175 Chr7 (453872..453885,453946..454375) [444 bp, 147 aa...    32   1.1  
TDEL0F04640 Chr6 (870870..874583) [3714 bp, 1237 aa] {ON} Anc_8....    33   1.2  
KAFR0F03170 Chr6 complement(627907..629685) [1779 bp, 592 aa] {O...    33   1.4  
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    32   4.2  
TBLA0H02250 Chr8 (543632..545305) [1674 bp, 557 aa] {ON} Anc_5.1...    31   4.9  
NCAS0A01730 Chr1 (335930..338284) [2355 bp, 784 aa] {ON} Anc_4.97      31   7.1  
Smik_5.92 Chr5 complement(130819..132264) [1446 bp, 481 aa] {ON}...    30   7.8  
Ecym_2287 Chr2 (558921..561386) [2466 bp, 821 aa] {ON} similar t...    30   8.8  
Kpol_513.18 s513 complement(51452..52096) [645 bp, 214 aa] {ON} ...    30   9.1  

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  782 bits (2020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/377 (100%), Positives = 377/377 (100%)

Query: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60
           MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT
Sbjct: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60

Query: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120
           LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF
Sbjct: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120

Query: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180
           PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT
Sbjct: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180

Query: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240
           ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE
Sbjct: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240

Query: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300
           ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF
Sbjct: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300

Query: 301 EETNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQWQ 360
           EETNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQWQ
Sbjct: 301 EETNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQWQ 360

Query: 361 NTWGENLEDFGVDVDAE 377
           NTWGENLEDFGVDVDAE
Sbjct: 361 NTWGENLEDFGVDVDAE 377

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score =  496 bits (1277), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 241/379 (63%), Positives = 286/379 (75%), Gaps = 3/379 (0%)

Query: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60
           MPV+LK+P++GIAIPCFLISFI Y AHYFIL NFLS  KQIWFE S+TMIW SYYLAIYT
Sbjct: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60

Query: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120
            PG+P  N+ P  N WK+YCKKC  YKPER HHCKTC QCVL MDHHCPWT NCVGY NF
Sbjct: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120

Query: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180
           PHF+RFLFWVI TT YLLY L  R  F+  + N P+YL+NKSE+IFLTI  PMDGF+LLT
Sbjct: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180

Query: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240
           IS+LFIRC  NQ+  GRTQIETWE ERLE L+Y +RL P L++N WE +PEL+T + E +
Sbjct: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240

Query: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300
           A ++ + +RI  D LV+FPYD+   +N    LGSP+ WLW +G+P GDGM F KN+ S F
Sbjct: 241 AEKIVS-KRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLF 299

Query: 301 EETN-LTDMLLALPWPPDGGKDKV-ISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQ 358
           EE + L D +L+LPWPPDGGK    I     N++ET+ +DGE VIRKR    +   SRTQ
Sbjct: 300 EEDSILEDQILSLPWPPDGGKHGFNIENSSTNSIETSTKDGEHVIRKRSPVSKLLESRTQ 359

Query: 359 WQNTWGENLEDFGVDVDAE 377
           W N WGENLEDFGVD+D E
Sbjct: 360 WYNDWGENLEDFGVDIDVE 378

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score =  494 bits (1271), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 228/378 (60%), Positives = 287/378 (75%), Gaps = 1/378 (0%)

Query: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60
           MPV+LKWP+LGIAIPC L+SFIGY  H+FILSNFLS  KQ+WF+ +L +IW SYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60

Query: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120
            PG+P PNF+  K  WK+YCKKC+NYKPERAHHCKTCNQCVL MDHHCPWT NCVG+ NF
Sbjct: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120

Query: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180
           PHF+RFL WVI  T +LLY+L  R   +  + N P Y++++SEL+FLTIL P+D F+LLT
Sbjct: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVLLT 180

Query: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240
           I+IL  RCL+NQIF G +QIETWE ERL+ L+ SKRL+P L+   W+++P  R +  E  
Sbjct: 181 ITILLCRCLANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240

Query: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300
           A+ LS  + + L+ +VNFPYD+DPWSN  + LG+PL WLWPFG+PKGDGM F KN+ISE+
Sbjct: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300

Query: 301 -EETNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQW 359
               +  D+LL+LPWPPDGG+ +       +++E+  + GEQ+IR+R  D  D   R QW
Sbjct: 301 SSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQW 360

Query: 360 QNTWGENLEDFGVDVDAE 377
           QN WGENLEDFGVDVD E
Sbjct: 361 QNDWGENLEDFGVDVDTE 378

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score =  474 bits (1220), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 225/378 (59%), Positives = 283/378 (74%), Gaps = 1/378 (0%)

Query: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60
           M V+LKWP+LGIAIP FLISFIGY AHYFILSNFLS  KQI FE SL+MIW SYYLAIYT
Sbjct: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80

Query: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120
            PG+P P +QP+ N+W +YCKKC+NYKPER+HHCK CNQCVL MDHHCPWT NCVG+ N+
Sbjct: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140

Query: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180
           PHF+RF+FWVIATTG+L      R  FI    + P YL+ KSEL+FLTIL P++ F+LLT
Sbjct: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPLNFFVLLT 200

Query: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240
           I ILF+RCL NQI  GR+QIE+W+ +RLE L+ S+RL+  L+ N W +YPE R+ +LE +
Sbjct: 201 IVILFLRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260

Query: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300
           A +L T+ +I  + +VNFPY+ID ++N   +LG    WLWP G P GDG  F KNDIS++
Sbjct: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320

Query: 301 E-ETNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQW 359
           E  ++L D++L+LPWPPDGGK K  S     A+ET    GEQV+R R+      ++R +W
Sbjct: 321 EVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSATREKW 380

Query: 360 QNTWGENLEDFGVDVDAE 377
            N WGE+L+DFGVDVD E
Sbjct: 381 YNDWGESLDDFGVDVDME 398

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score =  472 bits (1215), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 222/379 (58%), Positives = 287/379 (75%), Gaps = 5/379 (1%)

Query: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60
           MPV+LK+P++G+ IPC L SFIGY+AH F+L+NF+S + Q+WF+ SLTM+W SY LAI+T
Sbjct: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60

Query: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120
            PG+P  +F+P K  W  +CKKC+ +KPERAHHCKTCNQCVL MDHHCPWT NCVG+ NF
Sbjct: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120

Query: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180
           PHF+RFLFWV+ TTG+LLY+L  R  ++    + P+YL+ K+E+ FL ILIPMDGF+L+T
Sbjct: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180

Query: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240
           +++LFIRCLSNQI  G+TQIE+WE ERLE LYY K+LLP LL N WE+YP  +T E +  
Sbjct: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240

Query: 241 ASRLSTR-RRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISE 299
           A +L  R R++  +++V FPYD+D WSN +  LGSP+ WLW FG P  DGM F KN+++ 
Sbjct: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300

Query: 300 FEE-TNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQ 358
           +EE   + D+LL+LPWPPDGG++  I   G N VE+   +GEQVIR+R  +  D S R  
Sbjct: 301 YEEGAAIEDLLLSLPWPPDGGRN-FIQQKGTN-VESITENGEQVIRQRNFE-NDNSYRKT 357

Query: 359 WQNTWGENLEDFGVDVDAE 377
           W N WGENLEDFGVDVD E
Sbjct: 358 WNNDWGENLEDFGVDVDVE 376

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score =  465 bits (1197), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 227/378 (60%), Positives = 277/378 (73%), Gaps = 3/378 (0%)

Query: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60
           MPV+LKWP+LGIAIP FLI+ IGY AHYFIL NFLS +KQ+W++F  TMIW SYYLAIYT
Sbjct: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60

Query: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120
            PG+P  NF+PSKN WK YCKKC+ YKPER+HHCKTCNQCVL MDHHCPWT NCVGY NF
Sbjct: 61  PPGKPPTNFKPSKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120

Query: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180
           PHF+RFLFWVI  T  L   L  R + I  + +SP+YL+ KSELIFLTIL P++ FILLT
Sbjct: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180

Query: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240
           ISIL IRCL NQIF GR+QIE+WE +RLE L    +LLP L+ N W ++P LR   +E +
Sbjct: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240

Query: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300
           A  L  ++R+ LD LVNFPYD+ P+ N I+ LG+P  WL+PF  P+ DG+ F KN+ S  
Sbjct: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300

Query: 301 EETN-LTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQW 359
           E+ N L D++L LPWPPD  K    + +  + V+    +GEQVIR R   P    SR++W
Sbjct: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIR--TPEKKLSRSEW 358

Query: 360 QNTWGENLEDFGVDVDAE 377
            N WGE+LEDFGVDVD E
Sbjct: 359 LNDWGESLEDFGVDVDVE 376

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score =  462 bits (1189), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 223/378 (58%), Positives = 276/378 (73%), Gaps = 3/378 (0%)

Query: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60
           MPV+LKWP+LGIAIPCFLI+FIGY+A  F+L  FLS ++QIWF+FSLTMIW SYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60

Query: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120
            PG P+P FQP K+ WK+YCKKC+N+KPER HHCKTC QCVL MDHHCP+T NCVGY NF
Sbjct: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120

Query: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180
           PHFMRFLFW+I TT YL  +   R +F+ +  +S   L  K E+IFLTIL P + F+LLT
Sbjct: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180

Query: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240
           ISILF RC+ NQ+  G TQIE WE +R+E ++Y++RL+P LL+N  ELYP       + E
Sbjct: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGH-KGE 239

Query: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300
             R+   R+I  + LVNFPYD DPW N I  +G  L WL PFGKP G+GM F KN++S +
Sbjct: 240 IDRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAY 299

Query: 301 EE-TNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQW 359
           E  + LTD LL+LPWPPDG +    S +    VE++ R+GE +IRKR  +PR   SRT+W
Sbjct: 300 EHGSTLTDKLLSLPWPPDGERAPN-SSNSRLKVESSTRNGEHIIRKRSPEPRLNLSRTEW 358

Query: 360 QNTWGENLEDFGVDVDAE 377
            N WGENL  FGVDVDA+
Sbjct: 359 YNDWGENLAHFGVDVDAD 376

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score =  461 bits (1186), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 223/379 (58%), Positives = 278/379 (73%), Gaps = 2/379 (0%)

Query: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60
           M V+LKWP+LGIAIP FLISFIGY AHYFILSNFLS  KQ+ FE SL+MIW SYYLAIYT
Sbjct: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60

Query: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120
             G+PLPN++PS   W ++CKKC++YKPER+HHCK CNQCVL MDHHCPWT NCVG+ N+
Sbjct: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120

Query: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180
           PHF+RFLFWVI TT  L      R  FI    + P YL+ KSELIFLTIL P+D F+LLT
Sbjct: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180

Query: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240
           I+ILF+RCLSNQI  GR+QIE+W+ +RLE L  S +L+P L+ N W +YPE R+ + E +
Sbjct: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240

Query: 241 ASRLSTRR-RIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISE 299
           A +L T+R R   D LV+FPY+ +P +N I +LG    WLWP+G P GDG  FPKNDIS+
Sbjct: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300

Query: 300 FE-ETNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQ 358
           +E  + L D++L+LPWPPDG K K +S    + +ET    GEQ++R R       + R +
Sbjct: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREK 360

Query: 359 WQNTWGENLEDFGVDVDAE 377
           W N WGE+L+DFGVDVD E
Sbjct: 361 WYNDWGESLDDFGVDVDME 379

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score =  457 bits (1177), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 220/378 (58%), Positives = 278/378 (73%), Gaps = 1/378 (0%)

Query: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60
           M V+L+WP+LGIAIP  LISFIGY AHYFILSNFL   KQI FEFSL+MIWFSYYLAIYT
Sbjct: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60

Query: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120
            PG+PLPN+QP+   W ++CKKC+NYKPER+HHCKTCNQCVL MDHHCPWT NCVG+ N+
Sbjct: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120

Query: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180
           PHF+RFLFW+I TT  L      R  FI    N P YL+ KSEL FLTIL P++ F+LLT
Sbjct: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPLNFFVLLT 180

Query: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240
           I++LF+RCL NQI  GR+QIE+W+ +RLE L+ S+RL+  L+ N W +YPE +T + E +
Sbjct: 181 ITVLFLRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240

Query: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300
           A  L  ++R   + LVNFPY+ D  +N I +LG    WLWP+G P G+G  FPKNDIS +
Sbjct: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300

Query: 301 E-ETNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQW 359
           E ++ L D++L+LPWPPDGG+   +S    + +ET    GEQV+R R+      +SR +W
Sbjct: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREKW 360

Query: 360 QNTWGENLEDFGVDVDAE 377
            N WGE+L+DFGVDVD E
Sbjct: 361 FNDWGESLDDFGVDVDME 378

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score =  457 bits (1176), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 219/378 (57%), Positives = 276/378 (73%), Gaps = 1/378 (0%)

Query: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60
           MPV+L+WP+LGIAIP FLISFIGY AHYFILSNFLS  KQI FEF L+MIW SYYLAI T
Sbjct: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60

Query: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120
            PG+PLPN++P  + W+++CKKC++YKPER+HHCKTCNQCVL MDHHCPWT NCVG+ N+
Sbjct: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120

Query: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180
           PHF+RFLFW+I TT  L      R YFI    + P Y + KSELIFLTI  P++ F+LLT
Sbjct: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180

Query: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240
           I+ILF+RCL NQI  GR+QIE+W+ +RLE L+ S RL   L+ N W +YPE R+ + + +
Sbjct: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240

Query: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300
           A    T++R   D LVNFPYD D ++N + +LG    WLWP+G P GDG  FPKN IS++
Sbjct: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300

Query: 301 E-ETNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQW 359
           E  ++L D +L+LPWPPDGGK   +   G + +E     GEQ+IR RL      +SR +W
Sbjct: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKW 360

Query: 360 QNTWGENLEDFGVDVDAE 377
            N WGE+L+DFGVDVD E
Sbjct: 361 YNDWGESLDDFGVDVDME 378

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score =  454 bits (1169), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 223/380 (58%), Positives = 283/380 (74%), Gaps = 4/380 (1%)

Query: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60
           M V+LKWP+LGIAIP FLISFIGY AHYFILSNFL T+KQ+WFEFSL MIW SYYLAIYT
Sbjct: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60

Query: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120
            PG+P P F+PSK  W+++C KC NYKPERAHHCK CNQCVL+MDHHCPWT NCVG+ NF
Sbjct: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120

Query: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180
            HF+RFLFWVI TT +LL  L  R  F+ +  + P Y  ++SELIFLTIL PMD F+LLT
Sbjct: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180

Query: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240
           IS+L +RC  NQI  G TQIE+WE +R+E +++S +L+P +L N  E+ P   + + +D+
Sbjct: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQ-DDD 239

Query: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300
             +L ++ R+ LD +VNFPYD++PW+N +  LG    W+ P+G  KG+GM F KN++S +
Sbjct: 240 IRKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVY 299

Query: 301 E-ETNLTDMLLALPWPPDGGKDKV--ISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRT 357
           E E  + D LL+LPWPPDGG+ KV     +  N VE++ RDGE+V+RKR VDPR    R 
Sbjct: 300 EPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRK 359

Query: 358 QWQNTWGENLEDFGVDVDAE 377
           +W N WGENL DFGVD+D E
Sbjct: 360 KWYNDWGENLADFGVDLDEE 379

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score =  453 bits (1166), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 218/389 (56%), Positives = 290/389 (74%), Gaps = 14/389 (3%)

Query: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60
           M ++LK+P+LG+AIP F+ISFIGYN+HYFILSNFLS +KQIWF+FSL+MIW SY LAI+T
Sbjct: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60

Query: 61  LPGQPLPNFQP----SKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVG 116
            PG+P  N +P     +  W ++CKKC NYKPER+HHCKTCNQCVL MDHHCPWT NCVG
Sbjct: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120

Query: 117 YYNFPHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGF 176
           Y NFPHF+RFL W+I TTG+LL  L  R   + +  + P+Y+++++E+IFLTILIPMD F
Sbjct: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180

Query: 177 ILLTISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRE 236
           ILLTIS+LFIRC +NQI  G TQIE WE ERLE L+Y+K+LLP ++A  WE+YP  RT+ 
Sbjct: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240

Query: 237 LEDEASR-LSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKN 295
            ++ A   LS R+++  +++VNFPYDID W+N    +GS   W+W FG P  +G+ F KN
Sbjct: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300

Query: 296 DISEFE-ETNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPS 354
           +IS +E  +++ D+LL+LPWPPD G++ + + D   +VE+ V DGEQV+R R  +  + S
Sbjct: 301 EISLYEPGSSVEDLLLSLPWPPDKGRNFISNKD--TSVESLVYDGEQVVRNRASNDTNIS 358

Query: 355 ------SRTQWQNTWGENLEDFGVDVDAE 377
                 SR +W N WGE+L DFGVD++AE
Sbjct: 359 TINKDISREEWNNDWGESLVDFGVDIEAE 387

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score =  429 bits (1103), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 212/379 (55%), Positives = 277/379 (73%), Gaps = 2/379 (0%)

Query: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60
           MPV+ KWP++GIAIPC LISFIGY +HY+IL   LS  KQ +FEFSLTMIW SYY+AI  
Sbjct: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60

Query: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120
            PG+P  NF+P  + W+++CKKC NYKPER+HHCKTCNQCVL MDHHCPWT NC+G+ NF
Sbjct: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120

Query: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180
           PHFMRFL W++ATTG+LL+    R  ++ +N N P+YL+ +SE+I L +  P++ FILLT
Sbjct: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPLNLFILLT 180

Query: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240
           I++LF RCL NQI  G+TQIE WE +RLE  +Y K+LLP L+ N WELYPEL++ + ++E
Sbjct: 181 ITLLFCRCLFNQIINGKTQIEDWEMDRLENRFYLKKLLPQLILNLWELYPELKSAKHDEE 240

Query: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300
           A RL  ++ I  D +VNFPYD+  + N    +G PL+WLWPFG P G+GM F KN+I+ F
Sbjct: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300

Query: 301 E-ETNLTDMLLALPWPPDGGK-DKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQ 358
           + +++L    LALPWPPD G+ +   +++  + VE    DGEQV+R R        SR +
Sbjct: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360

Query: 359 WQNTWGENLEDFGVDVDAE 377
           W N WGENLEDFGVDV+ E
Sbjct: 361 WFNEWGENLEDFGVDVEME 379

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  412 bits (1058), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 198/379 (52%), Positives = 266/379 (70%), Gaps = 5/379 (1%)

Query: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60
           MPV+LKWP+LGIA+P FLI++IGY++HYFIL NF ST +Q+WFEFSLT+IW SY  AI+ 
Sbjct: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60

Query: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120
            PG+P PNF+P  + WK+YCKKC NYKPER HHCKTC QCVL+MDHHCPWT NCVG+ NF
Sbjct: 61  NPGRPPPNFEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120

Query: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180
           PHF+RFL WV+ TT YL   L  RA+   ++ N+  ++ + SEL FL +  P++ FILLT
Sbjct: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFV-HTSELCFLFVNAPLNAFILLT 179

Query: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240
           +S+L  RC+ NQ   G TQIE+WE +R+E L++++RL+P L+ N  EL+PE      E  
Sbjct: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFD--EGA 237

Query: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300
           A +L + +++ L+ ++NFPYD+D   N    +G    W  P G+P+ +G  F  ND+S++
Sbjct: 238 AQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDY 297

Query: 301 E-ETNLTDMLLALPWPPDGGKDKVI-SIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQ 358
           + + ++ D LL+LPWPPDGG+ K   S D  + +ET    GE  +R R  D R    RT+
Sbjct: 298 DIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTE 357

Query: 359 WQNTWGENLEDFGVDVDAE 377
           W N WGENL DFGVDVDAE
Sbjct: 358 WHNDWGENLSDFGVDVDAE 376

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score =  407 bits (1045), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 201/378 (53%), Positives = 254/378 (67%), Gaps = 4/378 (1%)

Query: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60
           M V +KWP+LG+AIPCFLISF GY AH+F+L+NFLS ++ +WF+ SL+MIW SY+ AIY 
Sbjct: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60

Query: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120
            PG+P   F+P +  W++YC KC  YKPER HHCK CNQCVL MDHHCPWT NC+G    
Sbjct: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120

Query: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180
                   W+IATTG LL+    R  F   N  +   L +K ELIFLTIL P+D FILLT
Sbjct: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180

Query: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240
           IS+LF+RC+ NQI  GRTQIE WE +R+E L+Y +RLLP LL N  E+YP     + E E
Sbjct: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQ-EKE 239

Query: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300
                +      D ++NFPYDI+PW N +  +GSPL WL PFG PK DGM F KN+IS++
Sbjct: 240 VEEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDY 299

Query: 301 EE-TNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQW 359
           +E T++ D LLALPWPPD  +   I+    + VE   + GEQV+R+R V P     R +W
Sbjct: 300 DEATSIQDKLLALPWPPDDTRHG-IAFPSVSHVEKDTQGGEQVVRRRHV-PIAVPPRNEW 357

Query: 360 QNTWGENLEDFGVDVDAE 377
            N WGE+LE FGVDV+ E
Sbjct: 358 YNDWGESLEHFGVDVEVE 375

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score =  402 bits (1032), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 193/378 (51%), Positives = 259/378 (68%), Gaps = 2/378 (0%)

Query: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60
           M ++LK  +LG+AIP FL++ IGY +HYFILSNFLS  +QI+++   TMIW SYYLAIYT
Sbjct: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60

Query: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120
            PG P  +F+PS   W +YCKKCR YKPERAHHCKTCNQCVLAMDHHCPWT NCVG+ NF
Sbjct: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120

Query: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180
           PHFMRFLFWVI +T YLL+ L  R Y + S  ++  +  + SE+IF+ I+ PMD F+LLT
Sbjct: 121 PHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180

Query: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240
           +S L  RC+ NQ   G TQIE+WE +R++ L+Y  RLL  ++    E  PE+   + + E
Sbjct: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAK-QHE 239

Query: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300
            ++L ++R +  +   NFPYD++PW+N    +G    WLWP+ KP   G  F KN++  +
Sbjct: 240 INKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFY 299

Query: 301 E-ETNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQW 359
           +  +++ DML++LPWPPDG      ++   +++ET V  GEQVIR + VD RD   R  W
Sbjct: 300 DPNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNSW 359

Query: 360 QNTWGENLEDFGVDVDAE 377
            N WGE+L DFGVD + E
Sbjct: 360 YNDWGEDLSDFGVDTELE 377

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score =  388 bits (996), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 192/379 (50%), Positives = 256/379 (67%), Gaps = 5/379 (1%)

Query: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60
           MPV+LKWP+LGIAIP  LI+FIGY +HYFIL NFLS  +Q+WF+  L+MIW SY LAI+T
Sbjct: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60

Query: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120
            PG+P   FQP  + WK+ C+KC+ YKPER HHCKTC+QCVL MDHHCPWT NCVG+ NF
Sbjct: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120

Query: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180
           PHF+RFL WVI TT YL + L  R +      ++  Y+  K EL+F+ I  P++ F+ LT
Sbjct: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYV-QKIELVFIFINTPLNAFVWLT 179

Query: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240
           I +L +RC  NQ  CG TQIE WE+ER+E  + + RL+P LL N  E+Y +         
Sbjct: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILN--SPN 237

Query: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300
           A +L   R + L+ +VNFPYD++  +NT   +G+ L  + P+  P G+G+ F KND+S +
Sbjct: 238 AKKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSY 297

Query: 301 EETN-LTDMLLALPWPPDGGKDKVISIDGPNA-VETTVRDGEQVIRKRLVDPRDPSSRTQ 358
           +  + + D LL+LPWPPDGG+ +       ++ +E     GE V+RKRL DPR    RT+
Sbjct: 298 DTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTE 357

Query: 359 WQNTWGENLEDFGVDVDAE 377
           W N WGENL DFGVDV++E
Sbjct: 358 WYNDWGENLSDFGVDVESE 376

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score =  387 bits (993), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 201/386 (52%), Positives = 252/386 (65%), Gaps = 17/386 (4%)

Query: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60
           MPVQLK P+ GIAIPC LI FIGY AH+FIL N LS ++QI F+F LTMIW SYY+AIYT
Sbjct: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60

Query: 61  LPGQPLPNF--QPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYY 118
            PG+P      Q +      YC KC  +KPER+HHCKTC QCVL MDHHCPWT NC+G+ 
Sbjct: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120

Query: 119 NFPHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSP----TYLWNKSELIFLTILIPMD 174
           NFP FMRFL WVI TT  L + L LR   I    N P           EL+ L +L PMD
Sbjct: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180

Query: 175 GFILLTISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRT 234
            F+L TI+ LF+RC++NQ+  G TQIE+WE ERL+ ++YSK+LLP ++   WE +P  +T
Sbjct: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240

Query: 235 RELEDEASRLSTRRRIGL---DHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMF 291
            E E EA +L      GL     +VNFPYD+D  +N  + LGSP+  LWPF   +G+G+ 
Sbjct: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300

Query: 292 FPKNDISEFEET-NLTDMLLALPWPPDGGKD--KVISIDGPNAVETTVRDGEQVIRKRLV 348
           F KNDIS +E+  +++D+LL L WPPDGG+        DG + ++ TV DGE +IRKR  
Sbjct: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKR-- 358

Query: 349 DPRDP-SSRTQWQNTWGENLEDFGVD 373
               P  SRT W+N WGE LE FGVD
Sbjct: 359 --NSPIESRTTWENQWGETLEGFGVD 382

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score =  376 bits (966), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 202/396 (51%), Positives = 259/396 (65%), Gaps = 19/396 (4%)

Query: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60
           M +QLKWP+LGIAIP FLISFIGY+AHYFIL + LS + Q+WF+FSL+MIW SYYLAI  
Sbjct: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60

Query: 61  LPGQP-LPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYN 119
            PG P + +      + ++YCKKC  YKP RAHHCKTCN+C+L MDHHCPWT NCVG+ N
Sbjct: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120

Query: 120 FPHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILL 179
           +PHF+RFLFWVI TT +LL +L  R  FI +N  S + L  + E++ LTIL PMD FILL
Sbjct: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFILL 180

Query: 180 TISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKR-----LLPHLLANFWELYPELRT 234
           TI++L IRC  NQIF G +QIE WE ERLE  +YS++      L  L+ N + ++     
Sbjct: 181 TITLLLIRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIESP 240

Query: 235 RELEDEAS---RLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMF 291
            + ++E +   R   +RR+    ++NFPYDID  +N    LG    WL PFG P+GDGM 
Sbjct: 241 EDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDGMH 300

Query: 292 FPKNDISEFEETNLTDMLLALPWPPDGGKDKV-ISID-GPNAVETTVRDGEQVIRKRLVD 349
           F  N+I+  + + L D+LL+LPWPPD    K   SID G   VET +  GE V+R R V 
Sbjct: 301 FELNEIASEKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRNRTVS 360

Query: 350 P--------RDPSSRTQWQNTWGENLEDFGVDVDAE 377
           P         +  SR  W N WGENL+ FGVD++ E
Sbjct: 361 PSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score =  194 bits (493), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 144/415 (34%), Positives = 209/415 (50%), Gaps = 79/415 (19%)

Query: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60
           M ++   P+ G+AIP  +I  +   +++ IL + L+T + IW+  +  MI +SYYLAI T
Sbjct: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60

Query: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPE----------------RAHHCKTCNQCVLAM 104
            P  P P+        +S+     N + +                RAHHCKTCN CV+ M
Sbjct: 61  -PPTPAPSTLT-----QSFISDVMNNENDIFPTTTCKKCKKIKLPRAHHCKTCNTCVVMM 114

Query: 105 DHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWN--KS 162
           DHHCPWT NCVGY N+PHF+RFL WVI +T  LL +L  +AY +    NSP +L+   K 
Sbjct: 115 DHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKY 174

Query: 163 ELIFLTILIPMDGFILLTISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKR------ 216
           ++I LT+LIP   F+ LT+ +L ++ L NQI+ G TQIE W++E +E  Y+  +      
Sbjct: 175 KIIILTLLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAL 234

Query: 217 --LLPHLLANFWELYPELRTRELEDEASRLST-----RRRIGLDHLVNFPYDIDPWSNTI 269
              L   L NF+    +L T  +      +S+     R       ++NFPYD+   +N  
Sbjct: 235 QLQLLENLLNFYN--KKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNIT 292

Query: 270 EFLGS--PLFWLWPFGKPKGDGMFFPKNDISEFE-------ETNLTDMLLALPWPPDGGK 320
             +GS  PL W  P+  P    +    N I+EF          N+ DMLL LPWP +   
Sbjct: 293 TTMGSLNPLSWFNPWYTP----LTASYNKINEFAIWDDNETHDNIKDMLLCLPWPLNYSN 348

Query: 321 DKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQWQNTWGENLEDFGVDVD 375
           +            +T +DGE V++                N +GE L+DFGVD D
Sbjct: 349 N------------STFQDGELVVKS---------------NDYGETLQDFGVDYD 376

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 85.9 bits (211), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 76/142 (53%), Gaps = 7/142 (4%)

Query: 67  PNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRF 126
            ++   +N     C+ C+ +KP+R HHC TCN+C+L MDHHCPW   C+G+ N   F++F
Sbjct: 96  KSYTMKRNGRYRLCQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQF 155

Query: 127 LFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLTISILFI 186
           L   I  T Y    L L +Y  ++ + +  Y+   +E I  T+LI      +++IS+L  
Sbjct: 156 L---IYCTIYAFVALGLISYQFVNWYKNQNYM---NEYIDFTLLIVGLLAFVISISVLAF 209

Query: 187 RCLS-NQIFCGRTQIETWEYER 207
              S  Q+   RT IE +   R
Sbjct: 210 SSFSIYQVLKNRTTIEMYGIRR 231

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 85.9 bits (211), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 76/141 (53%), Gaps = 7/141 (4%)

Query: 68  NFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFL 127
           +F   K+     C+ C+ +KP+R HHC TC++C+L MDHHCPW   C+G+ N  +F++FL
Sbjct: 89  SFTLKKDGRYRLCQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFL 148

Query: 128 FWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLTISILFIR 187
            +  A +  +L+      ++  S          + ELI L +L      I++T+S++F  
Sbjct: 149 IYCTAYSIVVLFFTSCELHYWFSGKQY------EDELIDLMLLTVWILAIVITVSLIFFS 202

Query: 188 CLS-NQIFCGRTQIETWEYER 207
             S  Q+   +T IE +  +R
Sbjct: 203 SFSIYQLLKNQTTIEMYGMKR 223

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 83.6 bits (205), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 73/132 (55%), Gaps = 7/132 (5%)

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLY 139
           C+ C  +KP+R HHC +CN+C+L MDHHCPW   C+G+ N  +F++FLF+  + +  +L+
Sbjct: 106 CQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFLFYCTSYSIIVLF 165

Query: 140 ELCLRAYFILSNHNSPTYLWNKSELIFLTI-LIPMDGFILLTISILFIRCLSNQIFCGRT 198
              ++ Y       S +Y +   +   LT+ L+ +  FI L   +LF      Q+   +T
Sbjct: 166 VTSIQIYHWF---RSTSYEYEFIDFKLLTVWLLAIVIFISL---VLFTGFSVFQLLGNQT 219

Query: 199 QIETWEYERLEG 210
            IE + Y R + 
Sbjct: 220 TIELYAYRRYKA 231

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 83.6 bits (205), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 73/146 (50%), Gaps = 17/146 (11%)

Query: 68  NFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFL 127
           ++   +N     CK C ++KP+R HHC TCN CVL MDHHCPW   CVGY N   F++FL
Sbjct: 94  SYTQKRNGRFRVCKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFL 153

Query: 128 FWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKS-----ELIFLTILIPMDGFILLTIS 182
            +    T Y +  L L +  I        Y W K      ELI  T+L      ++++IS
Sbjct: 154 IY---CTVYSILVLILSSMEI--------YTWFKGEFFEVELINFTLLSLWLLALVVSIS 202

Query: 183 ILFIRCLS-NQIFCGRTQIETWEYER 207
           I      S +Q+   +T IE +   R
Sbjct: 203 ITIFTVFSISQVCQNQTTIELYSLRR 228

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 82.8 bits (203), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 108/240 (45%), Gaps = 53/240 (22%)

Query: 52  FSYYLAIYTLPGQPL--------------------PNFQPSKNSWKSY------CKKCRN 85
           ++YY  I   PG PL                    P+F   ++    +      C+ C  
Sbjct: 52  YTYYKVIIVGPGSPLDFGQLTVRNIKDAEDGIELPPDFLAQRSFTLKHDGRFRVCRTCNV 111

Query: 86  YKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLYELCLRA 145
           +KP+R HHC  C++C+L MDHHCPW   CVG+ N  +F++FL   I TT Y        A
Sbjct: 112 WKPDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFL---IYTTVY--------A 160

Query: 146 YFILSNHNSPTYLWNKSELIFLTILIPMDGFILLTISI---LFIRCLSN----QIFCGRT 198
             +++  +   Y W K+EL + T +I +   ++  +S+   L + C +     Q    RT
Sbjct: 161 ILVMTYTSFQIYDWFKNEL-YETEIIKIRLLMVWILSVAVFLTVTCFTGFSIYQTINNRT 219

Query: 199 QIETWEYER------LEGLYYSKRLLPHL--LANFWELYPELRTRELEDEASRLSTRRRI 250
            IE +   +      L G Y   +L  ++  L + WE + E+    L ++   + TR+ I
Sbjct: 220 TIEMYTLRKYREELELYGNYRDSQLTRNIFDLGSTWENWCEVMGTSLWEQLMPVRTRKSI 279

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 72/138 (52%), Gaps = 25/138 (18%)

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLY 139
           C+ CR +KP+R HHC +C++C+L MDHHCPW   CVG+ N   F++FL +   TT Y   
Sbjct: 103 CQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLY---TTAY--- 156

Query: 140 ELCLRAYFILSNHNSPTYLWNKSE----------LIFLTILIPMDGFILLTISILFIRCL 189
                A F+LS  +   Y W  ++          L+FL I   +  FI +T   LF    
Sbjct: 157 -----AIFVLSMTSVQLYRWFYNDKFQEELISGYLLFLWIF-SLVVFIAMT---LFSAFS 207

Query: 190 SNQIFCGRTQIETWEYER 207
            +Q+   +T IE +  +R
Sbjct: 208 VSQVLKNQTTIEMYGVQR 225

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 71/134 (52%), Gaps = 7/134 (5%)

Query: 73  KNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIA 132
           +N    +C+ C  +KP+R HHC  CN+C L MDHHCPW  +CVGY N  +F+ FL +   
Sbjct: 126 RNGRFRFCRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLY--- 182

Query: 133 TTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLTISILFIRCLSNQ 192
           TT Y +    L    +L    S  Y     ELI L +LI     +++TIS+L     +  
Sbjct: 183 TTAYSILVFFLTGADLLMWFRSQGY---NQELINLPLLIVWILSLVITISMLAFTSYTIY 239

Query: 193 IFC-GRTQIETWEY 205
           +    +T IE +E+
Sbjct: 240 LVAKNQTTIEMYEW 253

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 91/210 (43%), Gaps = 54/210 (25%)

Query: 39  KQIWFEFSLTMIW-------FSYYLAIYTLPGQPL----------------PNFQPSKNS 75
           K I + F +TM+W       ++Y  A    PG P                   F P   S
Sbjct: 32  KWINYTFMITMLWSLYLIGYYAYVQAFMVGPGSPSDFPELRVNSIEAAEAGTEFPPEYLS 91

Query: 76  WKS----------YCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMR 125
            KS           C+ C  +KP+R HHC +C++C+L MDHHCPW   C+G+ N  +F+ 
Sbjct: 92  QKSITLKHDGRARVCRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFIN 151

Query: 126 FLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWN-KSELIFLTILIPMDGFILLTISI- 183
           FL   I  + Y  + +CL          S   LWN  S+  ++T LI +   +L  +S+ 
Sbjct: 152 FL---IYNSLYATF-VCLI---------SSKELWNWFSQEKYVTELINIHLLLLFIVSLI 198

Query: 184 ------LFIRCLSNQIFCGRTQIETWEYER 207
                 LF      Q+   RT IE + Y R
Sbjct: 199 TSVSMTLFTAYSIYQVLINRTTIELYAYRR 228

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 73/141 (51%), Gaps = 11/141 (7%)

Query: 73  KNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFW--V 130
           +N    +C+ C  +KP+R HHC  C +C L MDHHCPW  +CVGY N  +F++FL +  V
Sbjct: 99  RNGRFRFCRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLIYGTV 158

Query: 131 IATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLTISIL-FIRCL 189
            +   +LL    L  +F    +N         E+I L +L+     + ++IS+L F    
Sbjct: 159 FSILIFLLSGTELLLWFKNQRYN--------QEMIQLPLLVVWILSVAISISMLAFTSYT 210

Query: 190 SNQIFCGRTQIETWEYERLEG 210
              I   +T IE +E+  L+ 
Sbjct: 211 VYLITKNQTTIEMYEWSNLKA 231

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 56/93 (60%), Gaps = 6/93 (6%)

Query: 79  YCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLL 138
           +C+ C  +KP+R HHC  CN+C L MDHHCPW  +CVG+ N   F++FL +   TT Y L
Sbjct: 104 FCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAY---TTVYSL 160

Query: 139 YELCLRAYFILSNHNSPTYLWNKSELIFLTILI 171
           Y L + +  + S      Y   KSEL+ L +L+
Sbjct: 161 YVLLMTSAQLYSWFRQMKY---KSELLDLHLLV 190

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 74/153 (48%), Gaps = 20/153 (13%)

Query: 54  YYLAIYTLPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKN 113
           YY +I +LP  P  N  P       YC  CR ++P RA HC TC  CV+  DHHC W  N
Sbjct: 157 YYSSI-SLP-TPKSNVDPLSKIDIRYCTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNN 214

Query: 114 CVGYYNFPHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPM 173
           CVG  N+ +F+ FL       G +L EL L A       N   ++  +S  + +TIL+  
Sbjct: 215 CVGQRNYRYFIIFLI------GTVLAELFLIA-------NCSIHIARRSSQVPVTILL-- 259

Query: 174 DGFILLTISILF-IRCLSNQIFCGRTQIETWEY 205
              +   +SIL+    L   +F   TQ  T E+
Sbjct: 260 --LVYACLSILYPAILLGYHVFMTGTQQTTREF 290

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 44/73 (60%), Gaps = 2/73 (2%)

Query: 59  YTLPGQPLP--NFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVG 116
           + LP Q L   +     N     C+ C  +KP+R+HHC TCN+CVL MDHHCPW   C+G
Sbjct: 87  FELPPQFLSQNSLTIKNNGRPRVCRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIG 146

Query: 117 YYNFPHFMRFLFW 129
           + N   F++FL +
Sbjct: 147 FKNQKFFIQFLIY 159

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 37/51 (72%)

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWV 130
           C+ C  +KP+R HHC  CN+C+L MDHHCPW  +CVG+ N  +F++FL + 
Sbjct: 108 CRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLMYA 158

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 81/175 (46%), Gaps = 37/175 (21%)

Query: 46  SLTMIWFSYYLAIYTLPGQPLP-------NFQPSKNSWK-------------------SY 79
           +LT+  ++YY  I   PG PL        + + ++N  +                     
Sbjct: 46  TLTVALYTYYKVISRGPGSPLDFPDLIVHDLKAAENGLELPPEYISKRCMTLKHDGRFRV 105

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLY 139
           C+ C  +KP+R HHC +C+ CVL MDHHCPW   C G+ N   F++FL +   TT Y   
Sbjct: 106 CQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMY---TTCYAFL 162

Query: 140 ELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLTISILFIRCLSNQIF 194
            L    Y + +  NS ++     ELI   +L    G  LL +++ FI  L+  +F
Sbjct: 163 VLIYTCYELGTWFNSGSF---NRELIDFQLL----GVALLAVAV-FITVLAFTVF 209

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 7/68 (10%)

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFW-------VIA 132
           C+ C+ +KP+R+HHC +CN+C L MDHHCPW  +C+G+ N   F++FL +       V  
Sbjct: 105 CRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLYTTWYAVFVFM 164

Query: 133 TTGYLLYE 140
           TTG  L++
Sbjct: 165 TTGLQLWK 172

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 69/157 (43%), Gaps = 20/157 (12%)

Query: 55  YLAIYTLP-GQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKN 113
           Y  + TLP G PL       N    YC  CR ++P RA HC TC  C++  DHHC W  N
Sbjct: 151 YYNMITLPTGNPLI-----ANIEVKYCTTCRIWRPPRASHCSTCEACIITHDHHCKWVNN 205

Query: 114 CVGYYNFPHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPM 173
           C+G  N+ +F  FL   +  T +++    +R    +   ++P  +     L+    L+  
Sbjct: 206 CIGQRNYHYFFTFLVSCVIATAFIIANCAIRVSRSVHAKDAPVAIL----LLIYCGLVVC 261

Query: 174 DGFILLTISILFIRCLSNQIFCGRTQIETWEYERLEG 210
             FILL             IF   +Q  T EY +  G
Sbjct: 262 YPFILLVY----------HIFLTGSQQTTREYLKSIG 288

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 91/207 (43%), Gaps = 40/207 (19%)

Query: 35  LSTQKQIWFEFSLTMIWF-------SYYLAIYTLPGQPL--------------------P 67
           L+   QIW++F +++  F       +YY  I T PG PL                    P
Sbjct: 29  LTRINQIWYKFLVSVDVFLVAIGLYTYYKVIITGPGSPLDYDTIKVYDMQAVESGAELPP 88

Query: 68  NF------QPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFP 121
            F         ++     C+ C  +KP+R HHC  C++C+L MDHHCPW   C+G+ N  
Sbjct: 89  EFLSRRSITTKRDGRFRVCRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQR 148

Query: 122 HFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLTI 181
            F+++L +    T Y +      +  +L   N+  Y   + ELI   +L      + +++
Sbjct: 149 FFIQYLLY---ATTYSIVIFLFSSIQLLHWFNTKQY---EVELIDFHLLSVWLLGVAVSV 202

Query: 182 SILFIRCLS-NQIFCGRTQIETWEYER 207
           S+ F    S  Q+   +T +E   Y R
Sbjct: 203 SLSFFTGFSIYQVTKNQTTVEMHIYRR 229

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 84/189 (44%), Gaps = 33/189 (17%)

Query: 46  SLTMIWFSYYLAIYTLPGQPLP-------NFQPSKNSWK-------------------SY 79
           +L +  ++YY  I T PG PL        + + ++N  +                     
Sbjct: 46  TLMVALYTYYKVISTGPGSPLDFPDLLVHDLKAAENGLELPPEYMSKRCMTLKRDGRFRV 105

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLY 139
           C+ C  +KP+R HHC +C+ C+L MDHHCPW   C G+ N   F++FL +   TT Y   
Sbjct: 106 CQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLMY---TTFYAFL 162

Query: 140 ELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLTISILFIRCLS-NQIFCGRT 198
            L    Y + +  NS ++     ELI L +L      I + IS+L     S  Q+   +T
Sbjct: 163 VLIDTCYELGTWFNSGSF---SRELIDLHLLGTALLAIAVFISVLAFSAFSIYQVCNNQT 219

Query: 199 QIETWEYER 207
            IE     R
Sbjct: 220 TIELHSMRR 228

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 82/189 (43%), Gaps = 33/189 (17%)

Query: 46  SLTMIWFSYYLAIYTLPGQPLP-------NFQPSKNSWK-------------------SY 79
           +L +  ++YY  I   PG PL        + + ++N  +                     
Sbjct: 46  TLAVALYTYYKVIARGPGSPLDFPDLLVHDLKAAENGLELPPEYMSKRCLTLKHDGRFRV 105

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLY 139
           C+ C  +KP+R HHC +C+ C+L MDHHCPW   C G+ N   F++FL +   TT Y   
Sbjct: 106 CQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMY---TTLYAFL 162

Query: 140 ELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLTISILFIRCLSNQIFC-GRT 198
            L    Y + +  NS ++     ELI   +L      + + IS+L   C S    C  +T
Sbjct: 163 VLIYTCYELGTWFNSGSF---NRELIDFHLLGVALLAVAVFISVLAFTCFSIYQVCKNQT 219

Query: 199 QIETWEYER 207
            IE     R
Sbjct: 220 TIEVHGMRR 228

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 66/146 (45%), Gaps = 14/146 (9%)

Query: 66  LPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMR 125
           LP F    N    YCK CR ++P R+ HC  C  CVL  DHHC W  NCVG  N+ +F+ 
Sbjct: 170 LPTFHTDCNIVLKYCKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLT 229

Query: 126 FLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLTISILF 185
           FL     T+ +L+    +         ++P           + +L+ + GF+ +   ++ 
Sbjct: 230 FLTSSTLTSIFLIVNAAIDVARTPDVTDTP-----------VAVLLIVYGFLTIWYPMIL 278

Query: 186 IRCLSNQIFCGRTQIETWEYERLEGL 211
              L   +F   TQ  T EY +  G 
Sbjct: 279 ---LMYHVFMTGTQQTTREYLKQIGF 301

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 73.6 bits (179), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 50/94 (53%), Gaps = 9/94 (9%)

Query: 53  SYYLAIYTLPGQPLPNFQPSKNS--WKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPW 110
           S Y +I TLP         S NS     YC  CR ++P RA HC TCN C++  DHHC W
Sbjct: 167 SEYYSIITLPSS-------STNSPIQLKYCTTCRIWRPLRASHCSTCNSCIMTFDHHCIW 219

Query: 111 TKNCVGYYNFPHFMRFLFWVIATTGYLLYELCLR 144
             NCVG  N+ +F+ F++  + T   L+    +R
Sbjct: 220 VNNCVGQRNYRYFLTFIYSAVLTIILLVINCSVR 253

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 73.6 bits (179), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 87/194 (44%), Gaps = 43/194 (22%)

Query: 46  SLTMIWFSYYLAIYTLPGQPLP-------NFQPSKNSWK-------------------SY 79
           +L +  ++Y+ AI   PG PL        + Q ++N  +                     
Sbjct: 46  TLLVALYTYFKAIAKGPGSPLDFPDLLVHDLQAAENGLELPPEYMSKRCMTLKHDGRFRV 105

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLY 139
           C+ C  +KP+R HHC +C+ C+L MDHHCPW   C G+ N   F++FL +   TT Y   
Sbjct: 106 CQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMY---TTFYAFL 162

Query: 140 ELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLTISILFIRCLS------NQI 193
            L    Y + +  +S ++     ELI   +L    G  LL I+I FI  L+       Q+
Sbjct: 163 VLIYSCYELGTWFHSGSF---NQELIDFHLL----GVALLAIAI-FISVLAFTAFSIYQV 214

Query: 194 FCGRTQIETWEYER 207
              +T IE +   R
Sbjct: 215 CNNQTTIELYGMRR 228

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 73/151 (48%), Gaps = 15/151 (9%)

Query: 79  YCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLL 138
           YC+ CR ++P R  HC TCN CV+  DHHC W  NCVG  N+  F+ FL   I ++ +LL
Sbjct: 174 YCQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFSSVFLL 233

Query: 139 YELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLTISILFIRCLSNQIFCGRT 198
                 A  I    + P     ++  + L +LI   G  +   +ILF    +  IF   T
Sbjct: 234 TNC---AIHIARESDGP-----RNYPVALLLLI-YAGLTIWYPAILF----TYHIFMAGT 280

Query: 199 QIETWEYERLEGLYYSKRLLPHLLANFWELY 229
           Q  T E+  L+G+   K  + H +     +Y
Sbjct: 281 QQTTREF--LKGIGSKKNPVFHRVVKEQNIY 309

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 46/84 (54%), Gaps = 4/84 (4%)

Query: 55  YLAIYTLPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNC 114
           Y  + TLP         SK+    YC+ CR ++P R+ HC TCN CV+  DHHC W  NC
Sbjct: 154 YYNLITLPTHS----SVSKDITIKYCQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNC 209

Query: 115 VGYYNFPHFMRFLFWVIATTGYLL 138
           +G  N+  F+ FL   + ++  LL
Sbjct: 210 IGKRNYRFFLVFLLSAVISSIILL 233

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 38/57 (66%)

Query: 73  KNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFW 129
           +N    YC  C  +KP+R+HHC +CN+C L  DHHCPW  +C+G+ N   F++FL +
Sbjct: 103 QNGRYRYCATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMY 159

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 39/72 (54%)

Query: 66  LPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMR 125
           LP  Q S +    YC  C+ ++P RA HC+ C  CV   DHHC W  NCVG  N+ +F+ 
Sbjct: 172 LPTAQRSAHVEVKYCTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLT 231

Query: 126 FLFWVIATTGYL 137
           FL    AT   L
Sbjct: 232 FLTATCATCTVL 243

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 34/63 (53%)

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLY 139
           C  CR  KP R+ HC  CN+C+L  DHHC W  NC+G  N+  F  FL   I +  Y   
Sbjct: 136 CSTCRITKPARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFYLFLISNIVSMSYAFL 195

Query: 140 ELC 142
            LC
Sbjct: 196 RLC 198

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 40/68 (58%)

Query: 79  YCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLL 138
           YC  CR ++P RA HC TC  C+L  DHHC W  NC+G  N+ +F+ FL   I ++ +L+
Sbjct: 180 YCTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLASAILSSIFLI 239

Query: 139 YELCLRAY 146
               +  Y
Sbjct: 240 ANCSIHIY 247

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 71/145 (48%), Gaps = 14/145 (9%)

Query: 66  LPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMR 125
           LP   P+ +    YC+ CR ++P R+ HC  C+ CVL+ DHHC W  NC+G  N+  F+ 
Sbjct: 160 LPTKNPNASVSMKYCQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLE 219

Query: 126 FLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLTISILF 185
           FL  + +T   +L  L L + F LS   SP   +    L    ++I   G  +    ILF
Sbjct: 220 FL--MASTISCIL--LILLSSFRLS--YSPQVRYTPVSL----LIICYCGLGIWYPLILF 269

Query: 186 IRCLSNQIFCGRTQIETWEYERLEG 210
           I      IF   TQ  T EY R  G
Sbjct: 270 IY----HIFLAGTQQTTHEYLRSIG 290

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 41/61 (67%)

Query: 78  SYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYL 137
           +YC+ CR ++P R+ HC  C+ CV+++DHHC W  NCVG  N+ +F+ FL   I T  +L
Sbjct: 194 TYCRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIFLTSTIMTVIFL 253

Query: 138 L 138
           L
Sbjct: 254 L 254

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 55  YLAIYTLPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNC 114
           Y  + TLP         SK+    YC  CR ++P R+ HC TCN CV+  DHHC W  NC
Sbjct: 154 YYNLITLPTHS----SISKDITIKYCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNC 209

Query: 115 VGYYNFPHFMRFLFWVIATTGYLL 138
           +G  N+  F+ FL   I ++  LL
Sbjct: 210 IGKRNYRFFLIFLLGAILSSVILL 233

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 49/108 (45%), Gaps = 26/108 (24%)

Query: 49  MIWFSYYLAIYTLPGQPL--------------------PNFQPSKN------SWKSYCKK 82
           +I ++Y+  I   PG PL                    P+F  +K           YC K
Sbjct: 114 LILYAYFSTIAVGPGSPLDFEELRIRDLNDVETGMEFPPDFLAAKTVTLDSTGRHRYCVK 173

Query: 83  CRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWV 130
           C+ +KP+R HHC  C++C L  DHHC W   C+GY N   F+ FL + 
Sbjct: 174 CKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYA 221

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 56/104 (53%), Gaps = 5/104 (4%)

Query: 55  YLAIYTLPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNC 114
           Y +I TLP  P+ N  P +     YC  CR ++P RA HC  C+ C+L+ DHHC W  NC
Sbjct: 167 YYSIITLPS-PVAN-APVR---LKYCTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNC 221

Query: 115 VGYYNFPHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYL 158
           +G  N  +F+ FLF  + ++ +LL    L+     S   +P  L
Sbjct: 222 IGQRNHRYFLAFLFSSVLSSIWLLTCCALKLRHAGSPSAAPVSL 265

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 70.5 bits (171), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLY 139
           C  CR  K  R+ HC  CN+CVL  DHHC W  NC+G  N+  F  FLF  I +  Y   
Sbjct: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAF- 194

Query: 140 ELCLRAYFILSNHNS 154
              LR YFI  N  +
Sbjct: 195 ---LRLYFISFNSTA 206

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 59  YTLPGQPLPNFQPSKNS-WKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGY 117
           Y L   P+    P+ +S    YC+ CR ++P RA HC  C  CV+  DHHC W  NCVG 
Sbjct: 156 YNLINLPITRGNPNGDSILMKYCRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQ 215

Query: 118 YNFPHFMRFLFWVIATTGYLL 138
            N+ +F+ FL      + +LL
Sbjct: 216 RNYRYFVTFLISGTLASIFLL 236

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 44/84 (52%), Gaps = 4/84 (4%)

Query: 55  YLAIYTLPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNC 114
           Y  + TLP  P        +    YC  CR ++P R+ HC TCN CV+  DHHC W  NC
Sbjct: 154 YYNLITLPTHP----SVHNDITIKYCTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNC 209

Query: 115 VGYYNFPHFMRFLFWVIATTGYLL 138
           +G  N+  F+ FL   I ++  LL
Sbjct: 210 IGKRNYRFFLIFLLSAIFSSILLL 233

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 42/86 (48%), Gaps = 12/86 (13%)

Query: 55  YLAIYTLPGQPLPNFQPSKNSWKSY------------CKKCRNYKPERAHHCKTCNQCVL 102
           +  I T+   P      S +S K Y            CK C+  KP R+ HC  C+QC+L
Sbjct: 100 FFGIITMLINPDTALMYSNDSIKKYAYDRILYFPDTECKTCKVEKPARSKHCAVCDQCIL 159

Query: 103 AMDHHCPWTKNCVGYYNFPHFMRFLF 128
             DHHC W  NC+G  NF +F  FLF
Sbjct: 160 VNDHHCVWVNNCIGRGNFLYFYLFLF 185

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 66  LPNFQP-SKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFM 124
           LP+  P  K     YC  CR ++P RA HC TC  CVL  DHHC W  NC+G  N+ +F+
Sbjct: 163 LPSAHPEGKTVDVKYCATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFL 222

Query: 125 RFL 127
            FL
Sbjct: 223 TFL 225

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (68%)

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFL 127
           C+ C++YKP R+ HC  C++CVL  DHHC W  NCVG  N+ +F  FL
Sbjct: 137 CRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFL 184

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 33/48 (68%)

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFL 127
           C+ C+  KP R+ HC  CNQCVLA+DHHC W  NCVG  N+ +F  FL
Sbjct: 135 CRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFL 182

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 36/66 (54%)

Query: 78  SYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYL 137
           ++C  CR  KP R+ HC  CN+CVL  DHHC W  NC+G  N+ +F  FL       GY 
Sbjct: 135 TFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYA 194

Query: 138 LYELCL 143
              + L
Sbjct: 195 FLRIIL 200

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 55/116 (47%), Gaps = 15/116 (12%)

Query: 27  HYFILSNFLSTQKQIWFEFSLTM-IWFSY--YLAIYTLPGQPLPNFQPSKNSWKSY---- 79
           +Y +  NF+      WFE  L + I F+   Y  + T+  +P  + +   NS   Y    
Sbjct: 67  YYHLRVNFMVNPHLYWFEKGLILPIMFTSLPYFGVMTMITKPENSIEHGINSNNRYRFDE 126

Query: 80  --------CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFL 127
                   CK CR  KP R+ HC  C++C+L  DHHC W  NC+G  N+  F  F+
Sbjct: 127 ILYFPNVSCKTCRKPKPARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYLFI 182

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 57/132 (43%), Gaps = 24/132 (18%)

Query: 79  YCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLL 138
           YC  CR ++P RA HC  C  C+L  DHHC W  NC+G  N+ +F+ FL      + +L 
Sbjct: 172 YCPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFL-----VSSWLT 226

Query: 139 YELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLTISILFIRC-----LSNQI 193
             +C+ +  I   H               T L+ +   ILL I      C     L   +
Sbjct: 227 AVICIVSCAIRIAHA--------------TRLVKVAVAILLLIYCALCSCYPFLLLLYHV 272

Query: 194 FCGRTQIETWEY 205
           F   TQ  T EY
Sbjct: 273 FLTSTQQTTREY 284

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score = 67.4 bits (163), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 56/108 (51%), Gaps = 10/108 (9%)

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLY 139
           C+ CR  K  R+ HC  C +C+L  DHHC W  NC+G  N+ +F  FL    +   Y   
Sbjct: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYATI 192

Query: 140 ELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLTISILFIR 187
            L         +  +P+ LW +S   FL+++I +  F +++IS  +++
Sbjct: 193 RL---------SSVAPSGLW-RSNKSFLSLMILVCCFAVISISFTYMQ 230

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 38/73 (52%)

Query: 66  LPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMR 125
           LP   P       YC  CR ++P R+ HC  C  C++  DHHC W  NC+G  N+  F+ 
Sbjct: 203 LPTGNPESTINIKYCTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLT 262

Query: 126 FLFWVIATTGYLL 138
           FL     T+ +L+
Sbjct: 263 FLLSGTFTSIFLI 275

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 34/62 (54%)

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLY 139
           C+ C   KP R+ HC  CN+C+L +DHHC W  NC+G  N+ +F  FL   +    Y   
Sbjct: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191

Query: 140 EL 141
            L
Sbjct: 192 RL 193

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLY 139
           C  CR  KP R+ HC  CN+CVL  DHHC W  NC+G  N+  F  FL   I +  Y   
Sbjct: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAF- 194

Query: 140 ELCLRAYFILSNHNS 154
              LR ++I  N  S
Sbjct: 195 ---LRLWYISLNSTS 206

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 45/91 (49%), Gaps = 3/91 (3%)

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLY 139
           C+ C+  KP R+ HC  CN C+   DHHC W  NCVG  N+ +F  FL   +    Y   
Sbjct: 136 CRTCKQVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFLCSNLLLLSYSFI 195

Query: 140 ELCLRAYFILSNHNSPTYLWNKSELIFLTIL 170
            L    +   + + +PT    +  L+ L+IL
Sbjct: 196 RLIFIQFNKSAYNTTPT---GEKSLLILSIL 223

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 41/80 (51%)

Query: 79  YCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLL 138
           YC  C  ++P RA HC  C  C+   DHHC W  NCVG  N+ +F+ FL   I ++ +++
Sbjct: 189 YCSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNRNYRYFIIFLVGAILSSIFII 248

Query: 139 YELCLRAYFILSNHNSPTYL 158
               +    I    N+P  +
Sbjct: 249 INCSIHVARIRRASNAPVAI 268

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 46/91 (50%), Gaps = 5/91 (5%)

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLY 139
           C+ C   KP R+ HC  C +CVL  DHHC W  NC+G  N+  F  FL   + +  Y   
Sbjct: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGF- 196

Query: 140 ELCLRAYFILSNHNSPTYLWNKSELIFLTIL 170
              LR  +I    +    ++ +S LIF TIL
Sbjct: 197 ---LRVLWISVMKDPSMVVYPRSILIF-TIL 223

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 77/193 (39%), Gaps = 29/193 (15%)

Query: 4   QLKWPFLGIAIPCFLISFIGYNAHYF-------ILSNFLSTQKQIWFEFSLTMIWFSYYL 56
           + +W F   AIP F +S   Y    F       I S     ++ +    +L+    +  L
Sbjct: 47  RFRWKFR--AIPAFYLSIYAYCTFLFFKDIEGLIRSRLFGVERLLIIPVALSAPIITGLL 104

Query: 57  AIYTLPGQPLPNFQPSKNSWKSY-------CKKCRNYKPERAHHCKTCNQCVLAMDHHCP 109
            I+  P     +  P  +++          C+ C+  K  R  HC  C+QCV   DHHC 
Sbjct: 105 TIWIKPKSTYAS--PMLDAYDELIFHSGVSCRTCKLPKFARTKHCPICDQCVQLADHHCV 162

Query: 110 WTKNCVGYYNFPHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTI 169
           W  NC+G  N+ +F  FL   +  T Y    L     F+ S            +L+ L+I
Sbjct: 163 WANNCIGRGNYQYFYLFLVSNVFLTNYGFLRLLFLQRFVHSR-----------QLLILSI 211

Query: 170 LIPMDGFILLTIS 182
           L+   G IL   S
Sbjct: 212 LLGCFGVILAVFS 224

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 51/108 (47%), Gaps = 10/108 (9%)

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLY 139
           C+ C   KP R+ HC+ CN C+L  DHHC W  NC+G  N+ +F  FL     T  Y   
Sbjct: 139 CRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMTYSF- 197

Query: 140 ELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLTISILFIR 187
              +R + +    ++P      S    LT+LI    F ++     F++
Sbjct: 198 ---IRLFLMYCQGHAP------SSRNILTLLILCGSFAVICAGFTFLQ 236

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 64.3 bits (155), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 31/50 (62%)

Query: 79  YCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLF 128
           YC  C+ ++P RA HC  C  CVL  DHHC W  NCVG  N+ +F+ FL 
Sbjct: 159 YCHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLL 208

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 64  QPLPNFQPSKNSW--KSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFP 121
           Q  P FQP    +   + C+ C+  K  R+ HC  C +C+   DHHC W  NCVGY N+ 
Sbjct: 111 QAGPQFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYE 170

Query: 122 HFMRFL 127
           +F  FL
Sbjct: 171 YFYSFL 176

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 28/48 (58%)

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFL 127
           C  C   KP R+ HC  CN+C+L  DHHC W  NC+G  N+  F  FL
Sbjct: 136 CSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFL 183

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/298 (22%), Positives = 116/298 (38%), Gaps = 46/298 (15%)

Query: 60  TLPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYN 119
            +  +P   +Q  KN +  +C  C++ K  R+HH K   +C+L  DH+C W    +   N
Sbjct: 98  VISTKPPKYYQCDKNGYPPWCTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNN 157

Query: 120 FPHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILL 179
           +  F++++ W         + L L  Y++       T       +I   IL  +   + L
Sbjct: 158 YRLFLQYVGW---------FNLLLLWYWLTIAVFIRTIGMLNGNVIVGFILSCLGWMMTL 208

Query: 180 TISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELE- 238
            + I  I  +SN     +T IET + ER       KR    ++        E+    +E 
Sbjct: 209 GLFISHIYYMSNN----KTSIETLDAER------GKRKKHKMMVT----NDEIEHARIEY 254

Query: 239 --------DEASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSP-LFWLWPFGKPKGDG 289
                   ++  +      +  D           W N  EFLGS  +FWL+P+G      
Sbjct: 255 NRKYFCYYNQQDKFRYVVELTADEFAKCWKKRSFWINAREFLGSDIIFWLFPWGS----- 309

Query: 290 MFFP---KNDISEFEETNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIR 344
            +FP   K + S F+    +  L  +  P      +V+S    + +E  +  G  V +
Sbjct: 310 -YFPDLRKREASSFQSYGQSYDLENIIGP----YKEVLSSSAIDLIENRITQGNYVTK 362

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 30/62 (48%)

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLY 139
           C  C   KP R+ HC  C  C+L  DHHC W  NC+G  N+ +F  FL     +  Y   
Sbjct: 139 CSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLLLNTISLSYAFL 198

Query: 140 EL 141
            L
Sbjct: 199 RL 200

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 122/296 (41%), Gaps = 44/296 (14%)

Query: 65  PLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFM 124
           P   +Q   + +  +C +C++ K ER HH      C+   DH+C W    +G  N+  F+
Sbjct: 116 PPKCYQSDPHGYPIWCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFV 175

Query: 125 RFLFWVIATTGYLLYELCLRAYFILS-NHNSPTYLWNKSELIFLTILIPMDGFILLTISI 183
           +F  +       +   +C+    I   NHN   Y  N +  I  T++  + G+ LLT S+
Sbjct: 176 QFAAYFSTLLLIMWVSICVYIRIITQHNHN---YSPNLNANIISTLVFAILGW-LLTASL 231

Query: 184 LFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTREL---EDE 240
                L++ IF   +Q +T     LE +  SKR              +  TR++     E
Sbjct: 232 -----LASSIF-YMSQNKT----SLEAIIDSKR-------------KKFGTRKIFCYYSE 268

Query: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSP-LFWLWPFGKPKGDGMFFPKNDISE 299
           A++L            +F       +N  +F+GS  L W+ P GKP        K+D   
Sbjct: 269 ANKLRFVVEFDRSEFHSFWDKKSILANIKDFMGSNILMWIIPLGKPYTSRC---KSDGKS 325

Query: 300 FEETNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLV-DPRDPS 354
             +T L ++L        G  ++ +S     A+E  +  GE +   R   D  DP+
Sbjct: 326 GSKTTLVEIL--------GPYEETLSDYTIQAIEDKISRGEYLATLRASGDDSDPA 373

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 93/228 (40%), Gaps = 39/228 (17%)

Query: 69  FQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLF 128
           +Q     +  +C  C++ K ER+HH +    CV   DH+C W    +G  N+  FM+++ 
Sbjct: 116 YQCDPQGYPMWCSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFMQYVM 175

Query: 129 WVIATTGYLLYELCLRAYFI--LSNHNSPTYLWNKSELIFLTILIPMDGFILLTISILFI 186
           +    T YL+      A F+  + ++N    L     +I L IL+    F +  +  +F 
Sbjct: 176 YF---TIYLVTASLTIALFMKRIVDYNKEHDLTLNLNIIVLFILVLAFAFFVTPLFAVF- 231

Query: 187 RCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELED----EAS 242
              S  + C RT ++  +          K +  H  A F    PE R R + D    E  
Sbjct: 232 ---SFYMSCNRTSLDIIQ---------KKAIKRHRKAYFCVYNPEDRYRYVVDCLPAEQY 279

Query: 243 RLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLW--PFGKPKGD 288
            +  +R              + W N  EF+GS + WLW  P G    D
Sbjct: 280 NIWNKR--------------NAWLNIKEFIGSNI-WLWFIPIGTNISD 312

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 98/228 (42%), Gaps = 36/228 (15%)

Query: 65  PLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFM 124
           P   +Q   N +  +C  C++ K ER+HH      C+   DH+C W    +G  N+  F+
Sbjct: 116 PPKCYQSDPNGYPIWCSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFV 175

Query: 125 RFLFWVIATTGYLLYELCLRAYFILS---NHNSPTYLWNKSELIFLTILIPMDGFILLTI 181
           +F  +  +    +   +C+    I     NHNSP      +  +FLT+   + G++  T 
Sbjct: 176 QFTGYFSSLLLIMWVSICVFIRNITQHHHNHNSPL-----NANVFLTLAFAIFGWLFTT- 229

Query: 182 SILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTREL---E 238
                  L++ IF    Q +T+    LE +  SKR       NF        TR++    
Sbjct: 230 -----SMLASNIF-YMCQNKTY----LEAIMDSKR------KNF-------GTRKIFCYY 266

Query: 239 DEASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLG-SPLFWLWPFGKP 285
            EA++L            +F      ++N  +F+G + L WL PFGKP
Sbjct: 267 SEANKLRFVVEFERTEFHSFWSKKTIFANIKDFMGPNMLMWLIPFGKP 314

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 26/44 (59%)

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHF 123
           C+ CR  KP R+ HC  C +CV   DHHC W  NCVG  N+  F
Sbjct: 126 CRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLF 169

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%)

Query: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGY 136
           C+ C+  K  R+ HC  C +C    DHHC W  NC+G  N+ +F  FL   +  T Y
Sbjct: 131 CRTCKMPKYARSKHCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFLASNVFLTVY 187

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 34/73 (46%)

Query: 65  PLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFM 124
           P   +Q   N +  +C  C   K  R+HH    N C+   DH+C W    +G  N+  F+
Sbjct: 104 PAKLYQCDSNGYPRWCSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIGKDNYKQFV 163

Query: 125 RFLFWVIATTGYL 137
            FLF+   + G +
Sbjct: 164 IFLFYCTVSFGIM 176

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 103/254 (40%), Gaps = 38/254 (14%)

Query: 65  PLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFM 124
           P   +Q   + +  +C  C++ K ER HH      CV   DH+C W    +G  N+  F+
Sbjct: 117 PPKCYQSDPHGYPIWCSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFV 176

Query: 125 RFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLTISIL 184
           +F+ +       +   +C+    I   H+S     N +  + LT+   + G++L T +  
Sbjct: 177 QFVAYFSILLLIMWASICVYTKEITQRHHSQGPRINVN--VMLTLAFAILGWLLTTST-- 232

Query: 185 FIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTREL---EDEA 241
               L + IF   +Q +T     LE +  SKR              +  TR++     E+
Sbjct: 233 ----LGSAIFY-MSQNKT----SLEAIMDSKR-------------KKFGTRKIFSYYSES 270

Query: 242 SRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLG-SPLFWLWPFGKP-----KGDGMFFPKN 295
           ++L             F       +N  +F+G + L WL P GKP     K D +    N
Sbjct: 271 NKLRFVVEFDRSEFHAFWSKKTILANVKDFMGPNMLMWLIPLGKPFILSSKTDEV---DN 327

Query: 296 DISEFEETNLTDML 309
            +   +   LT++L
Sbjct: 328 SLPSGQRVTLTEIL 341

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 37/84 (44%), Gaps = 12/84 (14%)

Query: 56  LAIYTLP---GQPLPNFQPSKNSW---------KSYCKKCRNYKPERAHHCKTCNQCVLA 103
           L ++T P   G       PS+  W          + C+ C   K  R+ HC  C +C+  
Sbjct: 103 LTMFTRPEGCGGRDQGVAPSEGQWPYDGILYYPNTTCRSCHTVKWARSKHCSICRRCIQL 162

Query: 104 MDHHCPWTKNCVGYYNFPHFMRFL 127
            DHHC W   C+G  NF +F  FL
Sbjct: 163 ADHHCIWFNTCIGRGNFFYFYVFL 186

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 91/229 (39%), Gaps = 33/229 (14%)

Query: 79  YCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLL 138
           +C  C + K ERAHH      CV   DH C W    +G  N+  F++F+ ++   + ++ 
Sbjct: 126 WCSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFIQFVMYMAILSLFVF 185

Query: 139 YELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFI-LLTISILFIRCLSNQIFCGR 197
             +C     I+ + ++   L N + ++ L I +    F  L+T S+L    +   I    
Sbjct: 186 VPICAFIRRIIHDGDTQHSL-NPNLIVILIIAV----FAWLMTTSMLVTHAVC--IVTNT 238

Query: 198 TQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDEASRLSTRRRIGLDHLVN 257
           T +E     R +   +++ +  +          +L+  EL       S  R+        
Sbjct: 239 TSVEV--MARRDDSSFNRTVCYYSFKAGMRYVVQLKNNELH------SLWRK-------- 282

Query: 258 FPYDIDPWSNTIEFLGSP-LFWLWPFGKPKGDGMFFPKNDISEFEETNL 305
                D W N ++FLGS  L W  P      +    P  D+ E +   L
Sbjct: 283 ----KDLWLNMVDFLGSNMLLWFLPLRSNDNE----PNQDLEEMDNKVL 323

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 91/215 (42%), Gaps = 35/215 (16%)

Query: 74  NSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIAT 133
           N +  +C  C++ K  R HH K    C+   DHHC W    +G  N+  F +F+F+   +
Sbjct: 118 NGYPIWCDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQFVFYF--S 175

Query: 134 TGYLLYELCLRAYFI-LSNHNSPTYLWNKSELIFLTILIPMDGFILLTISILFIRCLSNQ 192
              L++ + + +Y   + ++    Y  + + ++ L + +P   F ++T+S+         
Sbjct: 176 CLLLIFWISIVSYIKRIVDYPHTGYKLDPNLIVILILSVP---FSIMTLSLFLSHVYFT- 231

Query: 193 IFCGRTQIETWEYERLEGLYYSKRL--LPHLLANFW--ELYPELRTRELEDEASRLSTRR 248
            F  RT +E    +R + L   K +  L     N +  E+ PE        + + +  +R
Sbjct: 232 -FMNRTSLEIINIKRNKKLNIKKFVCYLDKTSGNRYVIEMSPE--------DMANIWKKR 282

Query: 249 RIGLDHLVNFPYDIDPWSNTIEFLGSP-LFWLWPF 282
            I              W N  E LG+  LFW  PF
Sbjct: 283 SI--------------WENFKEVLGNNFLFWFIPF 303

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/236 (22%), Positives = 92/236 (38%), Gaps = 26/236 (11%)

Query: 65  PLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFM 124
           P   +Q   + +  +C +C++ K ER HH      CV   DH+C W    +G  N+  F+
Sbjct: 108 PPITYQCDPHGYPFWCSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFL 167

Query: 125 RFLFWVIATTGYLLYELCLRAYFILSNH-NSPTYLWNKSELIFLTILIPMDGFILLTISI 183
           +F+ +       +   +    + I+    N P + +N + +I L   I   G+ L T+ +
Sbjct: 168 QFVAYYAINLSIIWVSIVSYIHMIIRKRPNQPHHHFNTNLIIILVFAIL--GW-LFTVGL 224

Query: 184 LFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDEASR 243
            F       I   RT +E    +  +     K+ + H        Y ++       E + 
Sbjct: 225 FFANIY--YISKNRTSLEMLLQKHKKNSPLKKKFICH--------YSKINKSRYVVEFTN 274

Query: 244 LSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSP-LFWL--WPFGKPKGDGMFFPKND 296
                    D   +F      ++N  EFLGS  LFW    P  + K    FF  N+
Sbjct: 275 ---------DGFFDFWNKSKIYTNIKEFLGSNILFWFIPLPMNRYKSSPPFFINNN 321

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 93/240 (38%), Gaps = 29/240 (12%)

Query: 69  FQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLF 128
           +Q   N +  +C  C++ K ERAHH +    CV   DH C +  + +G  N+  F+++  
Sbjct: 116 YQCDPNGYPIWCTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQYCV 175

Query: 129 WVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLTISILFIRC 188
           ++      +   +      I  ++       N +    + ILI    F +   S+L  + 
Sbjct: 176 FMTIWLAIIWTSIVAYIRSITRDYRGHGSHLNGN---LIAILILTTLFWITVTSLLLTQL 232

Query: 189 LSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDEASRLSTRR 248
             N I   +T IE  E  R +     K    +   +      EL  +E E   S+ S   
Sbjct: 233 --NCIVKNKTSIEVMERRR-KAFSTRKMFCYYNPDDGCRYVVELNKKEYESCWSKDSW-- 287

Query: 249 RIGLDHLVNFPYDIDPWSNTIEFLGSPLF-WLWPFG----KPKGDGMFFPKNDISEFEET 303
                           W+N +E LGS +F W+ P+G    K K D     +ND S  E  
Sbjct: 288 ----------------WANAVESLGSNIFMWVIPWGTSVPKFKPDPEKNGRNDKSTIEAV 331

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%)

Query: 69  FQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLF 128
           +Q  +N + ++C  C++ K  R HH      CV   DH+C W    +G  N+  F++FL 
Sbjct: 115 YQCDENGYPTWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIGAGNYLLFIQFLV 174

Query: 129 WV 130
           ++
Sbjct: 175 YM 176

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 69/172 (40%), Gaps = 17/172 (9%)

Query: 69  FQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLF 128
           +Q     +  +C  C++ K ER HH  T   CV   DH+C W    VG  N+  F++F  
Sbjct: 116 YQCDPQGYPIWCSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQFSM 175

Query: 129 WVIATTGYLLYELC--LRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT------ 180
           +       +L  +C  L+     + H SP    N    I + +++   GF+++T      
Sbjct: 176 YFFFYFVIVLIPVCKYLKDIIHHNRHTSPPVNPN----ILVLLILCAIGFLMVTPLFLSH 231

Query: 181 -----ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWE 227
                +++  I  ++ +            Y + +G  Y  R LP     FW 
Sbjct: 232 TYYMAVNVSSIEIIAKKRASKAAPKYFCCYNQADGYRYVIRFLPGDPQAFWN 283

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 36/70 (51%)

Query: 60  TLPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYN 119
            +  +P   +Q   N +  +C  C++ K ER HH +    C+   DH+C W    +G  N
Sbjct: 97  VISTKPPLYYQCDPNGYPIWCTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNN 156

Query: 120 FPHFMRFLFW 129
           +  F++++F+
Sbjct: 157 YRLFIQYVFY 166

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 37/78 (47%)

Query: 64  QPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHF 123
           +P   +Q     +  +C  C++ K  R HH  T   C+   DH+C W    VG  N+  F
Sbjct: 109 KPPRIYQCDPQGYPIWCTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKNYRLF 168

Query: 124 MRFLFWVIATTGYLLYEL 141
           ++F F+    T Y++  +
Sbjct: 169 VQFAFYFWLFTIYMIASI 186

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%)

Query: 69  FQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLF 128
           +Q     +  +C  C++ K  R HH  T   C+   DH+C W    VG  N+  F++F F
Sbjct: 121 YQCDPQGYPIWCTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFVQFAF 180

Query: 129 W 129
           +
Sbjct: 181 Y 181

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 44/103 (42%), Gaps = 8/103 (7%)

Query: 69  FQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLF 128
            Q  K   KS+C +    KP R+ +    N  V   DH+CPW  N VG  N   F+ F  
Sbjct: 461 LQIGKFDTKSFCIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFI-FFI 519

Query: 129 WVIATTGYLLYELCLR-------AYFILSNHNSPTYLWNKSEL 164
             + +  +    LCL        AY  +S  NS  ++   S+L
Sbjct: 520 TSMESGIFTFLALCLEYFDELEDAYEEISQKNSKCFILGDSDL 562

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 51/112 (45%), Gaps = 2/112 (1%)

Query: 69  FQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLF 128
           +Q   + +  +C  C++ K ER HH      CV   DH+C W    +G  N+  F++F+ 
Sbjct: 126 YQCDPHGYPIWCSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFVQFVT 185

Query: 129 WVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180
           +  +    +   +C+    I   H       N +  + LT+ + + G+++ T
Sbjct: 186 YFSSLLLLMWLSICVYIRDITQRHRGHNPPLNVN--VILTLALALFGWLMNT 235

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 67  PN-FQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMR 125
           PN +Q   + +  +C  C++ K  R  H      CV   DH+C W    +G+ N+  F++
Sbjct: 102 PNCYQSDPHGYPVWCSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQ 161

Query: 126 FLFW 129
           F+F+
Sbjct: 162 FVFY 165

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 1/65 (1%)

Query: 67  PNFQP-SKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMR 125
           P+  P  +  +  +C  C++ K  R HH      CV   DH+C W    +G  N+  F++
Sbjct: 114 PDIYPCDERGYPIWCSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQ 173

Query: 126 FLFWV 130
           F F++
Sbjct: 174 FTFYL 178

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 70/167 (41%), Gaps = 23/167 (13%)

Query: 70  QPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFW 129
           Q  K    ++C +    KP R+ +       V   +H+CPW  N +G  N   FM F F 
Sbjct: 421 QIGKYDRNNFCVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGLKNHKLFMFFAFS 480

Query: 130 VIATTGYLLYELCLRAYFILSNH--------NSPTYLWNKS---------ELIFLTILIP 172
           V     +L   LCL  YF  +NH           T+L N++            FL I I 
Sbjct: 481 V-QYEMFLFMWLCLE-YFKKTNHIYEQVEEYAKCTFLKNETLCKGSNYDPSTFFLFIWIS 538

Query: 173 MDGFILLTISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLP 219
           M+ F+ L   +L ++C   QIF G T  E +   + E    +  L+P
Sbjct: 539 MN-FVWLG-GMLIVQCF--QIFKGITSPELYALIKEERKAEALNLIP 581

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 45/96 (46%), Gaps = 8/96 (8%)

Query: 77  KSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGY 136
           K++C +    KP R+ +    N  V   DH CPW  N VG  N  +F+ F+  V A  G 
Sbjct: 471 KNFCLESWTRKPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFILLVEA--GI 528

Query: 137 LLY-ELCLRAYFILSNH-----NSPTYLWNKSELIF 166
           + +  LC   +  L +H     N+  +L   ++L +
Sbjct: 529 ITFASLCFEYFDELKDHFEVNENTSCFLLGDNDLCY 564

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 44/103 (42%), Gaps = 13/103 (12%)

Query: 41  IWFEFSLTMIWFSYYLAIYTLPG--QPLPNFQPSKNS-----------WKSYCKKCRNYK 87
           I F   L  +   ++  +Y+ PG  +P  +F   +N             K++C +    K
Sbjct: 408 ILFVAVLGCVHLLFFQLVYSDPGVLEPETDFNEIRNKISELLKIGKFDTKNFCIETWQRK 467

Query: 88  PERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWV 130
           P R       ++ VL  DH+CPW  N VG  N   FM ++  V
Sbjct: 468 PLRCKFSSFHSRLVLRFDHYCPWVYNDVGLLNHKKFMYYVMSV 510

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 1/75 (1%)

Query: 72  SKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVI 131
            K    ++C +    KP R+ +    N  V   DH+CPW  N VG  N   F+ F+  + 
Sbjct: 456 GKYDTSNFCIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFILSME 515

Query: 132 ATTGYLLYELCLRAY 146
              G L   LCL  +
Sbjct: 516 TGIG-LFTSLCLEYF 529

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 3/71 (4%)

Query: 77  KSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGY 136
           K++C +    KP R+      N  V   DH+CPW  N VG  N   FM F+   +   G 
Sbjct: 468 KNFCIETWARKPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFI--TLMECGI 525

Query: 137 L-LYELCLRAY 146
           L  ++LCL  +
Sbjct: 526 LTFFKLCLEYF 536

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 77  KSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGY 136
           K++C +    KP R+      N  V   DH+CPW  N VG  N   F+ F   ++ +  +
Sbjct: 469 KNFCIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFI-FFIALMESGIF 527

Query: 137 LLYELCLRAY 146
             + LCL  +
Sbjct: 528 TFFALCLEYF 537

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 76/187 (40%), Gaps = 20/187 (10%)

Query: 69  FQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLF 128
            +  K   + +C +    KP R+         +   DH+CPW  N VG  N   F+ F+ 
Sbjct: 451 LKVGKYDTRHFCIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFVA 510

Query: 129 WVIATTGYLLYELCLRAYFILS------NHNSPTYLWNKSEL-------IFLTILIPMDG 175
            +I    ++   LCL  +  L       N +   +L   SEL       +F T+++    
Sbjct: 511 -LIEVAVWIFAHLCLEYFDELEDNYDDYNGDLKCFLIGDSELCAGLTYDLFTTLILLWAV 569

Query: 176 FILLTIS-ILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRT 234
           F  + +  ++F++    QIF G T    +EY +L        + P +   F+   PE   
Sbjct: 570 FQSIWVGCLVFVQAF--QIFKGVTN---YEYSKLMRDNKRINIDPAVANEFFSTAPEDLD 624

Query: 235 RELEDEA 241
            +L  E+
Sbjct: 625 ADLTTES 631

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 28/60 (46%)

Query: 69  FQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLF 128
           +Q     +  +C  C++ K  R HH      CV  +DH+C W    +G  N+  F +FL 
Sbjct: 111 YQCDTQGYPVWCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLM 170

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 40/90 (44%), Gaps = 3/90 (3%)

Query: 77  KSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGY 136
           K++C +    KP R+H        V   DH CPW  N +G  N  +FM F+  +     +
Sbjct: 454 KNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFIL-LTEVGIW 512

Query: 137 LLYELCLRAYFIL--SNHNSPTYLWNKSEL 164
               L ++ + IL  +N +   +L    EL
Sbjct: 513 FFISLTMKYFDILEDTNEDVACFLLGDDEL 542

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 26/56 (46%)

Query: 77  KSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIA 132
           + +C      KP R+   +     ++  DH CPW  N VG  N   F+ FL  +++
Sbjct: 451 RHFCVDTYKRKPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSLVS 506

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 36/83 (43%), Gaps = 2/83 (2%)

Query: 70  QPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFW 129
           Q  K   +++C +    KP R+         V   DH CPW  N +G  N   F+ F   
Sbjct: 435 QLGKFDRENFCVETLERKPLRSKFSPFSGALVARYDHFCPWVYNDIGLKNHKLFL-FFAL 493

Query: 130 VIATTGYLLYELCLRAYFILSNH 152
            +    +L   LCL AYF  +NH
Sbjct: 494 TVQYHMFLFMWLCL-AYFKRTNH 515

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 59/141 (41%), Gaps = 20/141 (14%)

Query: 77  KSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGY 136
           K++C +    KP R+      N  V   DH+CPW  N VG  N   F+ F   ++ +  +
Sbjct: 469 KNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFI-FFITLMESGIF 527

Query: 137 LLYELCLR-------AYFILSNHNSPTYLWNKSEL---------IFLTILIPMDGFILLT 180
               LCL        A+   S  N   ++   S+L         +FL +L  +   I + 
Sbjct: 528 TFLALCLEYFDELEDAHEDTSQKNGKCFILGASDLCSGLIYDRFVFLILLWALLQSIWVA 587

Query: 181 ISILFIRCLSNQIFCGRTQIE 201
            S++F++    QI  G T  E
Sbjct: 588 -SLIFVQAF--QICKGMTNTE 605

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 25/54 (46%)

Query: 77  KSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWV 130
           K++C +    KP R+      N  V   DH+CPW  N +G  N   F+  +  V
Sbjct: 461 KNFCIETWVKKPLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCILLV 514

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 40/100 (40%), Gaps = 13/100 (13%)

Query: 43  FEFSLTMIWFSYYLAIYTLPGQPLPN-------------FQPSKNSWKSYCKKCRNYKPE 89
           F  S+  + + +Y  I + PG+   N              +  K   + +C +    KP 
Sbjct: 418 FGVSIIGVIYEFYKLIRSNPGRKNRNHDMESVRKTIQTLMELGKFDIRHFCLETWVRKPL 477

Query: 90  RAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFW 129
           R+         V   DH+CPW  N +G  N   F+ F+F+
Sbjct: 478 RSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFIFF 517

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 49/113 (43%), Gaps = 14/113 (12%)

Query: 47  LTMIWFSYYLAIYTLPG------------QPLPNF-QPSKNSWKSYCKKCRNYKPERAHH 93
           L  + +S +L  ++ PG            + + N  +  K   +S+C +    KP R+ +
Sbjct: 410 LCFVCYSLFLLAFSDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLETWVRKPLRSKY 469

Query: 94  CKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLYELCLRAY 146
               +  +L  DH+CPW  N VG  N   F+ F    +    +   ++CL+ +
Sbjct: 470 SYLNDALILRFDHYCPWIYNDVGLKNHKLFI-FFILALELGIFSFVKVCLKYF 521

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 35/84 (41%), Gaps = 1/84 (1%)

Query: 77  KSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGY 136
           K +C      KP R+         V   DH CPW  N +G  N   F+ F+   + T  +
Sbjct: 449 KHFCISTWVRKPIRSKFSNFSRALVTRFDHFCPWIYNDIGLRNHKTFLFFIL-CLETCIF 507

Query: 137 LLYELCLRAYFILSNHNSPTYLWN 160
           +  +LC+  + +L +     Y  N
Sbjct: 508 VFLKLCMEYFDVLEDTFEDDYDLN 531

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 2/85 (2%)

Query: 78  SYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYL 137
           ++C K    KP R    K   Q V   DH+C W  N VG  N  H +   F ++  T  +
Sbjct: 403 TFCLKTWIRKPVRCSLSKLNQQQVARFDHYCAWIYNDVGLKN--HKLYIFFLILLETFLM 460

Query: 138 LYELCLRAYFILSNHNSPTYLWNKS 162
            + +    YF L    +  +L+N++
Sbjct: 461 TFGVLNWRYFGLMEKTAECFLFNRT 485

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 37.0 bits (84), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 2/76 (2%)

Query: 77  KSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGY 136
           +++C +    KP R+ +       V   DH+CPW  N VG  N   F+ F    +    +
Sbjct: 445 ENFCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFV-FFAVTVQYHMF 503

Query: 137 LLYELCLRAYFILSNH 152
           L   LCL AYF  +N+
Sbjct: 504 LFMWLCL-AYFKKTNY 518

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 37.0 bits (84), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 77  KSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGY 136
           +++C +    KP R+      N  V   DH+CPW  N +G  N      F+F++I+    
Sbjct: 460 RNFCIETWIRKPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHK---IFIFFIISVEIG 516

Query: 137 LLYELCL 143
           +L  +CL
Sbjct: 517 ILIFVCL 523

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 30/71 (42%), Gaps = 2/71 (2%)

Query: 77  KSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGY 136
            ++C +    KP R+ +    +  V   DH CPW  N +G  N  H +  LF ++   G 
Sbjct: 476 NNFCIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKN--HKLFVLFIILMVIGI 533

Query: 137 LLYELCLRAYF 147
             Y      YF
Sbjct: 534 WEYTYLAMEYF 544

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 72  SKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVI 131
            K   K +C       P RA + +  +  +L  DH+CPW  N +G+ N   F+ F+  ++
Sbjct: 440 GKYDSKHFCIHSWIRLPLRAKYKRFVHSVILRYDHYCPWIYNYIGFRNHKIFIYFIL-LL 498

Query: 132 ATTGYLLYELCLRAYFILSNH 152
                 L +LCL  +  L +H
Sbjct: 499 DLGILALAKLCLEYFDELKDH 519

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 34/83 (40%), Gaps = 2/83 (2%)

Query: 70  QPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFW 129
           Q  K   +++C +    K  R+ +       V   DH+CPW  N +G  N  H +   F 
Sbjct: 432 QLGKFDKENFCVETLERKSLRSKYSVFSGALVARFDHYCPWIYNDIGLKN--HKLSLFFA 489

Query: 130 VIATTGYLLYELCLRAYFILSNH 152
           +       L+     AYF  +NH
Sbjct: 490 MTVQYHMFLFMWLSLAYFKKTNH 512

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 33.9 bits (76), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 26/54 (48%)

Query: 77  KSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWV 130
           K +C       P R+ +    N  +   DH+CPW  N +G+ N   F+ F+ ++
Sbjct: 453 KHFCIHSWVRIPLRSKYKTARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIMFL 506

>KAFR0G02175 Chr7 (453872..453885,453946..454375) [444 bp, 147 aa]
           {ON}
          Length = 147

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 49/123 (39%), Gaps = 15/123 (12%)

Query: 60  TLPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHH-----CPWTKNC 114
           T P    P   PS  + K YC +  ++     H CKT    VL+   +     C +TK  
Sbjct: 24  TTPNVSPPAPPPSDGTSKGYCARTHDFLSAGLHKCKT---YVLSTKEYLSTKTCNFTKTL 80

Query: 115 VGYYNFPHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMD 174
               N   F+ FLFW  + +   +Y +     F+    N   ++W  S L  L  L+  D
Sbjct: 81  A---NPIVFLNFLFWSASLSSLFIYYIKYEKSFLQDRSNK--FIW--SSLAGLGTLLTFD 133

Query: 175 GFI 177
             +
Sbjct: 134 TLV 136

>TDEL0F04640 Chr6 (870870..874583) [3714 bp, 1237 aa] {ON} Anc_8.340
           YDR159W
          Length = 1237

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 45/107 (42%), Gaps = 16/107 (14%)

Query: 130 VIATTGYLLYELCLRAYFILSNHNSPTYLWNKSEL---IFLTILIPMDGFILLTISILFI 186
           V A  G    E   RAY +LS    P Y  N  EL   IF    + M        ++ F 
Sbjct: 334 VRAAGGECPNEAEFRAYALLSKIRDPAYDKNIQELPQNIFQNEKVQM--------ALCFR 385

Query: 187 RCLSNQIFCGRTQIETWE----YERLEGLYYSKRLLPHLLANFWELY 229
           R +SN  F  R  + T      Y R   L  S + LP LL++F ELY
Sbjct: 386 RIISNSNFNERGYMRTENCLNFYGRFFQLIKSGK-LPFLLSSFLELY 431

>KAFR0F03170 Chr6 complement(627907..629685) [1779 bp, 592 aa] {ON}
           Anc_4.97 YGL023C
          Length = 592

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 9/60 (15%)

Query: 55  YLAIYTLP-GQPLPNFQPSKNSW-----KSYCKKCRNY--KPERAHHCKTCNQCVLAMDH 106
           YL  Y     +P+ + QP+K  W     ++ CKKC       ER HHC+ C + +   DH
Sbjct: 436 YLKDYAASENEPIISIQPTKKHWVPDSQRTNCKKCGKKFTVVERKHHCRHCGE-IFCQDH 494

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 22/51 (43%)

Query: 77  KSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFL 127
           K +C       P R+ + +     + A DH CPW  N +G  N   F  F+
Sbjct: 465 KHFCVHTWIRIPLRSKYDRDSACLISAFDHFCPWVYNQIGLLNHKLFYMFV 515

>TBLA0H02250 Chr8 (543632..545305) [1674 bp, 557 aa] {ON} Anc_5.102
           YHR151C
          Length = 557

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 19/36 (52%)

Query: 251 GLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPK 286
           G   ++N P+D+   +N +  L S L W W F +P 
Sbjct: 331 GYSPIINNPFDLSNITNILPLLNSSLLWSWRFNQPS 366

>NCAS0A01730 Chr1 (335930..338284) [2355 bp, 784 aa] {ON} Anc_4.97
          Length = 784

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 55/143 (38%), Gaps = 20/143 (13%)

Query: 27  HYFILSNFLST---QKQIWFEFSLTMIWFSYYLAIYTL--PGQPLPNFQPSKNSW----- 76
           H  +LSN +       Q     + + +  SY   I +L          +P+   W     
Sbjct: 579 HQGVLSNAMDNLLLSSQSSVRSTTSSLVESYKSKIVSLFSHSNDSSKTEPTHEHWVPDSE 638

Query: 77  KSYCKKCRNYKP--ERAHHCKTCNQ--CVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIA 132
           ++ C+KC+      ER HHC+ C +  C L + H     K+     NF      +   + 
Sbjct: 639 RTSCRKCQKQFTFIERKHHCRHCGEIYCALHLRHWLYLDKDA----NFIINKNVMTDPME 694

Query: 133 TTGYL--LYELCLRAYFILSNHN 153
             G L  + + CL  Y  LSN N
Sbjct: 695 DDGILCKVCDFCLEKYETLSNPN 717

>Smik_5.92 Chr5 complement(130819..132264) [1446 bp, 481 aa] {ON}
           YEL016C (REAL)
          Length = 481

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 40/88 (45%), Gaps = 13/88 (14%)

Query: 101 VLAMDHHCPWTKNCVG-----YYNFP--HFMRFLFWVIATTGYLL--YELCLRAYFILSN 151
           +L + HH    KN  G      Y  P    ++FL  +I T  +LL  Y  C RAY +   
Sbjct: 1   MLLLQHHIDLEKNNEGDARAKSYTVPRCQLLKFLLCII-TVIWLLSSYSKCSRAYDVGRQ 59

Query: 152 ---HNSPTYLWNKSELIFLTILIPMDGF 176
              + S TY     +   LTIL+ +DGF
Sbjct: 60  KIMNRSNTYYNGTHDFKTLTILVSIDGF 87

>Ecym_2287 Chr2 (558921..561386) [2466 bp, 821 aa] {ON} similar to
           Ashbya gossypii ABR101C
          Length = 821

 Score = 30.4 bits (67), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 2/68 (2%)

Query: 299 EFEETNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRT- 357
           E++ T+ +D   +L     G K K I  D  N +ET   DG+  I K  ++P   S  T 
Sbjct: 106 EYDSTDFSDDTSSLRDKLSGFKSKTILTDDSNVIETKFSDGKPRIIKPEINPVYDSDDTD 165

Query: 358 -QWQNTWG 364
            + QNT G
Sbjct: 166 GEAQNTIG 173

>Kpol_513.18 s513 complement(51452..52096) [645 bp, 214 aa] {ON}
           complement(51452..52096) [645 nt, 215 aa]
          Length = 214

 Score = 29.6 bits (65), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 25/60 (41%), Gaps = 2/60 (3%)

Query: 79  YCKKCRN--YKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGY 136
           YC+KC N  YK +    CKTC +     ++  P   N    Y    F R  +     +GY
Sbjct: 93  YCQKCGNTGYKFKNGRSCKTCWRRFAPSNNVNPTYTNASSKYGNSSFYRPAYQTTQVSGY 152

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.142    0.484 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,202,975
Number of extensions: 2030034
Number of successful extensions: 6148
Number of sequences better than 10.0: 133
Number of HSP's gapped: 6163
Number of HSP's successfully gapped: 133
Length of query: 377
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 266
Effective length of database: 40,753,473
Effective search space: 10840423818
Effective search space used: 10840423818
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)