Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07524g6.29ON1670167067770.0
TDEL0G044006.29ON1490117736790.0
Kpol_1037.226.29ON1496120434050.0
SAKL0E01540g6.29ON1415116232570.0
ACL004W6.29ON1377112932470.0
NCAS0D021306.29ON1434111831850.0
YOL004W (SIN3)6.29ON1536100530480.0
Smik_15.1666.29ON156698430430.0
Skud_15.1586.29ON155598330160.0
KAFR0A051206.29ON147983929680.0
Suva_15.1716.29ON156185929580.0
Ecym_30336.29ON1474100429490.0
TPHA0J004006.29ON1512100129400.0
TBLA0E031606.29ON173992228950.0
KLLA0C06182g6.29ON151998528610.0
KLTH0C10956g6.29ON143398128420.0
KNAG0F029206.29ON149286828360.0
Kwal_56.224626.29ON154199028250.0
CAGL0E02475g6.29ON149388228160.0
NDAI0C026606.29ON165785027550.0
CAGL0J11594g6.29ON9373546371e-67
Kpol_1064.538.403ON48969782.6
KAFR0H021408.352ON723140782.9
SAKL0E08162g2.267ON711118748.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C07524g
         (1670 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} simil...  2615   0.0  
TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6....  1421   0.0  
Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...  1316   0.0  
SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] ...  1259   0.0  
ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic h...  1255   0.0  
NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6....  1231   0.0  
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...  1178   0.0  
Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...  1176   0.0  
Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...  1166   0.0  
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...  1147   0.0  
Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...  1144   0.0  
Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON} ...  1140   0.0  
TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {O...  1137   0.0  
TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6....  1119   0.0  
KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} simil...  1106   0.0  
KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...  1099   0.0  
KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....  1097   0.0  
Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...  1092   0.0  
CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} simil...  1089   0.0  
NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {...  1065   0.0  
CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa...   249   1e-67
Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON} (95468....    35   2.6  
KAFR0H02140 Chr8 (403762..405933) [2172 bp, 723 aa] {ON} Anc_8.3...    35   2.9  
SAKL0E08162g Chr5 (656921..659056) [2136 bp, 711 aa] {ON} simila...    33   8.3  

>ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1670

 Score = 2615 bits (6777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1335/1670 (79%), Positives = 1335/1670 (79%)

Query: 1    MSQTWDRSPPTGSNSAHDTDXXXXXXXXXXXXXXXXXXXXXGSNKGSEVDSDXXXXXXXP 60
            MSQTWDRSPPTGSNSAHDTD                     GSNKGSEVDSD       P
Sbjct: 1    MSQTWDRSPPTGSNSAHDTDTNNMNNNNSNANSQNATNNNQGSNKGSEVDSDNNENNNNP 60

Query: 61   ASRNGVELPLPQQQQQNSGTEIKQESGSKPHFVLPSISDLXXXXXXXXXXXXXXXXXXXX 120
            ASRNGVELPLPQQQQQNSGTEIKQESGSKPHFVLPSISDL                    
Sbjct: 61   ASRNGVELPLPQQQQQNSGTEIKQESGSKPHFVLPSISDLSGETGSSPSHGGSGTTNTTN 120

Query: 121  XXXXXXQNPNATGAGVNSTMAPGVPSMLSQQSLPRLSSVQATYPSAPPVLPRFSTATAGE 180
                  QNPNATGAGVNSTMAPGVPSMLSQQSLPRLSSVQATYPSAPPVLPRFSTATAGE
Sbjct: 121  VNTSGSQNPNATGAGVNSTMAPGVPSMLSQQSLPRLSSVQATYPSAPPVLPRFSTATAGE 180

Query: 181  VQGXXXXXXXXXXXXXXXXXXXXXXDDKSRIGVKPRSGSAGMSVASFDNXXXXXXXXXXX 240
            VQG                      DDKSRIGVKPRSGSAGMSVASFDN           
Sbjct: 181  VQGPTTLTSSSSIPTTQQQQQQQPPDDKSRIGVKPRSGSAGMSVASFDNPLPPSQPSVPS 240

Query: 241  XHYQMLSSXXXXXXXXXXXXXXXXXXXXXIPLHDQYYRPLNVKDALSYLEQVKFQFNSRP 300
             HYQMLSS                     IPLHDQYYRPLNVKDALSYLEQVKFQFNSRP
Sbjct: 241  LHYQMLSSQQQQEQKGQDQQQQHQQQQQQIPLHDQYYRPLNVKDALSYLEQVKFQFNSRP 300

Query: 301  DVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTFLPQGYRIDCSQNPDEP 360
            DVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTFLPQGYRIDCSQNPDEP
Sbjct: 301  DVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTFLPQGYRIDCSQNPDEP 360

Query: 361  IKVTTPMGSSTVAGVAEMNQAALFQGQQPRIQQHLQPLSFXXXXXXXXXXXXXXXXXXXX 420
            IKVTTPMGSSTVAGVAEMNQAALFQGQQPRIQQHLQPLSF                    
Sbjct: 361  IKVTTPMGSSTVAGVAEMNQAALFQGQQPRIQQHLQPLSFPPSQDYQLQQQQQPQQQVPF 420

Query: 421  XXARGQQVLPATFPPPAENAPXXXXXXXXXXXXASSTHXXXXXXXXXXXXXXXXXXXXXX 480
              ARGQQVLPATFPPPAENAP            ASSTH                      
Sbjct: 421  EQARGQQVLPATFPPPAENAPQQQLQHQQQQQQASSTHVQPPTVGPPSQQPQQQQPQHGS 480

Query: 481  XXXXXXXTSAVSSGTGPTQPEVPAPVQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQP 540
                   TSAVSSGTGPTQPEVPAPVQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQP
Sbjct: 481  PQPAPQPTSAVSSGTGPTQPEVPAPVQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQP 540

Query: 541  DIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAXXXXXXXXXXXXXSSXXXXXXXXXXX 600
            DIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA             SS           
Sbjct: 541  DIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSASAAQQQRQQL 600

Query: 601  XXXXXXXXXXXXXXXXXXXENQPVARQNLPPLGSFSPPPNGTAPRDYYQEPSQGMALPPM 660
                               ENQPVARQNLPPLGSFSPPPNGTAPRDYYQEPSQGMALPPM
Sbjct: 601  QPVMQHQQAAAATGYGYYGENQPVARQNLPPLGSFSPPPNGTAPRDYYQEPSQGMALPPM 660

Query: 661  THLETQAAKVTPSHYVMTQGMSNDAIPLSNMRSPTVGAPGAQTPVETAXXXXXXXXXXXX 720
            THLETQAAKVTPSHYVMTQGMSNDAIPLSNMRSPTVGAPGAQTPVETA            
Sbjct: 661  THLETQAAKVTPSHYVMTQGMSNDAIPLSNMRSPTVGAPGAQTPVETAPQHPQQYSPQQA 720

Query: 721  XXXXXXXXXXXXXXXXXXXXXXTIPLTQPSQLGPQQEVQYVDIAVRPEIDLDXXXXXXXX 780
                                  TIPLTQPSQLGPQQEVQYVDIAVRPEIDLD        
Sbjct: 721  PQPQLPQQQLPPQQQEQSLPPQTIPLTQPSQLGPQQEVQYVDIAVRPEIDLDPSIVPVVP 780

Query: 781  XXXXXXXDSLSLVEETSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYL 840
                   DSLSLVEETSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYL
Sbjct: 781  EPTEPIEDSLSLVEETSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYL 840

Query: 841  GGSKELFTWFKNFVGYQDRPKNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGR 900
            GGSKELFTWFKNFVGYQDRPKNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGR
Sbjct: 841  GGSKELFTWFKNFVGYQDRPKNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGR 900

Query: 901  DEMCWEVLNDEWIGHPVWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQT 960
            DEMCWEVLNDEWIGHPVWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQT
Sbjct: 901  DEMCWEVLNDEWIGHPVWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQT 960

Query: 961  LETIASKIANMTEEEKANFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVA 1020
            LETIASKIANMTEEEKANFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVA
Sbjct: 961  LETIASKIANMTEEEKANFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVA 1020

Query: 1021 VPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLIS 1080
            VPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLIS
Sbjct: 1021 VPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLIS 1080

Query: 1081 EISSIKVDQTNKRIHWLTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERX 1140
            EISSIKVDQTNKRIHWLTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKER 
Sbjct: 1081 EISSIKVDQTNKRIHWLTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERL 1140

Query: 1141 XXXXXXXXXXXXXIPVSEVNDGLRRRSPSXXXXXXXXXXXXGTALAHGKRPREIELPLRD 1200
                         IPVSEVNDGLRRRSPS            GTALAHGKRPREIELPLRD
Sbjct: 1141 KDFLKSFLSLFFSIPVSEVNDGLRRRSPSNKEEHEANKKENGTALAHGKRPREIELPLRD 1200

Query: 1201 ILHRNKYQKLKLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKKPWLLGNIVEEANA 1260
            ILHRNKYQKLKLR                               AKKPWLLGNIVEEANA
Sbjct: 1201 ILHRNKYQKLKLRSDGEEGSIGQSEEGLDEQEEVDEEEEIIKQEAKKPWLLGNIVEEANA 1260

Query: 1261 QGIISNRKSFNLFANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNL 1320
            QGIISNRKSFNLFANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNL
Sbjct: 1261 QGIISNRKSFNLFANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNL 1320

Query: 1321 ISEQLKNMGLDFAGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVV 1380
            ISEQLKNMGLDFAGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVV
Sbjct: 1321 ISEQLKNMGLDFAGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVV 1380

Query: 1381 QALVKHAHTILTDIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFN 1440
            QALVKHAHTILTDIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFN
Sbjct: 1381 QALVKHAHTILTDIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFN 1440

Query: 1441 RISKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIES 1500
            RISKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIES
Sbjct: 1441 RISKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIES 1500

Query: 1501 EQEYDEDNGGDPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSE 1560
            EQEYDEDNGGDPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSE
Sbjct: 1501 EQEYDEDNGGDPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSE 1560

Query: 1561 SHKTKVDKKNELIRGYLDSEKGWKKNLDAKSIQSVEEKLNFVKNYGTLQGYRAQENGLES 1620
            SHKTKVDKKNELIRGYLDSEKGWKKNLDAKSIQSVEEKLNFVKNYGTLQGYRAQENGLES
Sbjct: 1561 SHKTKVDKKNELIRGYLDSEKGWKKNLDAKSIQSVEEKLNFVKNYGTLQGYRAQENGLES 1620

Query: 1621 TTKEAPFSDAVERKXXXXXXXXXXXXXXPSNTAGVEERGGNDTTAEDVEA 1670
            TTKEAPFSDAVERK              PSNTAGVEERGGNDTTAEDVEA
Sbjct: 1621 TTKEAPFSDAVERKADSAAQADGAANGGPSNTAGVEERGGNDTTAEDVEA 1670

>TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6.29
            YOL004W
          Length = 1490

 Score = 1421 bits (3679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 732/1177 (62%), Positives = 849/1177 (72%), Gaps = 53/1177 (4%)

Query: 497  PTQPEVPAPVQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQRE 556
            P QP      Q    DQ KK ADVEFSQAI+YVNKIKNRF++QPDIYKHFLEILQTYQRE
Sbjct: 357  PLQPAAGQQSQLPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQRE 416

Query: 557  QKPINEVYAQVTVLFQNAXXXXXXXXXXXXXSSXXXXXXXXXXXXXXXXXXXXXXXXXXX 616
            QKPINEVYAQVTVLFQNA             SS                           
Sbjct: 417  QKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSPSANRQQQQPGVLQQQSPAFGLSAYYN 476

Query: 617  XXXENQPVARQNLPPLGSFSPPPNGTAPRDYY--QEPSQGMALPPMTHLETQAAKVTPSH 674
                + P +RQNLPPLGSFSPPPNG  P +YY  Q+P Q + LPP+  +E    + +P H
Sbjct: 477  ET--SPPTSRQNLPPLGSFSPPPNGAVPHNYYRDQQP-QTLGLPPVAQVENHIDQRSPPH 533

Query: 675  YVMTQGMSNDAIPLSNMRSPTVGAPGAQTPVETAXXXXXXXXXXXXXXXXXXXXXXXXXX 734
             + TQG++ + +P+SN+RS       AQ+P E A                          
Sbjct: 534  -IATQGIAGEPMPVSNLRSQIT----AQSPSELAQLHQQQQ------------------- 569

Query: 735  XXXXXXXXTIPLTQPSQLGPQQEVQYVDIAVRPEIDLDXXXXXXXXXXXXXXXDSLSLVE 794
                     IP +QP+   P  + QY+DIAVRPEIDLD               DSL+LVE
Sbjct: 570  ---------IP-SQPTANIP--DGQYLDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVE 617

Query: 795  ETSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFV 854
            ETSFFD+AKKFIGNKQ+YTEFLKILNL+SQDLLD+D LV +VEHYLGG+KELF WFKNFV
Sbjct: 618  ETSFFDRAKKFIGNKQIYTEFLKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFV 677

Query: 855  GYQDRPKNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIG 914
            G+QD+PK+IEN++HEKHRLDLD+CEA GPSYKKLPKSDTFMPCSGRDEMCW VLNDEW+G
Sbjct: 678  GFQDKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVG 737

Query: 915  HPVWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEE 974
            HPVWASEDSGFIAHRKNQYEETLFK+EEERHEYDFYIESNLRTIQTLETIASKIANM+EE
Sbjct: 738  HPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMSEE 797

Query: 975  EKANFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEE 1034
            EKA FKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHE+PA+AVPVVLKRLKQKDEE
Sbjct: 798  EKATFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEE 857

Query: 1035 WRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRI 1094
            WRRAQREWNKVWRELEQKVY+KSLDHLGLTFKQADKKLLTTKQLISEI SIK DQTNKR+
Sbjct: 858  WRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRM 917

Query: 1095 HWLTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERXXXXXXXXXXXXXXI 1154
            HWLTPKPK QLDY  PD+ +F DILSLT+ F+NH  +YSN DK R              I
Sbjct: 918  HWLTPKPKDQLDYYVPDKSVFFDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSI 977

Query: 1155 PVSEVNDGLRRRSPSXXXXXXXXXXXXGTALAHGKRPREIELPLRDILHRNKYQKLKLRX 1214
            P+ EVN+ + RR                  L + KRPRE E+ L ++LHR K Q+ K R 
Sbjct: 978  PMYEVNEAVSRRGNLDDDKEDSTQKMESDNLNNSKRPREDEISLSEVLHRAKNQRFKSR- 1036

Query: 1215 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKKPWLLGNIVEEANAQGIISNRKSFNLFA 1274
                                          AKKPWLLGN+VEE NAQG+I+NRK+FN+FA
Sbjct: 1037 ---AADETSEESAAEPEPELNEEEETIRQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFA 1093

Query: 1275 NTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAG 1334
            NT+IYVFFRHLTTLYERL EVK ++  VT+EINSRKV QFAKDLNLIS+QLK MGLDF G
Sbjct: 1094 NTNIYVFFRHLTTLYERLEEVKKMNDAVTKEINSRKVVQFAKDLNLISQQLKEMGLDFEG 1153

Query: 1335 LDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDI 1394
             DAYEQL HL KRLIEGDIEHQWFEESLRQAYNN+AFK YTVDKV+Q+LVKHAHTILTD 
Sbjct: 1154 ADAYEQLRHLCKRLIEGDIEHQWFEESLRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDS 1213

Query: 1395 KCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYIAID 1454
            K SEIM  FEKDRT   TSAKDQILYR+Q RS+MS+TENMFRIE+N+ SK+V IQ+IA+D
Sbjct: 1214 KTSEIMTSFEKDRTQINTSAKDQILYRLQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVD 1273

Query: 1455 DLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIESEQEY--DEDNGGDP 1512
            DLTLAE +SLE+KW+YYVTSYSLSHPTEGIS E+LQ+PFLEK++E+E++Y  D DN    
Sbjct: 1274 DLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQEELQLPFLEKVLETEEDYGSDVDNFSID 1333

Query: 1513 KFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNEL 1572
            KFSPEGVSKS+L+IKIDPETY L++E GS DVFSRK+VN+FP+  +S  + TK +KK  +
Sbjct: 1334 KFSPEGVSKSTLKIKIDPETYLLDIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNM 1393

Query: 1573 IRGYLDSEKGWKKNLDAKSIQSVEEKLNFVKNYGTLQGYRAQENGLESTTKEAPFSDAVE 1632
            +  +L+S+KGWKKNLD   +++++EKL  VK  G+L  +        S T++A    A  
Sbjct: 1394 VIQFLESKKGWKKNLDDDQVKAIQEKLARVKENGSLDDFNEA-----SQTQQASEIIAPS 1448

Query: 1633 RKXXXXXXXXXXXXXXPSNTAGVEERGGNDTTAEDVE 1669
            +               P      E+R GNDTTA++V+
Sbjct: 1449 KVEQSKESTVADVNSLPKELVEAEDR-GNDTTADEVD 1484

 Score =  221 bits (562), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 145/315 (46%), Positives = 162/315 (51%), Gaps = 79/315 (25%)

Query: 81  EIKQESGSKPHFVLPSISDLXXXXXXXXXXXXXXXXXXXXXXXXXXQNPNATGAGVNSTM 140
           EIK ES  KPH  LPSISDL                               +G   ++  
Sbjct: 64  EIKVES--KPHVTLPSISDL-------------------------------SGESAHN-- 88

Query: 141 APGVPSMLSQQSLPRLSSVQATYPSAPPVLPRFSTATAGEVQGXXXXXXXXXXXXXXXXX 200
             G   + S  +  RL SVQ+TY S  P           EV G                 
Sbjct: 89  --GKDGLTSSNTPLRLPSVQSTYGSKAP-------GAGQEVNGTIM-------------- 125

Query: 201 XXXXXDDKSRIGVKP---RSGSAGMSVASFDNXXX-XXXXXXXXXHYQMLSSXXXXXXXX 256
                  +S +   P   R  S G+S ASFDN             H+Q+L          
Sbjct: 126 -------ESTVNPAPAQGRQNSVGLSFASFDNPLPPQQQTILSSSHFQVLPPHQQQQEQQ 178

Query: 257 XXXXXXXXXXXXXIPLHDQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQ 316
                           HD YYRPLNVKDALSYLEQVK+QFNSRPDVYNHFLDIMKDFKSQ
Sbjct: 179 QQMQQQMQ--------HDAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQ 230

Query: 317 AIDTPGVIERVSTLFRGYPNLIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVA 376
           AIDTPGVI+RVSTLF+GYP LIQGFNTFLPQGYRI+CS NPDEPI+VTTPMGSS+VAG  
Sbjct: 231 AIDTPGVIDRVSTLFKGYPGLIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSSVAGTI 290

Query: 377 EMNQAALFQGQQPRI 391
           E N  A F   QPRI
Sbjct: 291 E-NAVAGFPA-QPRI 303

 Score = 53.9 bits (128), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 49/79 (62%), Gaps = 2/79 (2%)

Query: 270 IPLHDQYYRPLNVK--DALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERV 327
           +P +DQ  +  +V+   A++Y+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V
Sbjct: 368 LPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQV 427

Query: 328 STLFRGYPNLIQGFNTFLP 346
           + LF+  P+L+  F  FLP
Sbjct: 428 TVLFQNAPDLLDDFKKFLP 446

 Score = 40.8 bits (94), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 33/48 (68%)

Query: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 572
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +V+ LF+
Sbjct: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFK 246

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
            (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score = 1316 bits (3405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 689/1204 (57%), Positives = 827/1204 (68%), Gaps = 60/1204 (4%)

Query: 492  SSGTGPTQPE--VPAPVQP--------QLADQTKKAADVEFSQAISYVNKIKNRFSDQPD 541
            ++ TG + P   +PA   P        Q   Q +K ADVEFSQA+SYVNKIKNRF+DQPD
Sbjct: 323  NTNTGISSPSSTIPAGTVPGTTVANNIQGTTQIEKPADVEFSQAVSYVNKIKNRFADQPD 382

Query: 542  IYKHFLEILQTYQREQKPINEVYAQVTVLFQNAXXXXXXXXXXXXXSSXXXXXXXXXXXX 601
            IYKHFLEILQTYQREQKPI+EVYAQVTVLFQNA             SS            
Sbjct: 383  IYKHFLEILQTYQREQKPISEVYAQVTVLFQNAPDLLDDFKKFLPDSSPSVTTQQPVQPQ 442

Query: 602  XXXXXXXXXXXXXXXXXXENQ---PVARQNLPPLGSFSPPPNGTAP---RDYYQEPSQGM 655
                                    P A QNLPPLG+FSPP NG  P    ++  E    M
Sbjct: 443  QQALPQQQQPMYGVNNGYYQAGKIPSANQNLPPLGNFSPPSNGAVPGRPEEFSTEAQHHM 502

Query: 656  -ALPPMTHLETQAAKVTPSHYVMTQGMSNDAIPLSNMRSPTVGAPGAQ--TPVETAXXXX 712
             ALP M    T+ A++    ++    M+N+AIP+S++RS  +        TP+E A    
Sbjct: 503  MALPSMLQAPTEHAQLHAQQHIAP--MTNEAIPISDLRSQIIDNNHVHNYTPIELAQLQQ 560

Query: 713  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIPLTQPSQLGPQQEVQY-VDIAVRPEIDL 771
                                                        E  Y  +  VRPEIDL
Sbjct: 561  QQQQQQQQQQQQQQQQMQL-------------------------EAAYATEGIVRPEIDL 595

Query: 772  DXXXXXXXXXXXXXXXDSLSLVEETSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDG 831
            D               +SLSLVEE +FFDKAKKFIGNKQ+Y EFLKILNLYSQD+L +D 
Sbjct: 596  DPSIVPVIPEPTEPIEESLSLVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQDILSLDD 655

Query: 832  LVEKVEHYLGGSKELFTWFKNFVGYQDRPKNIENVIHEKHRLDLDMCEASGPSYKKLPKS 891
            L+EKV++YLG +KELF WFKNFVG+QD+PK+IENV+HEKH+LDLD+CEA GPSYKKLPK+
Sbjct: 656  LIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPSYKKLPKT 715

Query: 892  DTFMPCSGRDEMCWEVLNDEWIGHPVWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYI 951
            DTFMPCSGRDEMCWEVLNDEW+GHPVWASEDSGFIAHRKNQYEETLFK+EEERHEYDFYI
Sbjct: 716  DTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYI 775

Query: 952  ESNLRTIQTLETIASKIANMTEEEKANFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIID 1011
            ESNLRTIQTLETIASKIANMTEEEK  FKLP GLGHTS TIY+KVIRKVYDKERGFEIID
Sbjct: 776  ESNLRTIQTLETIASKIANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKERGFEIID 835

Query: 1012 ALHEHPAVAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKK 1071
            ALHE+P+VAVPVVLKRLKQKD+EWRRAQREWNKVWRELEQKV+FKSLDHLGLTFKQ+DKK
Sbjct: 836  ALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQSDKK 895

Query: 1072 LLTTKQLISEISSIKVDQTNKRIHWLTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTGN 1131
            LLTTKQL++EISSIKVDQTNKRIHWLTPKPKSQLDY+  D+ +  DIL L +VF+NHT +
Sbjct: 896  LLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADVFINHTSS 955

Query: 1132 YSNSDKERXXXXXXXXXXXXXXIPVSEVNDGLRRRSPSXXXXXXXXXXXXGTALAHGKRP 1191
            YSN DKER              IP+ E+ D +   +               +     KRP
Sbjct: 956  YSNPDKERLRDFLQSYIGLFFSIPIREIKDAV--EAAIDNGKQLDENEQNSSKKNSNKRP 1013

Query: 1192 REIELPLRDILHRNKYQKLKLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKKPWLL 1251
            R++E+ L DIL+R++YQ+LK                                 AKKPWLL
Sbjct: 1014 RDVEICLSDILNRSRYQRLK---HSLDSSEASLGAVSPGQNEQDDMDEMIRQEAKKPWLL 1070

Query: 1252 GNIVEEANAQGIISNRKSFNLFANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKV 1311
            G++VEEAN+QG+I NRK +N+FAN ++YVF R+L T+Y+RL EVK I+  VT+EIN RKV
Sbjct: 1071 GSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDINDVVTKEINGRKV 1130

Query: 1312 SQFAKDLNLISEQLKNMGLDFAGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAF 1371
             QFAKDLNLIS QLKNMGLDF+G D+Y QLL LSKRLIEGD+EHQWFEESLRQAY NRAF
Sbjct: 1131 VQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNRAF 1190

Query: 1372 KFYTVDKVVQALVKHAHTILTDIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNT 1431
            K YT+DKV+Q+LVKHAH I+TD K S++M LFEKDR  ++T++KDQILYR+Q RSHMS T
Sbjct: 1191 KLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSHMSTT 1250

Query: 1432 ENMFRIEFNRISKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQV 1491
            E+MFRIE+N     + IQYIA+DDLTL E K+LEDKWKYY+TSYSLSHPTEGI  E++++
Sbjct: 1251 EHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIKI 1310

Query: 1492 PFLEKIIESEQEYDEDNGGDPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVN 1551
            PFL+K+IESEQ + ED   +PK+SPEGVSKS+L IKIDPETY LEVEPGS D+FSRK+VN
Sbjct: 1311 PFLDKVIESEQVHMEDEDDNPKYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSRKSVN 1370

Query: 1552 KFPLEKNSESHKTKVDKKNELIRGYLDSEKGWKKNLDAKSIQSVEEKLNFVKNYGTLQGY 1611
            KFP++  SES+K K   +    + +L+ + GWK+ L + +I  +E+K N +KN GT Q  
Sbjct: 1371 KFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISKIEQKFNDLKN-GTFQQ- 1428

Query: 1612 RAQENGLESTTKEAPFSDAVERKXXXXXXXXXXX---XXXPSNTA--GVEERGGNDTTAE 1666
            R++    E+T+     SD+ +++                 P N+A    EER GNDTT E
Sbjct: 1429 RSRSATSETTSVPLNASDSTQKEQESTGTSETSQPALQKVPINSAEPDQEER-GNDTTTE 1487

Query: 1667 DVEA 1670
            +VE+
Sbjct: 1488 EVES 1491

 Score =  194 bits (494), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 86/99 (86%), Positives = 92/99 (92%)

Query: 276 YYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYP 335
           YYRPLNVKDAL+YLEQVK QFNSRPD+YNHFLDIMKDFKSQ+IDTPGVIERVSTLFRGYP
Sbjct: 120 YYRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYP 179

Query: 336 NLIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVAG 374
           NLIQGFNTFLPQGY I+CS NPD+PIKVTTP+GS  V  
Sbjct: 180 NLIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIVTN 218

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 46/74 (62%), Gaps = 2/74 (2%)

Query: 275 QYYRPLNVK--DALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFR 332
           Q  +P +V+   A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+
Sbjct: 354 QIEKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQ 413

Query: 333 GYPNLIQGFNTFLP 346
             P+L+  F  FLP
Sbjct: 414 NAPDLLDDFKKFLP 427

 Score = 40.8 bits (94), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 33/48 (68%)

Query: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 572
           A++Y+ ++K +F+ +PDIY HFL+I++ ++ +      V  +V+ LF+
Sbjct: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 176

>SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] {ON}
            similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
            ACL004Wp and some similarites with YOL004W uniprot|P22579
            Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
            involved in transcriptional regulation
          Length = 1415

 Score = 1259 bits (3257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 677/1162 (58%), Positives = 790/1162 (67%), Gaps = 90/1162 (7%)

Query: 515  KKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 574
            KK  DVEFS AISYVNKIK RF++QPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA
Sbjct: 334  KKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 393

Query: 575  XXXXXXXXXXXXXSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENQPVARQNLPPLGS 634
                         +S                                Q   +QNLPPLGS
Sbjct: 394  PDLLDDFKKFLPDASAPQSTTTPAPVNGGTFYP--------------QAAPQQNLPPLGS 439

Query: 635  FSPPPNGTAPRDYYQEPSQGMALPPMTHLETQAAKVTPSHYVMTQGMSNDAIPLSNMRSP 694
            FSPP +G+A     +        PP   +  Q     P  +++TQGMSND IP+S +R+ 
Sbjct: 440  FSPPSSGSAREG--EHVGLPAVQPPSMDISGQ-----PQQHIITQGMSNDDIPISEVRNT 492

Query: 695  TVGAPGAQTPVETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIPLTQPSQLGP 754
              GA                                                   S L  
Sbjct: 493  ADGA-------------------------------------------------YRSDLRN 503

Query: 755  QQEVQYVDIAVRPEIDLDXXXXXXXXXXXXXXXDSLSLVEETSFFDKAKKFIGNKQLYTE 814
              EVQY++   RPEIDLD               + +SLVEETSFFDKAKKFIGNKQ+YTE
Sbjct: 504  SGEVQYMEPVARPEIDLDPSLVPVIPEPIEPMENEVSLVEETSFFDKAKKFIGNKQIYTE 563

Query: 815  FLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQDRPKNIENVIHEKHRLD 874
            FLKILNLYSQDLLD D LVEKVE+YLGG+KELF WFKNFVGY+ +PK+IEN++HEKHRLD
Sbjct: 564  FLKILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLD 623

Query: 875  LDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWASEDSGFIAHRKNQYE 934
            LD+CEA GPSYKKLPK+DTFMPCSGRDEMCWEVLNDEW+GHPVWASEDSGFIAHRKNQYE
Sbjct: 624  LDLCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE 683

Query: 935  ETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANFKLPPGLGHTSLTIYK 994
            ETLFK+EEERHEYDFYIE+NLRTIQTLETIA+KIANMT EEKA FKL PGLGHTS+TIYK
Sbjct: 684  ETLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYK 743

Query: 995  KVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVY 1054
            KVIRKVYDK+RGFEIIDALHE P++AVP+VLKRLKQKDEEWRRAQREWNKVWRELEQKVY
Sbjct: 744  KVIRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVY 803

Query: 1055 FKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPKPKSQLDYDFPDREI 1114
            +KSLDHLGLTFKQADKKLLTTKQL+SEIS+IKVDQ NKRIH LTPKPKSQLDY F DRE+
Sbjct: 804  YKSLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREV 863

Query: 1115 FCDILSLTEVFLNHTGNYSNSDKERXXXXXXXXXXXXXXIPVSEVNDGLRRRSPSXXXXX 1174
              DIL+L +VF++    YSN DKE+               P+ EV     RR        
Sbjct: 864  LYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARRRGDIGVQD 923

Query: 1175 XXXXXXXGTALAHGKRPREIELPLRDILHRNKYQKLKLRXXXXXXXXXXXXXXXXXXXXX 1234
                     +    KR RE E  L+D+L RNKYQK   R                     
Sbjct: 924  GEENSGQENSDLSRKRTREEENLLKDVLRRNKYQKG--RNFAEEEPIPEESEFAEKTVEE 981

Query: 1235 XXXXXXXXXXAKKPWLLGNIVEEANAQGIISNRKSFNLFANTSIYVFFRHLTTLYERLIE 1294
                      AKKPWLLG+IV+EAN  G + NRK+FN+FANT+IYVFFRHL TLY RL E
Sbjct: 982  KEEEEIIRQEAKKPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLSE 1041

Query: 1295 VKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGLDAYEQLLHLSKRLIEGDIE 1354
            VK I++ VT+EI +RKV QFAKDLNLIS QL +MGLDF G DAY Q+L LSKRLIEGDIE
Sbjct: 1042 VKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDIE 1101

Query: 1355 HQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIKCSEIMVLFEKDRTLATTSA 1414
            HQWFEESLRQAY N+AFK YT+DKVVQ+LVKHAHTI+TD K  EIM+LFEKDRT   TSA
Sbjct: 1102 HQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTSA 1161

Query: 1415 KDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTS 1474
            K+QILYR+Q RSHM+  ENMFRIE+NR S H  IQ++A+DDLTL E KSLED+WKYYVTS
Sbjct: 1162 KEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVTS 1221

Query: 1475 YSLSHPTEGISHEDLQVPFLEKIIESEQEYDEDNGGDPKFSPEGVSKSSLRIKIDPETYF 1534
            YSLSHPTEGISHE+LQ PFLEKI+E E+E+  +NG   ++SPEGVS S+L++KI+PETY 
Sbjct: 1222 YSLSHPTEGISHEELQPPFLEKILEKEEEFQCENG---EYSPEGVSSSNLKVKINPETYS 1278

Query: 1535 LEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLDSEKGWKKNLDAKSIQS 1594
            L+V+PGS D FSRK++NKFP+E N++++K+K  +K + +  YL+  KGWK+ L A  +  
Sbjct: 1279 LDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRGLVASKVLK 1338

Query: 1595 VEEKLNFVKNYGTLQGYRAQE------NGLESTTKEAPFSDAVERKXXXXXXXXXXXXXX 1648
             + ++ +VK  GTL G  +++      N ++   K   FS                    
Sbjct: 1339 AQTEIEYVKTKGTLVGLESKDKNDIVKNDIDGENKSYTFSTG---------QLHDHEEDK 1389

Query: 1649 PSNTAGVEERGGNDTTAEDVEA 1670
            P +     E  GNDTT E+ E 
Sbjct: 1390 PISHQEEPESKGNDTTTEEFEG 1411

 Score =  185 bits (470), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 98/114 (85%), Gaps = 5/114 (4%)

Query: 274 DQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRG 333
           D  YRPLNVKDALSYLEQVKFQFN+RPDVYNHFLDIMKDFKSQAIDTPGVIERVS LF+G
Sbjct: 155 DPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQG 214

Query: 334 YPNLIQGFNTFLPQGYRIDCSQNPDE--PIKVTTPMGSSTVAGVAEMNQAALFQ 385
           YPNLIQGFNTFLPQGY+I+CS NP++  PIKVTTP G++   G   +N A L Q
Sbjct: 215 YPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTT---GSVTLNTAPLEQ 265

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 57/114 (50%), Gaps = 20/114 (17%)

Query: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 403

Query: 345 LPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVAEMNQAALFQGQQPRIQQHLQPL 398
           LP     D S     P   TTP         A +N    +    P  QQ+L PL
Sbjct: 404 LP-----DASA----PQSTTTP---------APVNGGTFYPQAAP--QQNLPPL 437

 Score = 42.0 bits (97), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 34/48 (70%)

Query: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 572
           A+SY+ ++K +F+++PD+Y HFL+I++ ++ +      V  +V+ LFQ
Sbjct: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQ 213

>ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOL004W (SIN3)
          Length = 1377

 Score = 1255 bits (3247), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 656/1129 (58%), Positives = 774/1129 (68%), Gaps = 79/1129 (6%)

Query: 492  SSGTGPTQPEVPAPVQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQ 551
            S+   P     PA  Q Q     KKA DVEFS AISYVNKIK RF++QPDIYKHFLEILQ
Sbjct: 256  SAEGSPAAIATPATTQEQYGTGPKKAGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQ 315

Query: 552  TYQREQKPINEVYAQVTVLFQNAXXXXXXXXXXXXXSSXXXXXXXXXXXXXXXXXXXXXX 611
            TYQREQKPINEVYAQVTVLFQNA             SS                      
Sbjct: 316  TYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSAPQLQSHQQINGAMVAPGFGHA 375

Query: 612  XXXXXXXXEN-QPVA-RQNLPPLGSFSPPPNGTAPRDYYQEPSQGMALPPMTHLETQAAK 669
                       QP+  +QNLPPLG+FS       P D++      M+LP +       ++
Sbjct: 376  QSGLQQALPGTQPLMHQQNLPPLGNFS------TPGDHHP-----MSLPSVQGPNVGLSQ 424

Query: 670  VTPSHYVMTQGMSNDAIPLSNMRSPTVGAPGAQTPVETAXXXXXXXXXXXXXXXXXXXXX 729
                H ++TQG+SN  IP+S++R    GAP A                            
Sbjct: 425  GQSGH-IVTQGVSNQHIPVSDLR----GAPDASF-------------------------- 453

Query: 730  XXXXXXXXXXXXXTIPLTQPSQLGPQQEVQYVDIAVRPEIDLDXXXXXXXXXXXXXXXDS 789
                              + S+    Q+VQY++  VRPEIDLD               D 
Sbjct: 454  ------------------RASEYNQVQDVQYMEPTVRPEIDLDPSLVPVIPEPIKPLEDE 495

Query: 790  LSLVEETSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTW 849
            L+LVEE +FFDKAKKFIGNKQ+YTEFLKILNLYSQDLL+ + LVE V HYL GS ELF W
Sbjct: 496  LNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFDW 555

Query: 850  FKNFVGYQDRPKNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLN 909
            FK+FVGYQ+RPK+IENVIHEKHRLDLD+CEA GPSYK+LPK+DTFMPCSGRDEMCWEVLN
Sbjct: 556  FKSFVGYQERPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLN 615

Query: 910  DEWIGHPVWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIA 969
            DEW+GHPVWASEDSGFIAHRKNQYE+TLFK+EEERHEYDFYIE+NLRTIQTLETIA+KIA
Sbjct: 616  DEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIA 675

Query: 970  NMTEEEKANFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLK 1029
            NMT EEKA FKLPPGLGHTS+TIYKKVIRKVYDK+RGFEIIDALHEHPA+ VP+VLKRLK
Sbjct: 676  NMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHEHPAITVPLVLKRLK 735

Query: 1030 QKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQ 1089
            QKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLT KQLISEISSIKVDQ
Sbjct: 736  QKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQ 795

Query: 1090 TNKRIHWLTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERXXXXXXXXXX 1149
            +NKRIH LTPK KSQL YDF + E+F DILSL  VFL +   YS SD ER          
Sbjct: 796  SNKRIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSPSDNERLKDFFKGFIS 855

Query: 1150 XXXXIPVSEVNDGLRRRSPSXXXXXXXXXXXXG----TALAHGKRPR---EIELPLRDIL 1202
                 P+ E+ +GL +RS                       H  R R   + E  LRDIL
Sbjct: 856  LFFSYPLHEIEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSARKRVRDDTEHLLRDIL 915

Query: 1203 HRNKYQKLKLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKKPWLLGNIVEEANAQG 1262
            +RNK QK+                                  AKKPWLLG+IV+EA+  G
Sbjct: 916  YRNKQQKVN------KGPQNDQSSEEFEKESDIEEKEIVRQEAKKPWLLGSIVDEADNHG 969

Query: 1263 IISNRKSFNLFANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLIS 1322
             +S+R +FN+FANT+IYVFFRHLTT+YERL+EVK I+ EVT+EI++RKV QFAKDLNLIS
Sbjct: 970  HVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKVVQFAKDLNLIS 1029

Query: 1323 EQLKNMGLDFAGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQA 1382
             QL +MGLDF G DAYE+LL LS+ LI G++EHQWFEESLRQAY N+AFK YT+DKV+QA
Sbjct: 1030 TQLTDMGLDFKGADAYEELLRLSRSLISGELEHQWFEESLRQAYKNKAFKLYTIDKVIQA 1089

Query: 1383 LVKHAHTILTDIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNRI 1442
            LVKHAHTIL D K  EIM+LF+ DRT  +TS KDQILYR+Q RS+MSN ENMFRIE+N  
Sbjct: 1090 LVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIENMFRIEYNTT 1149

Query: 1443 SKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIESEQ 1502
            + H  IQ++A++DLTL E KSL DKW+YY+TSYSLSHPTEGISH++L+ PFLEKIIE ++
Sbjct: 1150 TSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPFLEKIIERDE 1209

Query: 1503 EYDEDNGGDPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESH 1562
             Y +D  GD ++SPEGV+ S++++KIDP TY +EVEPG  D+FSRK+VNKFP   + +  
Sbjct: 1210 GYIDD--GDERYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKFPTRVDVK-- 1265

Query: 1563 KTKVDKKNELIRGYLDSEKGWKKNLDAKSIQSVEEKLNFVKNYGTLQGY 1611
            K K  +   ++ G+L+ E+GWK+ L  K     E +L +VKN GTL  Y
Sbjct: 1266 KKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAERRLEYVKNNGTLDDY 1314

 Score =  179 bits (453), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 89/101 (88%), Gaps = 1/101 (0%)

Query: 270 IPLHD-QYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVS 328
           +P  D   YRPLNVKDALSYLEQVKFQF+SRPDVYNHFLDIMKDFKSQAIDTPGVIERVS
Sbjct: 121 VPAQDGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVS 180

Query: 329 TLFRGYPNLIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGS 369
           TLF GYP LIQGFNTFLP GY I+C  +P++PIKVTTP G+
Sbjct: 181 TLFHGYPALIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGT 221

 Score = 53.9 bits (128), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 40/62 (64%)

Query: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 289 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 348

Query: 345 LP 346
           LP
Sbjct: 349 LP 350

 Score = 42.7 bits (99), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 32/48 (66%)

Query: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 572
           A+SY+ ++K +FS +PD+Y HFL+I++ ++ +      V  +V+ LF 
Sbjct: 137 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFH 184

>NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6.29
            YOL004W
          Length = 1434

 Score = 1231 bits (3185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 642/1118 (57%), Positives = 762/1118 (68%), Gaps = 73/1118 (6%)

Query: 508  PQLADQTKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQV 567
            PQ  DQ+ K A+VEFSQAI+YVNKIKNRF+DQPDIYK FLEILQTYQREQKPINEVY+QV
Sbjct: 346  PQPEDQSAKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQV 405

Query: 568  TVLFQNAXXXXXXXXXXXXXSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-------E 620
            TVLFQ+A             SS                                      
Sbjct: 406  TVLFQHAPDLLDDFKKFLPESSGTTSTSELPQNAGIQQRAAIPTPNPKHQQYGYPNNYYP 465

Query: 621  NQPVARQNLPPLGSFSPPPNGTAPRDYYQEPSQGM----ALPPMTHLETQAAKVTPSHYV 676
            N    +QNLPP+GSF+PP NGTA R+Y   P         LP M  +    A        
Sbjct: 466  NGTGTQQNLPPIGSFAPP-NGTASREY--APGNQFVGPGGLPSM--IPNDQALQQQQQPG 520

Query: 677  MTQGMSNDAIPLSNMRSPTVGAPGAQTPVETAXXXXXXXXXXXXXXXXXXXXXXXXXXXX 736
            +  G +N+AIP+SN+RSP       Q P                                
Sbjct: 521  LVHGYTNEAIPVSNLRSPLTDQ---QYP-------------------NLLNMQNQMTPGQ 558

Query: 737  XXXXXXTIPLTQPSQLGPQQEVQYVDIA-VRPEIDLDXXXXXXXXXXXXXXXDSLSLVEE 795
                  T P+ Q          QY + A +RPEIDLD                ++SLVEE
Sbjct: 559  MDINNATAPMAQ----------QYTNEAPIRPEIDLDPSIVPVIPEPTEPLEYNVSLVEE 608

Query: 796  TSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVG 855
            T+FF+KAKKFIG KQ+YTEFLKILNLYSQDLL  D L  KVE+YLG ++ELFTWFKNFVG
Sbjct: 609  TNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNFVG 668

Query: 856  YQDRPKNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGH 915
            +Q++P  IEN++HEKH+LDLD+CEA GPSYKKLPK+DTFMPCSGRDEMCWEVLNDEW+GH
Sbjct: 669  FQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGH 728

Query: 916  PVWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEE 975
            PVWASEDSGFIAHRKNQYEE+LFK EEERHEYDF IESNLRTIQTLETIA+KI NMT EE
Sbjct: 729  PVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANKIGNMTNEE 788

Query: 976  KANFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEW 1035
            K NFKLPPGLGHTS TIYKKVIRKVYDK+RGFEIID LHE PA+ VPVVLKRLKQKDEEW
Sbjct: 789  KKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKRLKQKDEEW 848

Query: 1036 RRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIH 1095
            RRAQREWNKVWRELEQKVY+KSLDHLGLTFKQADKKLLTTKQL+SEISSIKVDQTNKRIH
Sbjct: 849  RRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIH 908

Query: 1096 WLTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERXXXXXXXXXXXXXXIP 1155
            WLTPKPKSQL++ F D +IF DIL LT VF+NH+  YSN +KER              IP
Sbjct: 909  WLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVFVSLFFSIP 968

Query: 1156 VSEVNDGLRRRS----------PSXXXXXXXXXXXXGTALAHGKRPREIELPLRDILHRN 1205
            + +VN+ L  RS                         +     KRP  I++PL DIL ++
Sbjct: 969  LDKVNEALSDRSHWLQEKEKKTKESSRNIDSTTSSSSSGSNSKKRPLNIDIPLADILRKH 1028

Query: 1206 KYQKLKLRXXXXXXXXXXXXX------XXXXXXXXXXXXXXXXXXAKKPWLLGNIVEEAN 1259
            KYQK++ +                                      K+PWLLGNI+E A+
Sbjct: 1029 KYQKIRKQAKESNEENAQEEDDENIVGDSNEELNEQDENEIILEEIKRPWLLGNIIETAS 1088

Query: 1260 AQGIISNRKSFNLFANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLN 1319
              G ISNRK FN+FANT+IYVFFR  T +YERL E+K I+++VT+E+NSR++SQFAKDLN
Sbjct: 1089 NHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRISQFAKDLN 1148

Query: 1320 LISEQLKNMGLDFAGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKV 1379
            LIS QLK+MGLDF G+++Y++LL LSKRLI+ DIEHQWFEESLRQA+NN+AFK YTVDKV
Sbjct: 1149 LISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFKLYTVDKV 1208

Query: 1380 VQALVKHAHTILTDIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEF 1439
            +Q+LVKHAHTIL D+K SEIMVLFEKDR  ++TSAK+QILYR+Q R+HM+NTENMFRIEF
Sbjct: 1209 IQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTENMFRIEF 1268

Query: 1440 NRISKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIE 1499
            N    HVCIQYIA++DLT+ + KS+E  W+YYVTSYSL HPTEG+  ++L++PFLEK +E
Sbjct: 1269 NEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIPFLEKTLE 1328

Query: 1500 SEQEYDEDNGGDPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNS 1559
             E     D  GD K SPEGVS S L+IKIDP++Y LE+EPGS D+FSRK++N +P    +
Sbjct: 1329 LEV----DEEGDNKSSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNVYP----T 1380

Query: 1560 ESHKTKVDKKNELIRGYLDSEKGWKKNLDAKSIQSVEE 1597
             S +TK  K  + +  +LD + GWKKNL      ++E+
Sbjct: 1381 YSDETKKRKSIDQMTKFLDGKNGWKKNLTTADSTNIED 1418

 Score =  187 bits (474), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 100/126 (79%)

Query: 272 LHDQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLF 331
             D  YRPLNVKDALSYLEQVK+QF+ RPD+YN FLDIMKDFKSQ+IDTPGVIERVS LF
Sbjct: 202 FQDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALF 261

Query: 332 RGYPNLIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVAEMNQAALFQGQQPRI 391
           RGYP L+QGFNTFLPQGYRI+C+ +PD PI+VTTPMG+ST++G   M   +  +    + 
Sbjct: 262 RGYPMLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTSTLSGGPAMEAPSSSESNLQQQ 321

Query: 392 QQHLQP 397
           Q H  P
Sbjct: 322 QHHQSP 327

 Score = 49.3 bits (116), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 40/64 (62%)

Query: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344
           A++Y+ ++K +F  +PD+Y  FL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 363 AINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKF 422

Query: 345 LPQG 348
           LP+ 
Sbjct: 423 LPES 426

 Score = 40.0 bits (92), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 32/48 (66%)

Query: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 572
           A+SY+ ++K +FS +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 215 ALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFR 262

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Component
            of the Sin3p-Rpd3p histone deacetylase complex, involved
            in transcriptional repression and activation of diverse
            processes, including mating-type switching and meiosis;
            involved in the maintenance of chromosomal integrity
          Length = 1536

 Score = 1178 bits (3048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/1005 (59%), Positives = 714/1005 (71%), Gaps = 49/1005 (4%)

Query: 621  NQPVARQNLPPLGSFSPPPNGTAPRDYYQEPSQGMALPPMTHLETQAAKVTPSHYVMTQG 680
            N+ + +QNLPP+GSFSPP NG+   + YQ+  Q    PP  H     + V     ++ QG
Sbjct: 533  NRGIPQQNLPPIGSFSPPTNGSTVHEAYQD--QQHMQPP--HFMPLPSIVQHGPNMVHQG 588

Query: 681  MSNDAIPLSNMRSPTVGAPGAQTPVETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 740
            ++N+  PLS++R+ ++    A + ++                                  
Sbjct: 589  IANENPPLSDLRT-SLTEQYAPSSIQHQQQ------------------------------ 617

Query: 741  XXTIPLTQPSQLGPQQEVQYVDIAVRPEIDLDXXXXXXXXXXXXXXXDSLSLVEETSFFD 800
                    P  + P    QY DI VRPEIDLD               +++SL EE +FF+
Sbjct: 618  -------HPQSISPIANTQYGDIPVRPEIDLDPSIVPVVPEPTEPIENNISLNEEVTFFE 670

Query: 801  KAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQDRP 860
            KAK++IGNK LYTEFLKILNLYSQD+LD+D LVEKV+ YLG +KELFTWFKNFVGYQ++ 
Sbjct: 671  KAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQEKT 730

Query: 861  KNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWAS 920
            K IEN++HEKHRLDLD+CEA GPSYK+LPKSDTFMPCSGRD+MCWEVLNDEW+GHPVWAS
Sbjct: 731  KCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWAS 790

Query: 921  EDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANFK 980
            EDSGFIAHRKNQYEETLFK+EEERHEYDFYIESNLRTIQ LETI +KI NMTE EKANFK
Sbjct: 791  EDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFK 850

Query: 981  LPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQR 1040
            LPPGLGHTS+TIYKKVIRKVYDKERGFEIIDALHEHPAV  PVVLKRLKQKDEEWRRAQR
Sbjct: 851  LPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQR 910

Query: 1041 EWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPK 1100
            EWNKVWRELEQKV+FKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNK+IHWLTPK
Sbjct: 911  EWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPK 970

Query: 1101 PKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERXXXXXXXXXXXXXXIPVSEVN 1160
            PKSQLD+DFPD+ IF DIL L + F+ HT  YSN DKER              I   ++ 
Sbjct: 971  PKSQLDFDFPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIE 1030

Query: 1161 DGLRRRSPSXXXXXXXXXXXXGTALAHGKRPREIELPLRDILHRNKYQKLKLRXXXXXXX 1220
            + L                  G+++A  KRP + E+ L DILHR++YQKLK R       
Sbjct: 1031 ESLYSHK---QNVSESSGSDDGSSIASRKRPYQQEMSLLDILHRSRYQKLK-RSNDEDGK 1086

Query: 1221 XXXXXXXXXXXXXXXXXXXXXXXXAKKPWLLGNIVEEANAQGIISNRKSFNLFANTSIYV 1280
                                    AK PWL GN+VEEAN+QGII NR  FNLFANT+IY+
Sbjct: 1087 VPQLSEPPEEEPNTIEEEELIDEEAKNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYI 1146

Query: 1281 FFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGLDAYEQ 1340
            FFRH TT+YERL+E+K +++ VT+EIN+R    FAKDL+L+S QL  MGLDF G DAY+Q
Sbjct: 1147 FFRHWTTIYERLLEIKQMNERVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQ 1206

Query: 1341 LLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIKCSEIM 1400
            +L LS+RLI GD+EHQWFEESLRQAYNN+AFK YT+DKV Q+LVKHAHT++TD K +EIM
Sbjct: 1207 VLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIM 1266

Query: 1401 VLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYIAIDDLTLAE 1460
             LF KDR  +TTSAKDQI+YR+Q RSHMSNTENMFRIEF++ + HV IQYIA+DDLTL E
Sbjct: 1267 ALFVKDRNASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKE 1326

Query: 1461 AKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIESEQEYDEDNGGDPKFSPEGVS 1520
             K+ EDKWKYYVTSY+L HPTEGI HE L++PFLE++IE  Q+ D     D +FSPEG+S
Sbjct: 1327 PKADEDKWKYYVTSYALPHPTEGIPHEKLKIPFLERLIEFGQDID-GTEVDEEFSPEGIS 1385

Query: 1521 KSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLDSE 1580
             S+L+IKI P TY L +E GS DVF+RKA NK+P   N  + K  V +K ELI  +LD  
Sbjct: 1386 VSTLKIKIQPITYQLHIENGSYDVFTRKATNKYPTIANDNTQKGMVSQKKELISKFLDCA 1445

Query: 1581 KGWKKNLDAKSIQSVEEKLNFVKNYGTLQGYRAQENGLESTTKEA 1625
             G + NLD     S+++K   +K+  ++    A   G+ES T++ 
Sbjct: 1446 VGLRNNLDEAQKLSMQKKWENLKD--SIAKTSAGNQGIESETEKG 1488

 Score =  191 bits (485), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 87/99 (87%), Positives = 94/99 (94%)

Query: 274 DQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRG 333
           D  YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLFRG
Sbjct: 213 DADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRG 272

Query: 334 YPNLIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTV 372
           YP LIQGFNTFLPQGYRI+CS NPD+PI+VTTPMG++TV
Sbjct: 273 YPILIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTV 311

 Score =  119 bits (297), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 67/92 (72%), Positives = 69/92 (75%), Gaps = 7/92 (7%)

Query: 490 AVSSGTGPTQ-PEVPA----PVQPQLADQ--TKKAADVEFSQAISYVNKIKNRFSDQPDI 542
           A SSG    Q PE+PA    P    L  Q   KK  DVEFSQAISYVNKIK RF+DQPDI
Sbjct: 369 ATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDAKKNVDVEFSQAISYVNKIKTRFADQPDI 428

Query: 543 YKHFLEILQTYQREQKPINEVYAQVTVLFQNA 574
           YKHFLEILQTYQREQKPINEVYAQVT LFQNA
Sbjct: 429 YKHFLEILQTYQREQKPINEVYAQVTHLFQNA 460

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+  P+L++ F  F
Sbjct: 411 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 470

Query: 345 LP 346
           LP
Sbjct: 471 LP 472

 Score = 38.9 bits (89), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 32/48 (66%)

Query: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 572
           A+SY+ ++K +FS +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 224 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 271

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
            (REAL)
          Length = 1566

 Score = 1176 bits (3043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/984 (59%), Positives = 707/984 (71%), Gaps = 46/984 (4%)

Query: 621  NQPVARQNLPPLGSFSPPPNGTAPRDYYQEPSQGMALPPMTHLETQAAKVTPSHYVMTQG 680
            N+ + +QNLPP+GSFSPP NG+   + YQ+  Q    PP  HL    + V     ++ QG
Sbjct: 564  NRGIPQQNLPPIGSFSPPTNGSTVHENYQD--QQHMQPP--HLMPLPSMVQHGANIVHQG 619

Query: 681  MSNDAIPLSNMRSPTVGAPGAQTPVETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 740
            ++N+ +PLS++R+ ++    A + ++                                  
Sbjct: 620  IANENLPLSDLRT-SLTEQYAPSNIQQQQQ------------------------------ 648

Query: 741  XXTIPLTQPSQLGPQQEVQYVDIAVRPEIDLDXXXXXXXXXXXXXXXDSLSLVEETSFFD 800
                    P  + P    QY D+ VRPEIDLD               D++SL EE +FF+
Sbjct: 649  ------QHPQSISPIANSQYGDVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFE 702

Query: 801  KAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQDRP 860
            KAK++IGNK LYTEFLKILNLYSQD+LD+D LVEKV+ YLG +KELF+WFKNFVGYQ+R 
Sbjct: 703  KAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQERT 762

Query: 861  KNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWAS 920
            K IEN++HEKHRLDLD+CEA GPSYK+LPKSDTFMPCSGRD+MCWEVLNDEW+GHPVWAS
Sbjct: 763  KFIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWAS 822

Query: 921  EDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANFK 980
            EDSGFIAHRKNQYEETLFK+EEERHEYDFYIESNLRTIQ LETI +KI NMTE EK NFK
Sbjct: 823  EDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFK 882

Query: 981  LPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQR 1040
            LPPGLGHTS+TIYKKVIRKVYDKERGFEIIDALHEHPAV  PVVLKRLKQKDEEWRRAQR
Sbjct: 883  LPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQR 942

Query: 1041 EWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPK 1100
            EWNKVWRELEQKV+FKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNK+IHWLTPK
Sbjct: 943  EWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPK 1002

Query: 1101 PKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERXXXXXXXXXXXXXXIPVSEVN 1160
            PKSQLD+DFPD+ IFCDIL L + F++HT  YSN DKER              I + E+ 
Sbjct: 1003 PKSQLDFDFPDKNIFCDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSISLEEIE 1062

Query: 1161 DGLRRRSPSXXXXXXXXXXXXGTALAHGKRPREIELPLRDILHRNKYQKLKLRXXXXXXX 1220
            + L+    S              +    KR  + E+ L DILHR++YQKLK R       
Sbjct: 1063 ESLQAYKQSVSESSGSDDG---GSSVSRKRSYQQEMTLLDILHRSRYQKLK-RSKDEDGK 1118

Query: 1221 XXXXXXXXXXXXXXXXXXXXXXXXAKKPWLLGNIVEEANAQGIISNRKSFNLFANTSIYV 1280
                                    AK PWL GN+VEEAN+QG+I NR  FNLFANT+IY+
Sbjct: 1119 VPQLSEAPDEESNIIEEEELINEEAKNPWLTGNLVEEANSQGMIQNRGIFNLFANTNIYI 1178

Query: 1281 FFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGLDAYEQ 1340
            FFRH TT+YERL+E+K ++++VT+EIN+R    FAKDL+L+S QL  MGLDF G DAY+Q
Sbjct: 1179 FFRHWTTIYERLLEIKQMNEKVTKEINTRSTVTFAKDLDLLSNQLSEMGLDFIGEDAYKQ 1238

Query: 1341 LLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIKCSEIM 1400
            +L LS+RLI GD+EHQWFEESLRQAYNNRAFK YT+DKV Q+LVKHAHT++TD K +EIM
Sbjct: 1239 VLKLSRRLINGDLEHQWFEESLRQAYNNRAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIM 1298

Query: 1401 VLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYIAIDDLTLAE 1460
             LF KDR + TTSAK QI+YR+Q RSHMSNTENMFRIEF++ + HV IQYIA+DDLTL E
Sbjct: 1299 ALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKE 1358

Query: 1461 AKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIESEQEYDEDNGGDPKFSPEGVS 1520
             K  EDKWKYYVTSY+L HPTEG+ HE L++PFLE++IE  Q+ D  +  D KFSPEG+S
Sbjct: 1359 PKEDEDKWKYYVTSYALPHPTEGVLHEKLKIPFLERLIEFGQDIDGKD-VDEKFSPEGIS 1417

Query: 1521 KSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLDSE 1580
             S+L+IKI P TY L++E GS DVF+RK+ NK+P   N ++HK  V +K ELI  +LD  
Sbjct: 1418 VSTLKIKIQPTTYKLDIENGSYDVFTRKSANKYPTVANDDTHKEVVVQKKELISRFLDCA 1477

Query: 1581 KGWKKNLDAKSIQSVEEKLNFVKN 1604
               + +L+     S++EK   +K+
Sbjct: 1478 VHLRNDLNESQKISMQEKFESLKD 1501

 Score =  191 bits (485), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 88/113 (77%), Positives = 97/113 (85%)

Query: 277 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPN 336
           YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLFRGYP 
Sbjct: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288

Query: 337 LIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVAEMNQAALFQGQQP 389
           LIQGFNTFLPQGYRI+CS NPD+PI+VTTPMG++TV       +      Q+P
Sbjct: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEP 341

 Score =  117 bits (293), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 65/93 (69%), Positives = 70/93 (75%), Gaps = 7/93 (7%)

Query: 489 SAVSSGT-GPTQPEVPAPVQ-PQLA-----DQTKKAADVEFSQAISYVNKIKNRFSDQPD 541
           SA S+G     Q E+P   Q PQ+      +  KK  DVEFSQAISYVNKIK RF+DQPD
Sbjct: 381 SATSTGLPSIQQSEIPVHHQIPQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPD 440

Query: 542 IYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 574
           IYKHFLEILQTYQREQKPINEVYAQVT LFQNA
Sbjct: 441 IYKHFLEILQTYQREQKPINEVYAQVTHLFQNA 473

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 52/91 (57%), Gaps = 14/91 (15%)

Query: 270 IPLHDQY--YRPLNVKD------------ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKS 315
           IP+H Q    +PL V++            A+SY+ ++K +F  +PD+Y HFL+I++ ++ 
Sbjct: 395 IPVHHQIPQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQR 454

Query: 316 QAIDTPGVIERVSTLFRGYPNLIQGFNTFLP 346
           +      V  +V+ LF+  P+L++ F  FLP
Sbjct: 455 EQKPINEVYAQVTHLFQNAPDLLEDFKKFLP 485

 Score = 38.5 bits (88), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 32/48 (66%)

Query: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 572
           A+SY+ ++K +FS +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 237 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 284

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
            (REAL)
          Length = 1555

 Score = 1166 bits (3016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/983 (59%), Positives = 703/983 (71%), Gaps = 47/983 (4%)

Query: 621  NQPVARQNLPPLGSFSPPPNGTAPRDYYQEPSQGMALPPMTHLETQAAKVTPSHYVMTQG 680
            N+ V +QNLPP+GSFSPP NG+   D YQ+  Q    PP  HL    + V     ++ QG
Sbjct: 551  NRGVPQQNLPPIGSFSPPTNGSTVHDNYQD--QQHMQPP--HLVPLPSMVQHGPNMVHQG 606

Query: 681  MSNDAIPLSNMRSPTVGAPGAQTPVETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 740
            ++N+ +P+S++R+         T  +                                  
Sbjct: 607  IANENLPISDLRTSLTDQYAPSTFQQQQQ------------------------------- 635

Query: 741  XXTIPLTQPSQLGPQQEVQYVDIAVRPEIDLDXXXXXXXXXXXXXXXDSLSLVEETSFFD 800
                    P  + P  ++QY D+ VRPEIDLD               D++SL EE +FF+
Sbjct: 636  -------NPPSISPITDLQYGDVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFE 688

Query: 801  KAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQDRP 860
            KAK++IGNK LYTEFLKILNLYSQD+LD+D LVEKV+ YLG +KELF+WFKNFVGYQ++ 
Sbjct: 689  KAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKT 748

Query: 861  KNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWAS 920
            K IEN++HEKHRLDLD+CEA GPSYK+LPKSDTFMPCSGRD+MCWE+LNDEW+GHPVWAS
Sbjct: 749  KCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEILNDEWVGHPVWAS 808

Query: 921  EDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANFK 980
            EDSGFIAHRKNQYEETLFK+EEERHEYDFYIESNLRTIQ LETI +KI NMTE EK++FK
Sbjct: 809  EDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTESEKSDFK 868

Query: 981  LPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQR 1040
            LPPGLGHTS+TIYKKVIRKVYDKERGFEIIDALHEHPAV  PVVLKRLKQKDEEWRRAQR
Sbjct: 869  LPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQR 928

Query: 1041 EWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPK 1100
            EWNKVWRELEQKV+FKSLDHLGLTFKQADKKLLTTKQLISEI+SIKVDQTNK+IHWLTPK
Sbjct: 929  EWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEINSIKVDQTNKKIHWLTPK 988

Query: 1101 PKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERXXXXXXXXXXXXXXIPVSEVN 1160
            PKSQLD+DFPD++IF DIL L + F++HT  YSN DKER              IP+ ++ 
Sbjct: 989  PKSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSIPLEKIE 1048

Query: 1161 DGLRRRSPSXXXXXXXXXXXXGTALAHGKRPREIELPLRDILHRNKYQKLKLRXXXXXXX 1220
              L+    +              +    KRP + E+ L DILHRN+YQKLK R       
Sbjct: 1049 KALQFHKENVSESSGSDDG---GSSTSRKRPYQQEMSLLDILHRNRYQKLK-RSNDEEGK 1104

Query: 1221 XXXXXXXXXXXXXXXXXXXXXXXXAKKPWLLGNIVEEANAQGIISNRKSFNLFANTSIYV 1280
                                    A+ PWL GN+VEEAN+QGII NR  FNLFANT+IY+
Sbjct: 1105 IPQLSEPLDEESNTIEEEELISEEARNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYI 1164

Query: 1281 FFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGLDAYEQ 1340
            FFRH TT+YERL+E+K ++ ++T+E+N+R    FAKDL+L+S QL  MGLDF G DAY+Q
Sbjct: 1165 FFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAKDLDLLSNQLPEMGLDFIGEDAYKQ 1224

Query: 1341 LLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIKCSEIM 1400
            +L LS+RLI GD+EHQWFEESLRQAYNN+AFK YT+DKV Q+LVKHAHT++ D+K +EIM
Sbjct: 1225 VLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMADVKTAEIM 1284

Query: 1401 VLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYIAIDDLTLAE 1460
             LF KDR   TTSAKDQI+YR+Q RS+MSN ENMFRIE N+ S HV +QYIA+DDLTL E
Sbjct: 1285 ALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFRIELNKRSLHVSVQYIALDDLTLKE 1344

Query: 1461 AKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIESEQEYDEDNGGDPKFSPEGVS 1520
             K+ EDKWKYYVTSY L HPTEGISHE L++PFLE++IE  Q+ D     D +FSPEG+S
Sbjct: 1345 PKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLERLIEFGQDTD-GREVDEEFSPEGIS 1403

Query: 1521 KSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLDSE 1580
             S+LRIKI P TY L +E GS DVF+RKAVNK+P   N + HK  V +K  LI  +L++ 
Sbjct: 1404 LSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPTIANDDVHKEMVVQKTALISRFLENA 1463

Query: 1581 KGWKKNLDAKSIQSVEEKLNFVK 1603
               + +L+  +   ++EKL  +K
Sbjct: 1464 IRSRNDLNEATKSGMQEKLALLK 1486

 Score =  193 bits (490), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 90/116 (77%), Positives = 99/116 (85%)

Query: 274 DQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRG 333
           D  YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLFRG
Sbjct: 221 DPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRG 280

Query: 334 YPNLIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVAEMNQAALFQGQQP 389
           YP LIQGFNTFLPQGYRI+CS NPD+PI+VTTPMG++TV      +      GQ+P
Sbjct: 281 YPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEP 336

 Score =  115 bits (287), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 58/70 (82%), Positives = 60/70 (85%), Gaps = 4/70 (5%)

Query: 505 PVQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVY 564
           PVQ    +  KK  DVEFSQAISYVNKIK RF+DQPDIYKHFLEILQTYQREQKPINEVY
Sbjct: 403 PVQ----EDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY 458

Query: 565 AQVTVLFQNA 574
           AQVT LFQNA
Sbjct: 459 AQVTHLFQNA 468

 Score = 53.9 bits (128), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+  P+L++ F  F
Sbjct: 419 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 478

Query: 345 LP 346
           LP
Sbjct: 479 LP 480

 Score = 38.5 bits (88), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 32/48 (66%)

Query: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 572
           A+SY+ ++K +FS +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 232 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 279

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 1147 bits (2968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/839 (65%), Positives = 649/839 (77%), Gaps = 14/839 (1%)

Query: 760  YVDIAVRPEIDLDXXXXXXXXXXXXXXXDSLSLVEETSFFDKAKKFIGNKQLYTEFLKIL 819
            YV+  VRPEIDLD                + +L+EETSFFDKAKKFI NKQ+YTEFLK+L
Sbjct: 603  YVEAPVRPEIDLDPSIVPVVPEPTEPIESNFTLIEETSFFDKAKKFINNKQIYTEFLKVL 662

Query: 820  NLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQDRPKNIENVIHEKHRLDLDMCE 879
            NL+SQDL+ +D LV KVE+Y+G SKELF WF+NFVGYQ  PK IEN++HEKHRLDLD+CE
Sbjct: 663  NLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRLDLDLCE 722

Query: 880  ASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWASEDSGFIAHRKNQYEETLFK 939
            A GPSYK+LPKSDTFMPCSGRD+MCWEVLNDEW+GHPVWASEDSGFIAHRKNQYEETLFK
Sbjct: 723  ACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 782

Query: 940  VEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANFKLPPGLGHTSLTIYKKVIRK 999
            +EEERHEYD+YIESNLRTIQTLE I +KI+NM+EEEK NFKL PGLGHTSLTIYKKVIRK
Sbjct: 783  IEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIYKKVIRK 842

Query: 1000 VYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLD 1059
            VYDKERGFEIIDALHEHPA+A P+VLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLD
Sbjct: 843  VYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLD 902

Query: 1060 HLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPKPKSQLDYDFPDREIFCDIL 1119
            HLGLTFKQADKKLLT KQLISEISSIKVDQ NKRIHWLTPKPKSQL++D  D EI  DIL
Sbjct: 903  HLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFDIL 962

Query: 1120 SLTEVFLNHTGNYSNSDKERXXXXXXXXXXXXXXIPVSEVNDGL-RRRSPSXXXXXXXXX 1178
            SL+E F+NH+  YS SDKER              +P++E+N+ L +R +           
Sbjct: 963  SLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDKRNNQKNSEKVTDSA 1022

Query: 1179 XXXGTALAHGKRPREIELPLRDILHRNKYQKLKLRXXXXXXXXXXXXXX---XXXXXXXX 1235
               GT     +   +IEL + DILHR KYQK+KL                          
Sbjct: 1023 LPDGTENQKKRSIHDIELSMSDILHRTKYQKMKLSNRGSDSQEENNIDTIIDEESDERLA 1082

Query: 1236 XXXXXXXXXAKKPWLLGNIVEEANAQGIISNRKSFNLFANTSIYVFFRHLTTLYERLIEV 1295
                     AK+PWLLG+I+++ N QGII++RK FNLFANT+IYVF RH TTLYERL+E+
Sbjct: 1083 EEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLLEL 1142

Query: 1296 KSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGLDAYEQLLHLSKRLIEGDIEH 1355
            K ++ EVT+EIN+RK  +FA+DL L+S QLKNMGLDF   D+YE+LL LSKRLIE DIEH
Sbjct: 1143 KEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDIEH 1202

Query: 1356 QWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIKCSEIMVLFEKDRTLATTSAK 1415
            QWFEESLRQAYNNRAFK YTVDKVVQALVKH HT++TD K +E+M LFEKDR  + TSAK
Sbjct: 1203 QWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATSAK 1262

Query: 1416 DQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTSY 1475
            DQILYR+QARSHMSNTE MFRIE+N+  +++CIQYIA+DDLTL E  + E+KWKYYVTSY
Sbjct: 1263 DQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVTSY 1322

Query: 1476 SLSHPTEGISHEDLQVPFLEKIIESEQ-------EYDEDNGGDPKFSPEGVSKSSLRIKI 1528
            SL HPTEGI HE LQ+PFL+KI+E +Q       E ++ NG   K+SPEGVS S  +IKI
Sbjct: 1323 SLPHPTEGIDHESLQIPFLQKILEFDQEELENNDEENKSNG---KYSPEGVSNSMYKIKI 1379

Query: 1529 DPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLDSEKGWKKNL 1587
             P  Y L+++ GS D+FSRK++NK+P++ N +    K++KK  ++  +L+S  GWKK+L
Sbjct: 1380 HPGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHESLKLNKKKNILNTFLESNNGWKKHL 1438

 Score =  187 bits (475), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 96/115 (83%)

Query: 274 DQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRG 333
           D  YRPLNVKDALSYLEQVK QFNSRPD+YN FLDIMKDFKSQ IDTPGVIERVSTLFRG
Sbjct: 207 DASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRG 266

Query: 334 YPNLIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVAEMNQAALFQGQQ 388
           YP+LIQGFNTFLP GYRIDC  NP++PIKVTTP+GSST+  +    Q A    QQ
Sbjct: 267 YPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSSTLHEMTRSVQRANSNLQQ 321

 Score =  149 bits (376), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 109/192 (56%), Gaps = 7/192 (3%)

Query: 506 VQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYA 565
           V  Q     KK ADVEFSQAI+YVNKIKNRF+DQPDIYK+FLEILQTYQREQKPINEVYA
Sbjct: 354 VDDQAKQANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYA 413

Query: 566 QVTVLFQNAXXXXXXXXXXXXXSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENQP-- 623
           QVT+LFQNA             SS                               N P  
Sbjct: 414 QVTILFQNAPDLLDDFKKFLPDSSKEQQYTGQLPQQIPNQEQLEEFSGSYARPP-NAPLD 472

Query: 624 -VARQNLPPLGSFSPPPN-GTAPRDYYQEPSQGMALPPMT-HLETQAAKVTPSHYVMTQG 680
            VA+Q+LPP+GSFSPP N G +  D  Q P   MALP M  H +       P   V TQG
Sbjct: 473 MVAQQSLPPIGSFSPPANTGISMHDQSQRP-HMMALPSMLQHEQIIDMNNHPKPAVSTQG 531

Query: 681 MSNDAIPLSNMR 692
           +SND IP+S++R
Sbjct: 532 ISNDEIPVSDVR 543

 Score = 49.3 bits (116), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 40/62 (64%)

Query: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344
           A++Y+ ++K +F  +PD+Y +FL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 373 AINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNAPDLLDDFKKF 432

Query: 345 LP 346
           LP
Sbjct: 433 LP 434

 Score = 39.3 bits (90), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 572
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 218 ALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFR 265

 Score = 34.3 bits (77), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 8/78 (10%)

Query: 788 DSLSLVEETSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELF 847
           D+LS +E+       ++F     +Y +FL I+  +    +D  G++E+V     G   L 
Sbjct: 217 DALSYLEQVK-----QQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLI 271

Query: 848 TWFKNFV--GYQ-DRPKN 862
             F  F+  GY+ D P N
Sbjct: 272 QGFNTFLPTGYRIDCPSN 289

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
            (REAL)
          Length = 1561

 Score = 1144 bits (2958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/859 (65%), Positives = 661/859 (76%), Gaps = 11/859 (1%)

Query: 752  LGPQQEVQYVDIAVRPEIDLDXXXXXXXXXXXXXXXDSLSLVEETSFFDKAKKFIGNKQL 811
            + P  + QY D+ VRPEIDLD               D++SL EE +FF+KAK++IGNK L
Sbjct: 646  ISPIIDSQYGDVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHL 705

Query: 812  YTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQDRPKNIENVIHEKH 871
            YTEFLKILNLYSQD+LD+D LVEKV+ YLG +KELF+WFKNFVGYQ++ K+IENV+HEKH
Sbjct: 706  YTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKH 765

Query: 872  RLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWASEDSGFIAHRKN 931
            RLDLD+CEA GPSYK+LPKSDTFMPCSGRD+MCWEVLNDEW+GHPVWASEDSGFIAHRKN
Sbjct: 766  RLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKN 825

Query: 932  QYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANFKLPPGLGHTSLT 991
            QYEETLFK+EEERHEYDFYIESNLRTIQ LETI +KI NMTE EKANFKLPPGLGHTS+T
Sbjct: 826  QYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMT 885

Query: 992  IYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQ 1051
            IYKKVIRKVYDKERGFEIIDALHEHPAV  PVVLKRLKQKDEEWRRAQREWNKVWRELEQ
Sbjct: 886  IYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQ 945

Query: 1052 KVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPKPKSQLDYDFPD 1111
            KVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNK+IHWLTPKPKSQLD+DFPD
Sbjct: 946  KVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPD 1005

Query: 1112 REIFCDILSLTEVFLNHTGNYSNSDKERXXXXXXXXXXXXXXIPVSEVNDGLRRRSPSXX 1171
            ++IF DIL L + F+ HT  YSN DKER              IP+ ++ + L+    +  
Sbjct: 1006 KDIFYDILYLADSFIAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYKQNLS 1065

Query: 1172 XXXXXXXXXXGTALAHGKRPREIELPLRDILHRNKYQKLKLRXXXXXXXXXXXXXXXXXX 1231
                       T     KRP + E+ L DILHR+KYQKLK R                  
Sbjct: 1066 DSSGSDDGDSSTP---RKRPYQQEMSLLDILHRSKYQKLK-RSNDEDGKVPQLSEPLDEE 1121

Query: 1232 XXXXXXXXXXXXXAKKPWLLGNIVEEANAQGIISNRKSFNLFANTSIYVFFRHLTTLYER 1291
                         AK PWL GN+VEEAN+QGII NR  FNLFAN++IY+FFRH TT+YER
Sbjct: 1122 SNAIEEEELINEEAKNPWLTGNLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYER 1181

Query: 1292 LIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGLDAYEQLLHLSKRLIEG 1351
            L+E+K ++++VT+EI+ R +  FAKDL+L+S QL  MGLDF G DAY+Q+L LS+RLI G
Sbjct: 1182 LLEIKQMNEKVTKEISKRSMVTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLING 1241

Query: 1352 DIEHQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIKCSEIMVLFEKDRTLAT 1411
            ++EHQWFEE LRQAYNN+AFK YT+DKV+Q LVKHAHT++TD K +EIM LF KDR  +T
Sbjct: 1242 ELEHQWFEEGLRQAYNNKAFKLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNAST 1301

Query: 1412 TSAKDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYIAIDDLTLAEAKSLEDKWKYY 1471
            TSAKDQI+YR+QARS+MSNTENMFR+EF+R + HV +QYIA+DDLTL E ++ EDKWKYY
Sbjct: 1302 TSAKDQIIYRLQARSYMSNTENMFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYY 1361

Query: 1472 VTSYSLSHPTEGISHEDLQVPFLEKIIESEQEYDEDNGG---DPKFSPEGVSKSSLRIKI 1528
            VTSY+L HPTEGISHE L++PFLE++I    EY +D  G   D KFSPEG+S S+L+IKI
Sbjct: 1362 VTSYALPHPTEGISHEKLKIPFLERLI----EYGQDTDGREVDEKFSPEGLSVSTLKIKI 1417

Query: 1529 DPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLDSEKGWKKNLD 1588
             P TY L +E GS DVF+RKA NK+P   N + HK  V KK  LI  +LD+    + +L+
Sbjct: 1418 QPVTYKLHIESGSYDVFTRKAANKYPTVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLN 1477

Query: 1589 AKSIQSVEEKLNFVKNYGT 1607
                 S++EKL+ +K   T
Sbjct: 1478 ETKKLSMQEKLDSLKGATT 1496

 Score =  192 bits (489), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 90/116 (77%), Positives = 99/116 (85%)

Query: 274 DQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRG 333
           D  YRPLNVKDALSYLEQVKFQFNSRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLFRG
Sbjct: 64  DPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRG 123

Query: 334 YPNLIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVAEMNQAALFQGQQP 389
           YP LIQGFNTFLPQGYRI+CS NPD+PI+VTTPMG++TV         +  + Q+P
Sbjct: 124 YPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSALEPQEP 179

 Score =  121 bits (304), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 63/78 (80%), Positives = 66/78 (84%), Gaps = 2/78 (2%)

Query: 499 QPEVPAP-VQPQLA-DQTKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQRE 556
           QPE+P P  QP  A +  KK  DVEFSQAISYVNKIK RF+DQPDIYKHFLEILQTYQRE
Sbjct: 231 QPELPIPQSQPLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQRE 290

Query: 557 QKPINEVYAQVTVLFQNA 574
           QKPINEVYAQVT LFQNA
Sbjct: 291 QKPINEVYAQVTHLFQNA 308

 Score = 53.9 bits (128), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+  P+L++ F  F
Sbjct: 259 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 318

Query: 345 LP 346
           LP
Sbjct: 319 LP 320

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 44/73 (60%), Gaps = 4/73 (5%)

Query: 621 NQPVARQNLPPLGSFSPPPNGTAPRDYYQEPSQGMALPPMTHLETQAAKVTPSHYVMTQG 680
           N  + +QNLPP+GSFSPP NG+   + +Q+  Q    PP  HL    + V     ++ QG
Sbjct: 557 NGGIPQQNLPPIGSFSPPTNGSTTHEGFQD--QQHMQPP--HLMPLPSMVQQGPNMVHQG 612

Query: 681 MSNDAIPLSNMRS 693
           + N+ IPLS++R+
Sbjct: 613 IVNENIPLSDLRT 625

 Score = 37.0 bits (84), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 572
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 75  ALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 122

>Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ACL004W
          Length = 1474

 Score = 1140 bits (2949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/1004 (59%), Positives = 711/1004 (70%), Gaps = 80/1004 (7%)

Query: 628  NLPPLGSFSPPPNGTAPRDYYQEPSQGMALPPMTHLETQAAKVTPSHYVMTQGMSNDAIP 687
            NLPPLGSFS P +              M LP +        +  P+H ++TQGMSN  IP
Sbjct: 488  NLPPLGSFSTPGD-----------HHPMNLPLVQAPNMNLNQGHPAH-IITQGMSNQKIP 535

Query: 688  LSNMRSPTVGAPGAQTPVETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIPLT 747
            +S++R          T  +T+                                       
Sbjct: 536  ISDLR----------TTADTSY-------------------------------------- 547

Query: 748  QPSQLGPQQEVQYVDIAVRPEIDLDXXXXXXXXXXXXXXXDSLSLVEETSFFDKAKKFIG 807
            +P++    Q+ QY++   RPEIDLD               D L+LVEE SFFDKAKK+IG
Sbjct: 548  RPAEYSQGQDTQYMETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIG 607

Query: 808  NKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQDRPKNIENVI 867
            NKQ+YTEFLKILNLYSQDLLD + LVEKV HYL G  ELF WFK+FVGYQ++PK+IEN++
Sbjct: 608  NKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKPKHIENIV 667

Query: 868  HEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWASEDSGFIA 927
            HEKHRLDLD+CEA GPSYK+LPK+DTFMPCSGRDEMCWEVLNDEW+GHPVWASEDSGFIA
Sbjct: 668  HEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIA 727

Query: 928  HRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANFKLPPGLGH 987
            HRKNQYE+TLFK+EEERHEYDFYIE+NLRTIQTLETIA+KIANMT EEKA FKLPPGLGH
Sbjct: 728  HRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLPPGLGH 787

Query: 988  TSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQREWNKVWR 1047
            TS+TIYKKVIRKVYDK+RG+EIIDALHE+PA+ VP+VLKRLKQKDEEWRRAQREWNKVWR
Sbjct: 788  TSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNKVWR 847

Query: 1048 ELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPKPKSQLDY 1107
            ELEQKV+FKSLDHLGLTFKQADKKLLT KQLISEISSIKVDQ NKRIH LTPK KSQLD+
Sbjct: 848  ELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQLDH 907

Query: 1108 DFPDREIFCDILSLTEVFLNHTGNYSNSDKERXXXXXXXXXXXXXXIPVSEVNDGLRRRS 1167
            DF D E+F DIL+L  VFL +   YS  DKER               PV ++   L +R 
Sbjct: 908  DFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIEKALAKRD 967

Query: 1168 PS--------XXXXXXXXXXXXGTALAHGKRPRE-IELPLRDILHRNKYQKLKLRXXXXX 1218
             +                    G      KR RE  +  LRD+L RNK QK         
Sbjct: 968  AASSSQSSNSNTETYSEKQQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQK------GGR 1021

Query: 1219 XXXXXXXXXXXXXXXXXXXXXXXXXXAKKPWLLGNIVEEANAQGIISNRKSFNLFANTSI 1278
                                      AK PWLLG+IV+EA+  G + NRK+FNLFANT+I
Sbjct: 1022 NSPRGDSSISAEKESDMEEEEIIRQEAKNPWLLGSIVDEADNHGHVENRKTFNLFANTNI 1081

Query: 1279 YVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGLDAY 1338
            YVFFRHL T+YERL+EVK ++ EVT+EI +RKV QFAKDLNLIS QL +MGLDF G DAY
Sbjct: 1082 YVFFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGEDAY 1141

Query: 1339 EQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIKCSE 1398
            E+LL LS+ LI GD+EHQWFEESLRQAY N+AFK YTVDKV+QALVKHAH I+TD K  E
Sbjct: 1142 EKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKTVE 1201

Query: 1399 IMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYIAIDDLTL 1458
            IM+LFEKDRT  +TS KDQILYR+Q RS+MSN ENMFRIE+NR++ HVCIQ++A+DDLTL
Sbjct: 1202 IMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDLTL 1261

Query: 1459 AEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIESEQEYDEDNGGDPKFSPEG 1518
             E KSL+DKW+YY+TSYSLSHPTEGISH++L+ PFLEKIIESE++  ED   D K+SPEG
Sbjct: 1262 EEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLEKIIESEEDIIEDK--DEKYSPEG 1319

Query: 1519 VSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLD 1578
            V+ S+L++KIDP TY +EVE GS D+FSRKAVNKFP+  +    K+  + K EL R +L+
Sbjct: 1320 VATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRVDIRKKKSS-ELKLELER-FLN 1377

Query: 1579 SEKGWKKNLDAKSIQSVEEKLNFVKNYGTLQGYRAQENGLESTT 1622
            S  GWKK+L AK I  VE++L FVK  G L+ Y + ++ + ST+
Sbjct: 1378 SNSGWKKDLSAKQIAEVEKRLEFVKLNGNLEEY-SDDSAVASTS 1420

 Score =  186 bits (473), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 96/116 (82%)

Query: 277 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPN 336
           YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLF+GYP 
Sbjct: 160 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPT 219

Query: 337 LIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVAEMNQAALFQGQQPRIQ 392
           LIQGFNTFLPQGY I+CS +P++PIKVTTP G++    +     + +     PR +
Sbjct: 220 LIQGFNTFLPQGYNIECSSDPNDPIKVTTPFGTTGEVAIGGGGGSGVCGHVVPRAE 275

 Score =  119 bits (299), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 64/83 (77%), Gaps = 2/83 (2%)

Query: 492 SSGTGPTQPEVPAPVQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQ 551
           S+   PT P+     Q Q     KK  DVEFS AISYVNKIK RF+DQPDIYKHFLEILQ
Sbjct: 326 STDGSPTMPQRQP--QDQFGTGGKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQ 383

Query: 552 TYQREQKPINEVYAQVTVLFQNA 574
           TYQREQKPINEVYAQVTVLFQNA
Sbjct: 384 TYQREQKPINEVYAQVTVLFQNA 406

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 40/64 (62%)

Query: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 416

Query: 345 LPQG 348
           LP  
Sbjct: 417 LPDA 420

 Score = 42.7 bits (99), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 33/48 (68%)

Query: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 572
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +V+ LFQ
Sbjct: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQ 215

 Score = 35.4 bits (80), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 7/80 (8%)

Query: 271 PLHDQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTL 330
           PL D+    LN+ +  S+ ++ K ++     +Y  FL I+  +    +D   ++E+V   
Sbjct: 585 PLEDE----LNLVEEASFFDKAK-KYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHY 639

Query: 331 FRGYPNLIQGFNTFLPQGYR 350
             G P L   F +F+  GY+
Sbjct: 640 LSGCPELFDWFKSFV--GYQ 657

>TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1512

 Score = 1137 bits (2940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/1001 (57%), Positives = 711/1001 (71%), Gaps = 27/1001 (2%)

Query: 624  VARQNLPPLGSFSPPPNGTAPRDYYQEPSQGMAL---PPMTHLETQ------AAKVTPSH 674
            V  Q+LPPLG+F PP N             G++    P + H+++Q          TP+ 
Sbjct: 479  VTIQSLPPLGNFLPPSNKNNNTTAVNNNLMGISSIMHPKVDHIQSQQYIADQKQAYTPAQ 538

Query: 675  YVMTQGMSNDAIPLSNMRSPTVGAP--GAQTPVETAXXXXXXXXXXXXXXXXXXXXXXXX 732
               T  ++N+A+ +S +R    G+P    QT    A                        
Sbjct: 539  QQSTTQLTNEAMQISELR----GSPMMDGQTARNLANVNYSPAELNQLQAQQHISIQQQQ 594

Query: 733  XXXXXXXXXXTIPLTQPSQLGPQQEVQYVDIAVRPEIDLDXXXXXXXXXXXXXXXDSLSL 792
                       + +      G  Q     DI+VRPEIDLD               DSLSL
Sbjct: 595  QQQQQQQQQLQMQMQMQMDGGYPQ-----DISVRPEIDLDPSIVPVIPEPVEPIEDSLSL 649

Query: 793  VEETSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKN 852
            VEET+FFDKAKKFI NKQ+Y EFLKILNLYSQ++L+++ LVEKV++YLG +KELF WFK 
Sbjct: 650  VEETNFFDKAKKFINNKQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKG 709

Query: 853  FVGYQDRPKNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEW 912
            FVGYQD+PK+IEN++HEKH+LDLD+CEA GPSYKKLPK+DTFMPCSGRDEMCWEVLND+W
Sbjct: 710  FVGYQDKPKHIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDW 769

Query: 913  IGHPVWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMT 972
            +GHPVWASEDSGFIAHRKNQYEETLFK+EEERHEYDFYIESNLRTIQTLETIASKIANMT
Sbjct: 770  VGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMT 829

Query: 973  EEEKANFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKD 1032
            EEE+ANFKLP GLGHTS+TIY+KVIRKVY KERGFE+IDALHE+PAVAVP++LKRLKQKD
Sbjct: 830  EEERANFKLPIGLGHTSVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKD 889

Query: 1033 EEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNK 1092
            EEWRRAQREWNKVWREL+QKVY+KSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNK
Sbjct: 890  EEWRRAQREWNKVWRELQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNK 949

Query: 1093 RIHWLTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERXXXXXXXXXXXXX 1152
            ++HWLTPKPKSQLDY   DR+I  DIL LT+VF+NHT NYSN DKER             
Sbjct: 950  KLHWLTPKPKSQLDYKVADRQILYDILKLTDVFINHTSNYSNPDKERLRDFLQSFISLFF 1009

Query: 1153 XIPVSEVNDGLRRRSPSXXXXXXXXXXXXGTALAHGKRPRE-IELPLRDILHRNKYQKLK 1211
             IP++++   ++ RSP              +     KR  E  ++   DIL + KYQK+K
Sbjct: 1010 FIPLADIKAAIKIRSPLDDTKTDSEESSGDSDKFPKKRSIEDDDISFHDILDKVKYQKVK 1069

Query: 1212 LRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKKPWLLGNIVEEANAQGIISNRKSFN 1271
                                             A+KPWLLG+IV++AN+ GII NR  +N
Sbjct: 1070 -----QGLDKNETFSNDISSATSVDDDELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYN 1124

Query: 1272 LFANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLD 1331
            +F NT+IYVF RHL TLYERL E K ++ EVT+EI +R +  FAKDLNL+S QLKNMGLD
Sbjct: 1125 IFGNTNIYVFIRHLITLYERLNEAKQMNAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLD 1184

Query: 1332 FAGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTIL 1391
            F G D+Y+QLL LS RLIEG++EH WFEESLRQA+ N+AFK YT+DKV Q++VKHAHTI+
Sbjct: 1185 FEGTDSYKQLLDLSTRLIEGNLEHHWFEESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIM 1244

Query: 1392 TDIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYI 1451
            +D K +EIM+L EKDR+ ATTS+KDQILYR+QARSHMS T+NMFRIEFN+ S ++ IQYI
Sbjct: 1245 SDTKTAEIMMLMEKDRSCATTSSKDQILYRLQARSHMSTTDNMFRIEFNKSSDNISIQYI 1304

Query: 1452 AIDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIESEQEYDEDNGG- 1510
             +DDLTL E K+ E+KWKYY+TSY+LSHPTEG+  E++Q+PFLEKI+E+E+ Y E+    
Sbjct: 1305 GMDDLTLGEPKTAEEKWKYYITSYALSHPTEGVPQEEIQIPFLEKILETEEAYAEEEEVI 1364

Query: 1511 DPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKN 1570
            + K+SP+GVS+S L+IKI PE Y LE+EPGS D FSR ++NK+P++  S+ +K K     
Sbjct: 1365 NDKYSPKGVSQSDLKIKISPENYALEIEPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSI 1424

Query: 1571 ELIRGYLDSEKGWKKNLDAKSIQSVEEKLNFVKNYGTLQGY 1611
            + +  +L+ + GWK++L    I ++  K + +K YG+L+ Y
Sbjct: 1425 DRVNAFLNGKFGWKQSLSEDEINNINLKYSHIKKYGSLKNY 1465

 Score =  189 bits (481), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 98/109 (89%)

Query: 274 DQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRG 333
           +Q+YRPLNVKDAL+YLEQVK QF+SRPD+YNHFLDIMKDFKSQ+IDTPGVIERVSTLFRG
Sbjct: 139 EQFYRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRG 198

Query: 334 YPNLIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVAEMNQAA 382
           YP+LIQGFNTFLPQGY I+C+ NP++PIKVTTP+GS T+     +  AA
Sbjct: 199 YPSLIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETIPYAKPIPSAA 247

 Score =  114 bits (286), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 69/93 (74%), Gaps = 7/93 (7%)

Query: 489 SAVSSGTGPTQPEVPAPVQPQLADQTK-------KAADVEFSQAISYVNKIKNRFSDQPD 541
           + V+      Q    AP+QP + + T+       K ADVEFSQA+SYVNKIKNRF D+PD
Sbjct: 314 TEVTKSESVIQSSANAPIQPNMHNMTQDTMKITEKPADVEFSQAVSYVNKIKNRFVDEPD 373

Query: 542 IYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 574
           IYK FLEILQTYQ+EQKPI+EVY+QVT+LFQNA
Sbjct: 374 IYKTFLEILQTYQKEQKPIHEVYSQVTILFQNA 406

 Score = 48.5 bits (114), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 38/62 (61%)

Query: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344
           A+SY+ ++K +F   PD+Y  FL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 357 AVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAPDLLDDFKKF 416

Query: 345 LP 346
           LP
Sbjct: 417 LP 418

 Score = 41.6 bits (96), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 33/48 (68%)

Query: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 572
           A++Y+ ++K +FS +PDIY HFL+I++ ++ +      V  +V+ LF+
Sbjct: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 197

>TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6.29
            YOL004W
          Length = 1739

 Score = 1119 bits (2895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/922 (59%), Positives = 684/922 (74%), Gaps = 17/922 (1%)

Query: 755  QQEVQYVDIAVRPEIDLDXXXXXXXXXXXXXXXDSLSLVEETSFFDKAKKFIGNKQLYTE 814
            QQ+V Y + AVRPEIDLD               D+L LVEET+FFDK KK+IGNK +Y E
Sbjct: 820  QQQVMYEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAE 879

Query: 815  FLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQDRPKNIENVIHEKHRLD 874
            FLK+LNLYS DLL++D LVEK+++YL  ++ELF+WFKNFVGY ++PK+IEN++HEKH+LD
Sbjct: 880  FLKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLD 939

Query: 875  LDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWASEDSGFIAHRKNQYE 934
            LD+CEA GPSYKKLPK+DT MPCSGRDEMCWE+LNDEW+GHPVWASEDSGFIAHRK   +
Sbjct: 940  LDLCEACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTK 999

Query: 935  ETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANFKLPPGLGHTSLTIYK 994
            +   +++++ HEYDFYIESNLRTIQTLETIASKIANMTE EK NFKLP GLGHT+ TIYK
Sbjct: 1000 KPYLRLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYK 1059

Query: 995  KVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVY 1054
            KVIRKVYDKERGFEIIDALHE+PA+AVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKV+
Sbjct: 1060 KVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVF 1119

Query: 1055 FKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPKPKSQLDYDFPDREI 1114
            FKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQT+KR+HWLTPKPKSQLD++ PD++I
Sbjct: 1120 FKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDI 1179

Query: 1115 FCDILSLTEVFLNHTGNYSNSDKERXXXXXXXXXXXXXXIPVSEVNDGLRRRSPSXXX-X 1173
              DILS  E+F+ HT  YSN +KER              IP+ E+ + + +R  +     
Sbjct: 1180 IFDILSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDE 1239

Query: 1174 XXXXXXXXGTALAHGKRPREIELPLRDILHRNKYQKLKLRXXXXXXXXXXXXXXXXXXXX 1233
                    G   +  +  R+I L L DIL R KYQ+LK                      
Sbjct: 1240 KLEDKQKNGEENSKKRTSRDITLSLEDILQRTKYQRLKY---GDDSDEVDGHGNRHDDQK 1296

Query: 1234 XXXXXXXXXXXAKKPWLLGNIVEEANAQGIISNRKSFNLFANTSIYVFFRHLTTLYERLI 1293
                       AKKPWLLG +VEEANAQG I +R  FN+F+NT++Y+F RHLTT+YERL 
Sbjct: 1297 LLEEEELLRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLH 1356

Query: 1294 EVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGLDAYEQLLHLSKRLIEGDI 1353
            E+K ++ +V++EI+ RK+S+FAKDLNLIS QL  MGLDF+  D Y+QLL L KRLI GD+
Sbjct: 1357 EIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDL 1416

Query: 1354 EHQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIKCSEIMVLFEKDRTLATTS 1413
            EHQWFEESLRQA+NN+AFK YT+DKV QALVKHAHTI++D+K +EIM LFEKDRT  +TS
Sbjct: 1417 EHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTS 1476

Query: 1414 AKDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYIAIDDLTLAEAKSLEDKWKYYVT 1473
            +KDQILYR+Q R+ M++ ENMFRIE+N  +KH+CIQYIA+DDLT+ +AK+LE+KWKYY+T
Sbjct: 1477 SKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYIT 1536

Query: 1474 SYSLSHPTEGISHEDLQVPFLEKIIESEQEYDEDNGGDP-------KFSPEGVSKSSLRI 1526
            SY+LSHPTEGI  E++Q+PFLE+IIE EQ Y+++   D        K+SPEG+S S+L+I
Sbjct: 1537 SYALSHPTEGIFQENIQIPFLERIIEEEQLYEDEETDDQKQTKSLMKYSPEGISGSTLKI 1596

Query: 1527 KIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLDSEKGWKKN 1586
            KIDP+ Y L +E GS D+FSRK++N+FP++   +S    + K    +  +L+S+ GWK+ 
Sbjct: 1597 KIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKRA 1656

Query: 1587 LDAKSIQSVEEKLNFVKNYGTLQGYRAQENGLESTTKEAPFSDAVERKXXXXXXXXXXXX 1646
            +    ++S+E K + + N G L+GY+ +     S  K+   +D  +              
Sbjct: 1657 ISKDQMESIESKWDHLSNNGNLEGYQEK-----SILKDVNGTDISKISPMKTFTVTESAN 1711

Query: 1647 XXPSNTAGVEERGGNDTTAEDV 1668
              P++ A  EER GNDTTAE+V
Sbjct: 1712 GVPNDKADGEER-GNDTTAEEV 1732

 Score =  194 bits (494), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 91/125 (72%), Positives = 103/125 (82%), Gaps = 3/125 (2%)

Query: 271 PLHDQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTL 330
           P  D  YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVI RVS+L
Sbjct: 293 PKEDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSL 352

Query: 331 FRGYPNLIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVAEMNQAALFQGQQPR 390
           F  YP+LIQGFNTFLPQGYRI+CS NP+ PI V TPMG++TV+GV E    ++ + Q  +
Sbjct: 353 FHDYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGVLE---TSVTENQNHQ 409

Query: 391 IQQHL 395
           +Q  L
Sbjct: 410 LQHSL 414

 Score =  124 bits (310), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/162 (45%), Positives = 90/162 (55%), Gaps = 3/162 (1%)

Query: 491 VSSGTGPTQPEVPAPVQPQLAD--QTKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLE 548
            ++GT   Q  + + V P L +  + ++  DVEFSQAISYVNKIKNRF++QP IYKHFLE
Sbjct: 512 ATAGTATQQFPMVSSVSPPLQELPEQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLE 571

Query: 549 ILQTYQREQKPINEVYAQVTVLFQNAXXXXXXXXXXXXXSSXXXXXXXXXXXXXXXXXXX 608
           ILQTYQREQKPINEVY+QVTVLFQ A             SS                   
Sbjct: 572 ILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKFLPDSSANNNGSIVTSQEENFMYAN 631

Query: 609 XXXXXXXXXXXENQPVARQNLPPLGSFSPPPNGTAPRDYYQE 650
                       ++ +  QNLPPLGSFS  PNG  P+   Q+
Sbjct: 632 GFNQQQPHLTPHSE-IQAQNLPPLGSFSTQPNGVFPKQESQQ 672

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 55/110 (50%), Gaps = 14/110 (12%)

Query: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344
           A+SY+ ++K +F ++P +Y HFL+I++ ++ +      V  +V+ LF+  P+L++ F  F
Sbjct: 548 AISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKF 607

Query: 345 LPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVAEMNQAALFQGQQPRIQQH 394
           LP     D S N +         GS   +       A  F  QQP +  H
Sbjct: 608 LP-----DSSANNN---------GSIVTSQEENFMYANGFNQQQPHLTPH 643

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 34/49 (69%)

Query: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 573
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V A+V+ LF +
Sbjct: 307 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHD 355

>KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} similar to
            uniprot|Q75CF0 Ashbya gossypii ACL004W ACL004Wp and
            weakly similar to YOL004W uniprot|P22579 Saccharomyces
            cerevisiae YOL004W SIN3 DNA binding protein involved in
            transcriptional regulation
          Length = 1519

 Score = 1106 bits (2861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/985 (57%), Positives = 675/985 (68%), Gaps = 68/985 (6%)

Query: 628  NLPPLGSFSPPPNGTAPRDYYQEPSQGMALPPMTHLETQAAKVTPSHYVMTQGMSNDAIP 687
            NLPPLG+FS   +G A       P++   + P  H       V P H V+TQGMSN  IP
Sbjct: 572  NLPPLGNFSA--SGQA------SPAENSHMLPSMHQHIAGGHVIPQH-VVTQGMSNQDIP 622

Query: 688  LSNMRSPTVGAPGAQTPVETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIPLT 747
            +S MRS   G       ++ A                                       
Sbjct: 623  VSEMRSTMNGTYNQVEYIQGA--------------------------------------- 643

Query: 748  QPSQLGPQQEVQYVDIAV-RPEIDLDXXXXXXXXXXXXXXXDSLSLVEETSFFDKAKKFI 806
             P    P + VQY++  + RPEIDLD               D+++L +E +FF++ K+FI
Sbjct: 644  -PGYPQPLEGVQYMEAPMARPEIDLDPSLVPVVPEPIQPPEDAIALGDEVTFFERVKRFI 702

Query: 807  GNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQDRPKNIENV 866
            GNKQ+Y EFLKILNLYSQDLL    LV KVE YL  SKELF WFK+FVGYQ++PK+IEN+
Sbjct: 703  GNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENI 762

Query: 867  IHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWASEDSGFI 926
            +HEKHRLDLD+CEA GPSYKKLPK DTFMPCSGRDEMCWEVLNDEW+GHPVWASEDSGFI
Sbjct: 763  VHEKHRLDLDLCEACGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI 822

Query: 927  AHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANFKLPPGLG 986
            AHRKNQYE+TLFKVEEERHEYDFYIESNLRTIQTLETIA+KIANMT EEK NFKLPPGLG
Sbjct: 823  AHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLG 882

Query: 987  HTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQREWNKVW 1046
            HTSLTIYKKV+RKVYDK+RGFEIIDALHEHPAV VP+VLKRLKQKDEEWRRAQREWNKVW
Sbjct: 883  HTSLTIYKKVVRKVYDKDRGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVW 942

Query: 1047 RELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPKPKSQLD 1106
            RELEQKVY+KSLDHLGLTFKQADKKLLTTKQL+SEISSIKVDQTNKRIH LTPKPKSQLD
Sbjct: 943  RELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLD 1002

Query: 1107 YDFPDREIFCDILSLTEVFLNHTGNYSNSDKERXXXXXXXXXXXXXXIPVSEVNDGLRRR 1166
            ++  DRE+  DIL L   F+    +YSNSDK +               P+ +VN+ +  R
Sbjct: 1003 FEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSER 1062

Query: 1167 SPSXXXXXXXXXXXXGTALAHGKR--PREIELPLRDILHRNKYQKLKLRXXXXXXXXXXX 1224
            S                +    KR    E    ++DIL R K  K               
Sbjct: 1063 SSITDQENGEEDSNKSDSEKSNKRTLSDEDSYLMKDILRRTKNAK--------TSNSEEN 1114

Query: 1225 XXXXXXXXXXXXXXXXXXXXAKKPWLLGNIVEEANAQGIISNRKSFNLFANTSIYVFFRH 1284
                                A KPWLLG++++EAN  GI+S+R  FNLF NT+IYVFFRH
Sbjct: 1115 QNSSSVKSNEEDETELLAKEAAKPWLLGSLIDEANNSGIVSDRHIFNLFTNTTIYVFFRH 1174

Query: 1285 LTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGLDAYEQLLHL 1344
            L TLYERL+EVK ID EVT EI +RK+ QFA DLNLIS QL +MGL F    AY +LL L
Sbjct: 1175 LNTLYERLLEVKKIDAEVTDEIKNRKIVQFASDLNLISTQLADMGLAFKDTKAYGELLRL 1234

Query: 1345 SKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIKCSEIMVLFE 1404
            SKRLI GD++HQWFEESLRQAY N+AFK YT+DKVVQ+LVKHAH+I+TD K + +MVLFE
Sbjct: 1235 SKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHSIITDPKNAMVMVLFE 1294

Query: 1405 KDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYIAIDDLTLAEAKSL 1464
            +DR    T+AKDQILYR++ R+ M  +ENMFRIE+N  S HV IQY+A+DDLTL E +++
Sbjct: 1295 QDRLKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNM 1354

Query: 1465 EDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIESEQEYDEDNGGDPKFSPEGVSKSSL 1524
            ++KW YYVTSYSLSHPTEGI+ ED+  PFL KIIE E EY +D   + KFSPEGVS+S L
Sbjct: 1355 KEKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIEKEAEYLDDEEQNDKFSPEGVSQSKL 1414

Query: 1525 RIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLDSEKGWK 1584
            ++ I PETY L  E GS DVF+RK+VNKFP  ++++   +K+DK       +L+S KGWK
Sbjct: 1415 KVNIHPETYELTFECGSTDVFTRKSVNKFPSSQSTQP-ASKMDK-------FLNSSKGWK 1466

Query: 1585 KNLDAKSIQSVEEKLNFVKNYGTLQ 1609
            KNL  + I   E K+  +K  G L+
Sbjct: 1467 KNLSTEIIGRAESKMKILKEQGKLE 1491

 Score =  184 bits (467), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 97/113 (85%), Gaps = 2/113 (1%)

Query: 277 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPN 336
           YRPLNVKDALSYLEQVKFQF+SRPDVYNHFLDIMKDFKSQAIDTPGVI+RV+TLF+G+PN
Sbjct: 201 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPN 260

Query: 337 LIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSS--TVAGVAEMNQAALFQGQ 387
           LIQGFNTFLP GY+I+CS NP++PIKVTTP G++    AG     Q A   GQ
Sbjct: 261 LIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTGEVSAGPPTQYQLAPVAGQ 313

 Score =  106 bits (264), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 54/59 (91%)

Query: 515 KKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 573
           +K  +VEFS AISYVNKIK RF+DQPDIYK FLEILQTYQREQKPI+EVYAQVT+LFQN
Sbjct: 420 QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 39/62 (62%)

Query: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344
           A+SY+ ++K +F  +PD+Y  FL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNPDLLDDFKKF 489

Query: 345 LP 346
           LP
Sbjct: 490 LP 491

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 33/48 (68%)

Query: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 572
           A+SY+ ++K +FS +PD+Y HFL+I++ ++ +      V  +VT LFQ
Sbjct: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQ 256

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1433

 Score = 1099 bits (2842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/981 (56%), Positives = 685/981 (69%), Gaps = 70/981 (7%)

Query: 627  QNLPPLGSFSPPPNGTAPRDYYQEPSQGMALPPMTHLETQAAKVTPSHYVMTQGMSNDAI 686
            QNLPPLGSFSPP NG         P+     PP     +Q     PSH V+ Q +    +
Sbjct: 468  QNLPPLGSFSPPINGRENDPQLNLPA---VQPPAMEFASQQVPHHPSH-VVPQVIPGGTL 523

Query: 687  PLSNMRSPTVGAPGAQTPVETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIPL 746
            PLS++R    G    Q P+++                                       
Sbjct: 524  PLSDLRGAMDGNFAPQ-PLQS--------------------------------------- 543

Query: 747  TQPSQLGPQQEVQYVDIAVRPEIDLDXXXXXXXXXXXXXXXDSLSLVEETSFFDKAKKFI 806
                     Q+VQ+++   RPEIDLD               + L+L+EETSFFD+AKK++
Sbjct: 544  ---------QDVQFIEPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRAKKYM 594

Query: 807  GNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQDRPKNIENV 866
            GNKQ+YTEFLKILNL+SQDL+  + LV+KVEHYLGGS ELF WFK+FV Y ++PK+IENV
Sbjct: 595  GNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEKPKHIENV 654

Query: 867  IHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWASEDSGFI 926
            IHEKHRLDLD+CEA  PSYKKLPK+DTFMPCSGRDEMCWEVLNDEW+GHPVWASEDSGFI
Sbjct: 655  IHEKHRLDLDLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI 714

Query: 927  AHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANFKLPPGLG 986
            AHRKNQYEETLFK+EEERHEYD+YIE+NLRTIQ LETIA+KI+NMT EEK  FKLPPGLG
Sbjct: 715  AHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKLPPGLG 774

Query: 987  HTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQREWNKVW 1046
            HTS+TIYKKVIRKVYDK+RGFEIIDALHE+PAV+VP++LKRLKQKDEEWRRAQREWNKVW
Sbjct: 775  HTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQREWNKVW 834

Query: 1047 RELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPKPKSQLD 1106
            RELEQKV++KSLDHLGLTFKQADKKLLT KQLISEISSIKVDQTNKRI+  TPKPKSQLD
Sbjct: 835  RELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKSQLD 894

Query: 1107 YDFPDREIFCDILSLTEVFLNHTGNYSNSDKERXXXXXXXXXXXXXXIPVSEVNDGLRRR 1166
            YD  D+ +  DIL L   F++H+  YSN DKE+              I   E+ +     
Sbjct: 895  YDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIENSTPAD 954

Query: 1167 SPSXXXXXXXXXXXXGTALAHGKRPREIELPLRDILHRNKYQKLKLRXXXXXXXXXXXXX 1226
            S +                   KR  E E PL+++L R+K++  K R             
Sbjct: 955  SDAVSNSNPR------------KRLWESEQPLKELL-RSKHKHHKKRDTSAEDDSISDDQ 1001

Query: 1227 XX-XXXXXXXXXXXXXXXXAKKPWLLGNIVEEANAQGIISNRKSFNLFANTSIYVFFRHL 1285
                               AKKPWLLGNI++EAN  G +SNRK FNLFANT++YVFFRHL
Sbjct: 1002 NSPEKSPQEIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKIFNLFANTNVYVFFRHL 1061

Query: 1286 TTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGLDAYEQLLHLS 1345
            TT+Y+RL EVK++++EVT+EINSR V QFAKDLNL+S QL +MGLDF G DAY+QLL L 
Sbjct: 1062 TTMYQRLSEVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMGLDFKGKDAYDQLLTLC 1121

Query: 1346 KRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIKCSEIMVLFEK 1405
            KRLI  D++HQWFEESLRQAY N+AFK YTVDKV+Q+LVKHAH+I+TD K +EIM+LFEK
Sbjct: 1122 KRLIRNDMDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKSAEIMILFEK 1181

Query: 1406 DRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYIAIDDLTLAEAKSLE 1465
            DR    TS K+QILYR+Q RS+M  TENMFR+E N+ S HVCIQY+AIDDLTL E +SL+
Sbjct: 1182 DRRCTATSTKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQYVAIDDLTLKEPESLK 1241

Query: 1466 DKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIESEQEYDEDNGGDPKFSPEGVSKSSLR 1525
            D+W YY+TSY+LSHPTEGI HE+++VPFLEK ++ ++E DE   G  + SP G S S+LR
Sbjct: 1242 DRWHYYLTSYALSHPTEGIPHEEIKVPFLEKTLQDDEEADE---GSEERSPSGHSLSNLR 1298

Query: 1526 IKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLDSEKGWKK 1585
            I+++PE+Y L++EPGS D+F+R AVN+F     + S+    ++K + +   LD  +GWKK
Sbjct: 1299 IQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEKRKTLMSQLDGSRGWKK 1358

Query: 1586 NLDAKSIQSVEEKLNFVKNYG 1606
             +  + +      LN+V+ +G
Sbjct: 1359 GMSQELVDKTLTALNYVRLHG 1379

 Score =  169 bits (429), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 92/109 (84%), Gaps = 2/109 (1%)

Query: 272 LHDQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLF 331
           + D  YRPLN KDALSYLEQVKFQFN+RPDVYNHFLDIMKD+KSQAIDT GVIER+STLF
Sbjct: 137 VQDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLF 196

Query: 332 RGYPNLIQGFNTFLPQGYRIDCSQNPDEP--IKVTTPMGSSTVAGVAEM 378
           +GYP LIQG NTFLPQGY+I+C+ NP++P  IKVTTP  ++    +A M
Sbjct: 197 KGYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATM 245

 Score =  107 bits (267), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 55/60 (91%)

Query: 515 KKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 574
           + + DVEFS AISYVNKIK RF+DQP+IYKHFLEILQTYQREQKPI+EVYAQVT LFQNA
Sbjct: 329 RPSGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQNA 388

 Score = 52.8 bits (125), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 41/62 (66%)

Query: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344
           A+SY+ ++K +F  +P++Y HFL+I++ ++ +      V  +V++LF+  P+L+  F  F
Sbjct: 339 AISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQNAPDLLDDFKKF 398

Query: 345 LP 346
           LP
Sbjct: 399 LP 400

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 36/53 (67%)

Query: 520 VEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 572
           + F  A+SY+ ++K +F+++PD+Y HFL+I++ Y+ +      V  +++ LF+
Sbjct: 145 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 197

>KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6.29
            YOL004W
          Length = 1492

 Score = 1097 bits (2836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/868 (61%), Positives = 647/868 (74%), Gaps = 17/868 (1%)

Query: 762  DIAVRPEIDLDXXXXXXXXXXXXXXXDSLSLVEETSFFDKAKKFIGNKQLYTEFLKILNL 821
            D+ VRPEIDLD               ++LSL EETSFF+K KK IGN+Q+Y EFLK+LNL
Sbjct: 605  DMQVRPEIDLDPSIVPVVPEPTEPIENNLSLSEETSFFEKVKKNIGNRQIYIEFLKVLNL 664

Query: 822  YSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQDRPKNIENVIHEKHRLDLDMCEAS 881
            +SQDL+ +D LV KVE+YL G  ELF WFKNFVGYQD+PK IENVIHEKHRLDLD+CEA 
Sbjct: 665  FSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHEKHRLDLDLCEAY 724

Query: 882  GPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWASEDSGFIAHRKNQYEETLFKVE 941
            GPSYKKLPKSDTFMPCSGRD+MCWEVLNDEW+GHPVWASEDSGFIAHRKNQYEETLFK+E
Sbjct: 725  GPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 784

Query: 942  EERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANFKLPPGLGHTSLTIYKKVIRKVY 1001
            EERHEYDFYIESNLRTIQTLETIASKIANMTEEEK  FKLPPGLGHTSLTIYKK+IRKVY
Sbjct: 785  EERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTSLTIYKKIIRKVY 844

Query: 1002 DKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHL 1061
            DKERGFEIID LHEHPA+ VP+VLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHL
Sbjct: 845  DKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHL 904

Query: 1062 GLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPKPKSQLDYDFPDREIFCDILSL 1121
            GLTFKQADKKLLTTKQLISEISSIKVDQ NKR+HWLTPKPK QLDY F D +I  DI+ L
Sbjct: 905  GLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIVGL 964

Query: 1122 TEVFLNHTGNYSNSDKERXXXXXXXXXXXXXXIPVSEVNDGLRRRSPSXXXXXXXXXXXX 1181
            T+VF++H   YSN DKER              IP   ++  L  +S              
Sbjct: 965  TDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALDTKSDEGKSTDTKFEKAD 1024

Query: 1182 GTALAHGKRPR-EIELPLRDILHRNKYQKLKLRXXXXXXXXXXXXXXXXXXXXXXXXXXX 1240
             +     KRPR ++EL L DILHR KYQKLK                             
Sbjct: 1025 DSK----KRPRPDVELSLSDILHRAKYQKLK------NGEGLGMSEDDDEEKLAKEAEEM 1074

Query: 1241 XXXXAKKPWLLGNIVEEANAQGIISNRKSFNLFANTSIYVFFRHLTTLYERLIEVKSIDQ 1300
                A KPWL+G+IVE AN+ G++++R  +NLF NT++Y+F RH +TLY RL+E+K +D+
Sbjct: 1075 SEKNASKPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLELKQMDE 1134

Query: 1301 EVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGLDAYEQLLHLSKRLIEGDIEHQWFEE 1360
             VT+EIN+RKV QFA+DLNL+S QL++MGLDF G +AY++ L LSKRLI  ++EHQWFEE
Sbjct: 1135 RVTKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEHQWFEE 1194

Query: 1361 SLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIKCSEIMVLFEKDRTLATTSAKDQILY 1420
            SLRQAYNN+AFK YTVDKVV +LVKHAHT++TD K SE+M LFEKDR  ++T  KDQILY
Sbjct: 1195 SLRQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVKDQILY 1254

Query: 1421 RMQARSHMSNTENMFRIEFNRISKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTSYSLSHP 1480
            R+  RSHMS+TENMFR+++N+ ++HV IQYI +DD+TL +AK   ++W YY+TSY+L HP
Sbjct: 1255 RLLTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSYALPHP 1314

Query: 1481 TEGISHEDLQVPFLEKIIESEQEYDEDNGGDPKFSPEGVSKSSLRIKIDPETYFLEVEPG 1540
            TEGI  + L VPFLE+I+E E +  +   G  +++P G S S L+I IDP+TY L ++ G
Sbjct: 1315 TEGIMQDKLVVPFLERILEFENDMLDVEAGSDRYNPVGTSYSKLKINIDPKTYKLIIQDG 1374

Query: 1541 SCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLDSEKGWKKNLDAKSIQSVE--EK 1598
            S D+FSR ++N++P+  +S+ +   V+K+ E  + +LD   GWKK+L    I +VE  +K
Sbjct: 1375 SYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGWKKDLSDDVINTVEPTKK 1434

Query: 1599 LNFV----KNYGTLQGYRAQENGLESTT 1622
            +  +    K+ GTL      E G E+T 
Sbjct: 1435 IALLSEETKDVGTLSTPVTTEKGAENTV 1462

 Score =  180 bits (457), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 87/120 (72%), Positives = 96/120 (80%), Gaps = 5/120 (4%)

Query: 274 DQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRG 333
           D  YRPLNVKDALSYLEQVK QFNSRP +YN FLDIMKDFKSQ IDTPGVIERVSTLF+G
Sbjct: 215 DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274

Query: 334 YPNLIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVAEMNQAALFQGQQPRIQQ 393
           +P LIQGFNTFLPQGYRI+CS NP+EPIKVTTPMG      +  +  + +   QQP I Q
Sbjct: 275 FPALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMGV-----LENVRGSDITADQQPAIGQ 329

 Score =  136 bits (343), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 100/192 (52%), Gaps = 20/192 (10%)

Query: 512 DQTKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLF 571
           ++ KKA DVEFSQAISYVNKIKNRFSDQPDIYK+FLEILQTYQREQKPINEVYAQVTVLF
Sbjct: 371 NEPKKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLF 430

Query: 572 QNAXXXXXXXXXXXXXSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXE--------NQP 623
            NA             SS                                       NQP
Sbjct: 431 HNAPDLLDDFKKFLPDSSASNEQQPKQSPYSPQVYSGADMARGYMYNNTGVYYPPQVNQP 490

Query: 624 VARQNLPPLGSFSPPPNGTAPRDYYQEPSQGMALPPM--THLETQAAKVTPSHYVMTQGM 681
             + NLPP+GSFSPP NG A       P+ G A+P     H+      + P        M
Sbjct: 491 --QSNLPPIGSFSPPANGVA-------PTTGTAIPHADEQHVVAGVPAMAPHEQQHAPSM 541

Query: 682 -SNDAIPLSNMR 692
            +ND I +SNMR
Sbjct: 542 INNDGIQISNMR 553

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 55/114 (48%)

Query: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344
           A+SY+ ++K +F+ +PD+Y +FL+I++ ++ +      V  +V+ LF   P+L+  F  F
Sbjct: 384 AISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNAPDLLDDFKKF 443

Query: 345 LPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVAEMNQAALFQGQQPRIQQHLQPL 398
           LP     +  Q    P       G+    G    N    +  Q  + Q +L P+
Sbjct: 444 LPDSSASNEQQPKQSPYSPQVYSGADMARGYMYNNTGVYYPPQVNQPQSNLPPI 497

 Score = 35.4 bits (80), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 31/48 (64%)

Query: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 572
           A+SY+ ++K +F+ +P IY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 226 ALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFK 273

>Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] {ON}
            YOL004W (SIN3) - DNA binding protein involved in
            transcriptional regulation [contig 185] FULL
          Length = 1541

 Score = 1092 bits (2825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/990 (56%), Positives = 683/990 (68%), Gaps = 70/990 (7%)

Query: 620  ENQPVARQNLPPLGSFSPPPNGTAPRDYYQEPSQGMALPPMTHLETQAAKVTPSHYVMTQ 679
            ++Q    QNLPPLG+FSPP NG   RD   + +     PP      Q    +  H V+ Q
Sbjct: 571  QHQQARAQNLPPLGNFSPPING---RDNEAQVNLPAVQPPALDFPPQQQSQSHRH-VVAQ 626

Query: 680  GMSNDAIPLSNMRSPTVGAPGAQTPVETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 739
            GM+N+++P+S+MR P  G    Q                                     
Sbjct: 627  GMTNNSLPVSDMRGPVDGGFAPQ------------------------------------- 649

Query: 740  XXXTIPLTQPSQLGPQQEVQYVDIAVRPEIDLDXXXXXXXXXXXXXXXDSLSLVEETSFF 799
                 PL         Q+VQY++   RPEIDLD               +  +L+EETSFF
Sbjct: 650  -----PLYS-------QDVQYMEPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFF 697

Query: 800  DKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQDR 859
            DKAKK++GNKQ+YTEFLKILNL+SQDL+D D LV+KVEHYLGG+ ELF WFK+FV Y +R
Sbjct: 698  DKAKKYMGNKQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVER 757

Query: 860  PKNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWA 919
            PK+IENV+HEKHRLDLD+CEA  PSYKKLPK+DTFMPC GRDEMCWEVLNDEW+GHPVWA
Sbjct: 758  PKHIENVVHEKHRLDLDLCEACCPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWA 817

Query: 920  SEDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANF 979
            SEDSGFIAHRKNQYEETLFK+EEERHEYD+YIE+NLRTIQ LETIA+KI+NMT EEK  F
Sbjct: 818  SEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTF 877

Query: 980  KLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQ 1039
            KLPPGLGHTS TIYKKVIRKVYDK+RGFEIIDALHE+PAV+VP+VL+RLKQKDEEWRRAQ
Sbjct: 878  KLPPGLGHTSTTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQ 937

Query: 1040 REWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTP 1099
            REWNKVWRELEQKV++KSLDHLGLTFKQADKKLLT KQLISEISSIK+DQ NKRI+  T 
Sbjct: 938  REWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTS 997

Query: 1100 KPKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERXXXXXXXXXXXXXXIPVSEV 1159
            KPKSQLD+D  D+ +  DIL+L + F++H+  YSN DKE+              IP++++
Sbjct: 998  KPKSQLDFDISDKGVLFDILNLVDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTDL 1057

Query: 1160 NDGLRRRSPSXXXXXXXXXXXXGTALAHGKRPREIELPLRDILHRNKYQKLKLRXXXXXX 1219
            ++      PS                   KR R+ +   RD+L     Q  K        
Sbjct: 1058 DN------PSEEHKVENGDSTR-------KRSRDDDQFFRDLLKSKHKQAKKKTSQQEDE 1104

Query: 1220 XXXXXXXXXXXXXXXXXXXXXXXXXAKKPWLLGNIVEEANAQGIISNRKSFNLFANTSIY 1279
                                     AKKPWLLGNI++EAN  G +SNRK++N+FANT+IY
Sbjct: 1105 STSDDQDTAAKTSPDLEYEEAVRLDAKKPWLLGNILDEANNHGFVSNRKTYNMFANTNIY 1164

Query: 1280 VFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGLDAYE 1339
            VFFRHLTT+Y+RL E K+I++EVT+EINSRKV QFAKDLNL S QL +MGLDF G DAYE
Sbjct: 1165 VFFRHLTTMYQRLSEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSDMGLDFKGADAYE 1224

Query: 1340 QLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIKCSEI 1399
            QLL L KRLI+ DIEHQWFEESLRQAY N+AFK YTVDKV+Q+LVKHAH+I+TD K +EI
Sbjct: 1225 QLLALCKRLIQSDIEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKTAEI 1284

Query: 1400 MVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYIAIDDLTLA 1459
            M+LFEKDR   TTS ++QILYR+Q RS M  TENMFRIE N  S HV IQ++A+DDLTL 
Sbjct: 1285 MILFEKDRKAPTTSTREQILYRLQVRSCMGLTENMFRIELNSTSAHVSIQFVAVDDLTLN 1344

Query: 1460 EAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIESEQEYDEDNGGDPKFSPEGV 1519
            +  SL+D+W+YY+TSYSLSHPTEG+ HE+++ PFLEK +  + + DED+     +SP G 
Sbjct: 1345 QPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKAPFLEKTLRDDGDSDEDSEW---YSPGGQ 1401

Query: 1520 SKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLDS 1579
            S S LRI+I+PE+Y L++EP S D+F+R  VNK P  K  E+         + +   ++S
Sbjct: 1402 SVSQLRIQINPESYALQIEPNSKDLFTRSTVNKHPT-KIGEASGRDAKTMQKSLADMVNS 1460

Query: 1580 EKGWKKNLDAKSIQSVEEKLNFVKNYGTLQ 1609
            E GWKK L  +SI   E  +NFVK  G L+
Sbjct: 1461 EHGWKKGLQNESIGKAESIINFVKARGFLE 1490

 Score =  168 bits (425), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 88/101 (87%), Gaps = 2/101 (1%)

Query: 272 LHDQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLF 331
           + D  YRPLN KDALSYLEQVKFQFN+RPDVYNHFLDIMKD+KSQAIDT GVIER+STLF
Sbjct: 244 VQDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLF 303

Query: 332 RGYPNLIQGFNTFLPQGYRIDCSQNPDEP--IKVTTPMGSS 370
           +GYP LIQG NTFLPQGY+I+C+ NP +P  IKVTTP  ++
Sbjct: 304 KGYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTT 344

 Score =  107 bits (267), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/57 (87%), Positives = 52/57 (91%)

Query: 518 ADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 574
            DVEFS AISYVNKIK RF+DQPDIYKHFLEILQTYQREQKPI+EVY QVT LFQNA
Sbjct: 438 GDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQNA 494

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V++LF+  P+L+  F  F
Sbjct: 445 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQNAPDLLDDFKKF 504

Query: 345 LP 346
           LP
Sbjct: 505 LP 506

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 36/53 (67%)

Query: 520 VEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 572
           + F  A+SY+ ++K +F+++PD+Y HFL+I++ Y+ +      V  +++ LF+
Sbjct: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 304

>CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004w SIN3
            transcription regulatory protein
          Length = 1493

 Score = 1089 bits (2816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/882 (60%), Positives = 642/882 (72%), Gaps = 21/882 (2%)

Query: 762  DIAVRPEIDLDXXXXXXXXXXXXXXXDSLSLVEETSFFDKAKKFIGNKQLYTEFLKILNL 821
            ++ VRPEIDLD               +SL+L+EET+FF++ KK IGNKQ+Y EFLKILNL
Sbjct: 590  ELVVRPEIDLDPSLVPVVPEPTEPIENSLNLMEETNFFERVKKSIGNKQIYNEFLKILNL 649

Query: 822  YSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQDRPKNIENVIHEKHRLDLDMCEAS 881
            +S DLL +D LV+KVE+Y+G +KELF WFK FVGYQD+PK IEN++HEKH+LDLD+CEA 
Sbjct: 650  FSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEAY 709

Query: 882  GPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWASEDSGFIAHRKNQYEETLFKVE 941
            GPSYKKLPK+DTFMPCSGRD+MCWEVLNDEW+GHPVWASEDSGFIAHRKNQYEETLFK+E
Sbjct: 710  GPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 769

Query: 942  EERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANFKLPPGLGHTSLTIYKKVIRKVY 1001
            EERHEYD+YIESNLRTIQTLETIA+KIANMT+ EKA F+LPPGLGHTS+TIYKKVIRKVY
Sbjct: 770  EERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVY 829

Query: 1002 DKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHL 1061
            DKERGFEIIDALH +PA++VP++L+RLKQKDEEWRRAQREWNK+WR+LEQKVYFKSLDHL
Sbjct: 830  DKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHL 889

Query: 1062 GLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPKPKSQLDYDFPDREIFCDILSL 1121
            GLTFKQADKKLLTTKQLISEI+ IKVDQ +KRIHWLTPKPK+QLDYDFPD +I  DI++L
Sbjct: 890  GLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIAL 949

Query: 1122 TEVFLNHTGNYSNSDKERXXXXXXXXXXXXXXIPVSEVNDGLRRR-------------SP 1168
              VF  +T  YSN DKER              IP+ EV+D L RR             S 
Sbjct: 950  GFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFSDDNNNDSDKGSG 1009

Query: 1169 SXXXXXXXXXXXXGTALAHGKRPREIELPLRDILHRNKYQKLKLRXXXXXXXXXXXXXXX 1228
                             +  KRP + +L + DILH+ K QK K+                
Sbjct: 1010 KMDQIAEEIGETEQDTSSSKKRPFDNDLNMSDILHKTKQQKTKMNKEMDGSKSPSEDLGT 1069

Query: 1229 XXXXXXXXXXXXXXXXAKKPWLLGNIVEEANAQGIISNRKSFNLFANTSIYVFFRHLTTL 1288
                             +K WL+G++V+ AN +  + NR  +NLFANT+IY+FFRHL TL
Sbjct: 1070 DRNVGTIEDSGSLSEH-RKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLVTL 1128

Query: 1289 YERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGLDAYEQLLHLSKRL 1348
            YERL EVK I+ E+ +EI SR+V+ FAKDL LIS QL  +GLDF   DAY+QLL LSKRL
Sbjct: 1129 YERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSKRL 1188

Query: 1349 IEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIKCSEIMVLFEKDRT 1408
            IEGDIEHQWFEES+RQAYNNRAFK YT+DKVVQ+ VKHAHT+++D K SEIM+LFE  R 
Sbjct: 1189 IEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQRN 1248

Query: 1409 LATTSAKDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYIAIDDLTLAEAKSLEDKW 1468
               T+ KDQILYR+Q RSHMS+TENMFRIE+ R  +H  IQYIA+DDLTL  AKS E+ W
Sbjct: 1249 NTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEEAW 1308

Query: 1469 KYYVTSYSLSHPTEGISHEDLQVPFLEKIIESEQEYDEDNGGDPKFSPEGVSKSSLRIKI 1528
             YYVTSYSLS+PTEG+ HE+L+VPFLEK+IE +QEY +DNG +  +S  G+SKS+L I I
Sbjct: 1309 NYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNNSTYSLAGISKSNLHIDI 1368

Query: 1529 DPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLDSEKGWKKNLD 1588
            D E Y L ++ GS DV+SR  + K+P+  + ES    + +K + IR  L        + D
Sbjct: 1369 DREKYNLILQGGSSDVYSRATIQKYPIVASDESRAANISEKTQEIRKVL-------SHYD 1421

Query: 1589 AKSIQSVEEKLNFVKNYGTLQGYRAQENGLESTTKEAPFSDA 1630
              S   V EK N++   GT+ GY  Q   +   T++    D+
Sbjct: 1422 GNSNDDVNEKFNYILANGTIDGYVRQSAAVVQETEKTYNDDS 1463

 Score =  189 bits (480), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 84/97 (86%), Positives = 92/97 (94%)

Query: 277 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPN 336
           YRPLNVKDALSYLEQVKFQF++RPD+YN FLDIMKDFKSQ IDTPGVIERVS+LF+GYPN
Sbjct: 185 YRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYPN 244

Query: 337 LIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVA 373
           LIQGFNTFLPQGYRI+CS NP++PIKVTTPMGSST  
Sbjct: 245 LIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTV 281

 Score =  114 bits (284), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/76 (73%), Positives = 61/76 (80%), Gaps = 3/76 (3%)

Query: 502 VPAPVQPQLADQ---TKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQK 558
            P P Q  +       KK ADVEFSQAI+YVNKIK RF+DQPDIYK FLEILQTYQREQK
Sbjct: 316 TPIPTQHDVGQNFGSAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQK 375

Query: 559 PINEVYAQVTVLFQNA 574
           PI+EVYAQVT+LFQNA
Sbjct: 376 PIHEVYAQVTILFQNA 391

 Score = 49.7 bits (117), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 39/62 (62%)

Query: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344
           A++Y+ ++K +F  +PD+Y  FL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 342 AITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNAPDLLDDFKKF 401

Query: 345 LP 346
           LP
Sbjct: 402 LP 403

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 48/90 (53%), Gaps = 22/90 (24%)

Query: 629 LPPLGSFSPPPNGTAPRDYYQ----EPSQG-MALPPMTH----LETQAAK------VTPS 673
           LPP+GSFSPP NG       Q    E  +G M+LP M +    ++ QA K      ++ S
Sbjct: 470 LPPIGSFSPPTNGPFVDQTQQSANPETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDS 529

Query: 674 H------YVMTQGM-SNDAIPLSNMRSPTV 696
           H       V++Q + SND IP+SN+R+  V
Sbjct: 530 HDHNSQQQVLSQNIHSNDDIPVSNLRTTVV 559

 Score = 40.0 bits (92), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 47/85 (55%), Gaps = 3/85 (3%)

Query: 489 SAVSSGTGPTQ-PEVPAPVQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFL 547
           S  +S T  TQ P V  P Q Q    + +  +V+   A+SY+ ++K +F  +PDIY  FL
Sbjct: 158 STGASETSTTQSPLVSGPAQTQGDPMSYRPLNVK--DALSYLEQVKFQFHTRPDIYNLFL 215

Query: 548 EILQTYQREQKPINEVYAQVTVLFQ 572
           +I++ ++ +      V  +V+ LF+
Sbjct: 216 DIMKDFKSQTIDTPGVIERVSSLFK 240

>NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1657

 Score = 1065 bits (2755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/850 (61%), Positives = 631/850 (74%), Gaps = 19/850 (2%)

Query: 765  VRPEIDLDXXXXXXXXXXXXXXXDSLSLVEETSFFDKAKKFIGNKQLYTEFLKILNLYSQ 824
             RPEIDLD               ++++LVEETSFF+K KKFI +K +Y EFLK+LNLYSQ
Sbjct: 716  TRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFFEKVKKFISSKPIYMEFLKVLNLYSQ 775

Query: 825  DLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQDRPKNIENVIHEKHRLDLDMCEASGPS 884
            DLL  + LV +V++Y+G +KELF WFK FVGY + P  IEN+IHEKH+LDLD+CEA GPS
Sbjct: 776  DLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAYGPS 835

Query: 885  YKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWASEDSGFIAHRKNQYEETLFKVEEER 944
            YKKLPK+DTFMPCSGRD MCWEVLNDEW+GHPVWASEDSGFIAHRKNQYEETLFK+EEER
Sbjct: 836  YKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER 895

Query: 945  HEYDFYIESNLRTIQTLETIASKIANMTEEEKANFKLPPGLGHTSLTIYKKVIRKVYDKE 1004
            HEYDF+IESNLRTIQTLETIA+KI NMT EEK NFKLP GLGHTS TIYKKVIRKVYDKE
Sbjct: 896  HEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVYDKE 955

Query: 1005 RGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLT 1064
            RGFEIIDALHEHPA AVP++L+RLK+KDEEWRRAQREWNKVWRELEQKVY+KSLDHLGLT
Sbjct: 956  RGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLT 1015

Query: 1065 FKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPKPKSQLDYDFPDREIFCDILSLTEV 1124
            FKQADKKLLTTKQLISEISSI+VDQ NKRIHWLTPKPKSQLD+ F D +I  DIL L  V
Sbjct: 1016 FKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILDLANV 1075

Query: 1125 FLNHTGNYSNSDKERXXXXXXXXXXXXXXIPVSEVNDGLRRRSPSXXXXXXXXXXXXGTA 1184
            F++HT  YSNS+KER              IP SE++  L  ++                +
Sbjct: 1076 FIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSGKNDEKFEKGSSSSSSTSNS 1135

Query: 1185 LAHG-KRPREIELPLRDILHRNKYQKLKLRXXXXXXXXXXXXXXXXXXXXXXXXXX---- 1239
                 KR  E+++PL D+L + KYQK+K +                              
Sbjct: 1136 TPSAKKRSLELDIPLADVLRKYKYQKIKEKVINELENNSNEYDERDEEFDEELKRQQQEQ 1195

Query: 1240 -----XXXXXAKKPWLLGNIVEEANAQGIISNRKSFNLFANTSIYVFFRHLTTLYERLIE 1294
                       KKPWLLG+++++ +  G+I NR  FNLFANT+IYVFFRH TT+YERL+E
Sbjct: 1196 EEEDHMIDEEMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFFRHWTTIYERLLE 1255

Query: 1295 VKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGLDAYEQLLHLSKRLIEGDIE 1354
            +K I+ +VT+EINSRKV+ FAKDL LIS QL  MGLDF   D+Y++LL+L+KRLI+ DIE
Sbjct: 1256 LKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLIKNDIE 1315

Query: 1355 HQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIKCSEIMVLFEKDRTLATTSA 1414
            HQWFEESLRQAYNN+AFK YT DKV+QALVKHA++ILTD K SEIM LFEKDR  ++T+ 
Sbjct: 1316 HQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMALFEKDRLRSSTTT 1375

Query: 1415 KDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTS 1474
            +DQI+YR+Q R+HM+NTENMFRIEFN  + HVCIQYIA++DLTL  + + ++ W+YYVTS
Sbjct: 1376 RDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWEYYVTS 1435

Query: 1475 YSLSHPTEGISHEDLQVPFLEKI----IESEQEYD---EDNGGDPKFSPEGVSKSSLRIK 1527
            Y+L HPTEG+  E L+VPFLEK     +E+ Q+ D   E N    K SPEG+S S L+IK
Sbjct: 1436 YALPHPTEGVPQEGLKVPFLEKNLNLELENAQDLDNETEKNEFIEKISPEGISTSKLKIK 1495

Query: 1528 IDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLDSEKGWKKNL 1587
            ID ETY L+VEPGS DVFSRK++NKFP +  ++  ++ + +K+E    +L S++GW    
Sbjct: 1496 IDQETYNLDVEPGSFDVFSRKSLNKFPTD--AKKIESSIKEKSEAFNKFLSSKRGWNNQF 1553

Query: 1588 DAKSIQSVEE 1597
                +  +EE
Sbjct: 1554 KPDQVAGIEE 1563

 Score =  178 bits (452), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (85%)

Query: 274 DQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRG 333
           D  YRPLNVKDALSYLEQVK QFNS+P +YN FLDIMKDFKSQ IDTPGVIERVSTLF+G
Sbjct: 267 DPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKG 326

Query: 334 YPNLIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVAEMN 379
           YP LIQGFNTFLPQGY I CS NPD+P++VTTPMG+ST   +  ++
Sbjct: 327 YPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTSTYTNLPNVD 372

 Score = 97.1 bits (240), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 52/56 (92%)

Query: 519 DVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 574
           +VEFSQAI+YVNKIK R++DQP IYKHFLEILQTYQRE+KPI+EVY QVTVLF +A
Sbjct: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDA 519

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 41/63 (65%)

Query: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344
           A++Y+ ++K ++  +P +Y HFL+I++ ++ +      V E+V+ LF   P+L++ F  F
Sbjct: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529

Query: 345 LPQ 347
           LP+
Sbjct: 530 LPE 532

 Score = 36.6 bits (83), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 31/48 (64%)

Query: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 572
           A+SY+ ++K +F+ QP IY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFK 325

>CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa]
            {ON} weakly similar to uniprot|P22579 Saccharomyces
            cerevisiae YOL004w SIN3 transcription regulatory protein
          Length = 937

 Score =  249 bits (637), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 145/354 (40%), Positives = 203/354 (57%), Gaps = 29/354 (8%)

Query: 798  FFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVG-Y 856
            F    +  + ++ +Y EFLK++NL++Q L+D++   ++   + G    L T F N +  Y
Sbjct: 206  FLIYFRNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEY 265

Query: 857  QDRPKNIENVIHEKHRLDL-DMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGH 915
            +D  + ++  +      D+ D    SGPSYK+L   +T   C GRD +C EVLNDEW+GH
Sbjct: 266  KDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVLNDEWVGH 325

Query: 916  PVWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEE 975
            PVWASE+ GFIAH+KNQYEETLFKVEEERHEYDF++ S          +   I   TE E
Sbjct: 326  PVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLS----------VEHLIVKFTEYE 375

Query: 976  KA-----------NFKLPPGLGHTSL-TIYKKVIRKVYDKERGFEIIDALHEHPAVAVPV 1023
            K+           N    P     SL +I +KVIR++Y  E G  +IDA+  +P   VP 
Sbjct: 376  KSLQLSKDDGRRRNRVSSPKEPMISLNSITEKVIRRLYGIEHGNILIDAIKTNPEKVVPT 435

Query: 1024 VLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEIS 1083
            +LK  K+K ++W  A+ EWNK WRE+EQK Y+KSLDHLGL FK A+K+ L  KQL+ E  
Sbjct: 436  ILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLLEYK 495

Query: 1084 SIKVDQTNKRIHWLTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDK 1137
            S K D+  K  H+   + K    Y+F D+ +  D+  +    L    + S S K
Sbjct: 496  SEKQDKLLKE-HYDNYEYK----YEFFDKSVLYDVKDIILCGLRSNSSTSESQK 544

 Score =  134 bits (338), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 87/294 (29%), Positives = 147/294 (50%), Gaps = 12/294 (4%)

Query: 1264 ISNRKSFNLFANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISE 1323
             SNR++ N+F + +I   F ++ TLYER  +VK  +  + +++ ++K        +L   
Sbjct: 617  FSNRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKLL 676

Query: 1324 --QLKNMGLDFAGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQ 1381
              QL + GL+    D YE +   SK+ + G+++HQWFEESLR  + N+A+K YT+D+V++
Sbjct: 677  PMQLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIR 736

Query: 1382 ALVKHAHTILTDIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNR 1441
             ++    TI       +I+ L   +    TT+   Q+ YR + R  M    +MFR+E  R
Sbjct: 737  NILGVITTISQTPSLLQILDLLVDNMKKLTTTKLQQLTYRTKVRMLMDGVGDMFRLEIVR 796

Query: 1442 ISKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPF--LEKIIE 1499
             S  +  QYI +DDL  A+    + +   Y   Y  +  T+ +  + L  P+  L  +  
Sbjct: 797  DSNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLLKR 856

Query: 1500 SEQEYDEDNGGDPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKF 1553
             EQ     NG         + K  L + I+P  Y +++ PGS D+ S   + K 
Sbjct: 857  EEQNIPFMNG--------NIYKPHLSVNINPLDYVVDIAPGSIDICSSTHITKL 902

>Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON}
           (95468..96937) [1470 nt, 490 aa]
          Length = 489

 Score = 34.7 bits (78), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

Query: 805 FIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQ---DRPK 861
           + G K +Y ++LK+LN   QD   +   VE  +     S ++  +  N + YQ   +R K
Sbjct: 80  YTGLKNMYQDYLKVLNQLKQDKAAVRDEVEASDDKPEESSDVLEYIVNELPYQQPTERKK 139

Query: 862 NIENVIHEK 870
            I+N IH K
Sbjct: 140 YIDNFIHSK 148

>KAFR0H02140 Chr8 (403762..405933) [2172 bp, 723 aa] {ON} Anc_8.352
            YLR144C
          Length = 723

 Score = 34.7 bits (78), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 57/140 (40%), Gaps = 13/140 (9%)

Query: 1481 TEGISHEDLQVPFLEKIIESEQEYDEDNGGDP-KFSPEGVSKSSLRIKIDPETYFLEVEP 1539
            T  ++  ++Q+  +   I S   Y + N  +P +F P  VS      KID  TYF     
Sbjct: 572  TNLVNMANIQLGIINSSINSYFLYLDTNTIEPPQFVPNKVSGILFENKIDHTTYF---GT 628

Query: 1540 GSCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLDS--EKGWKK-------NLDAK 1590
             +  +    A+   P+     S K    + N+++   +D     GWK        + DAK
Sbjct: 629  NTEYIHMIHALPLIPITNYIRSAKFAKQEWNQVLSKIIDKIPNNGWKSVIMLEIASFDAK 688

Query: 1591 SIQSVEEKLNFVKNYGTLQG 1610
            S  +   + NF  NYG   G
Sbjct: 689  SSWNYFAQSNFFSNYGLDDG 708

>SAKL0E08162g Chr5 (656921..659056) [2136 bp, 711 aa] {ON} similar to
            uniprot|P40485 Saccharomyces cerevisiae YIL105C SLM1
            Phosphoinositide PI4 5P(2) binding protein forms a
            complex with Slm2p acts downstream of Mss4p in a pathway
            regulating actin cytoskeleton organization in response to
            stress phosphorylated by the Tor2p-containing complex
            TORC2
          Length = 711

 Score = 33.1 bits (74), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 57/118 (48%), Gaps = 7/118 (5%)

Query: 1288 LYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGLDAYEQLLHLSKR 1347
            L  ++ E+K +  +     N +++ Q  +DL    + ++      A  D Y     L+K 
Sbjct: 298  LLVKIKEIKGLQSDFKNSCN-KELQQTKQDLKGFQDSIEEARYGTARQDPY-----LAKI 351

Query: 1348 LIEGDIEHQWFEES-LRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIKCSEIMVLFE 1404
            +++  I+ Q  EE+ L +A+NN       ++KVV   +++A TI   I   E  ++F+
Sbjct: 352  ILDKQIKRQLTEENFLHEAFNNLQSSGRELEKVVVMEIQNALTIYARILGQEAQLVFD 409

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 145,591,887
Number of extensions: 5916825
Number of successful extensions: 15414
Number of sequences better than 10.0: 48
Number of HSP's gapped: 15788
Number of HSP's successfully gapped: 164
Length of query: 1670
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1547
Effective length of database: 39,377,481
Effective search space: 60916963107
Effective search space used: 60916963107
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 73 (32.7 bits)