Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07502g6.30ON1221226428e-88
TDEL0G043906.30ON1221226099e-83
KAFR0A051106.30ON1221225976e-81
Smik_15.1656.30ON1201205839e-79
YOL005C (RPB11)6.30ON1201205821e-78
NCAS0D021206.30ON1221225812e-78
KNAG0F029106.30ON1221205812e-78
Suva_15.1696.30ON1221225803e-78
Skud_15.1576.30ON1221225803e-78
Kpol_1037.216.30ON1201205794e-78
NDAI0C026706.30ON1221225786e-78
CAGL0E02453g6.30ON1201205742e-77
TBLA0E031506.30ON1181185654e-76
Kwal_56.224726.30ON1221225585e-75
SAKL0E01562g6.30ON1221225543e-74
KLTH0C10934g6.30ON1221225516e-74
ACL005C6.30ON1221225501e-73
TPHA0J004106.30ON1201205473e-73
KLLA0C06160g6.30ON1211185301e-70
TPHA0B029202.163ON1301061366e-11
CAGL0L03872g2.163ON137921315e-10
Kpol_165.22.163ON128921253e-09
KAFR0B045702.163ON131901244e-09
Ecym_54232.163ON127901211e-08
YNL113W (RPC19)2.163ON1421021211e-08
KNAG0I020602.163ON134901202e-08
Smik_14.2142.163ON1421021202e-08
Suva_14.2252.163ON1421041193e-08
TBLA0B012902.163ON102951163e-08
AFL220C2.163ON135901175e-08
Skud_14.2182.163ON1561041178e-08
ZYRO0B09878g2.163ON130901113e-07
NCAS0G025502.163ON1501041114e-07
SAKL0E10692g2.163ON131901114e-07
NDAI0F027502.163ON149901081e-06
KLTH0D09350g2.163ON146891053e-06
TDEL0F011802.163ON129901043e-06
KLLA0F23760g2.163ON127681027e-06
Kwal_26.84732.163ON150711002e-05
Ecym_47207.353ON26143633.1
KAFR0F015101.132ON28247615.2
Kwal_23.58927.257ON67859616.7
YHL030W (ECM29)4.15ON186863617.1
AGR316C5.161ON71375617.2
NCAS0C058604.15ON1868113609.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C07502g
         (122 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {O...   251   8e-88
TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON...   239   9e-83
KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {...   234   6e-81
Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {O...   229   9e-79
YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}  ...   228   1e-78
NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON...   228   2e-78
KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON...   228   2e-78
Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {O...   228   3e-78
Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {O...   228   3e-78
Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON...   227   4e-78
NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30...   227   6e-78
CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {O...   225   2e-77
TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON...   222   4e-76
Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C...   219   5e-75
SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly ...   218   3e-74
KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {O...   216   6e-74
ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON} Sy...   216   1e-73
TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30 ...   215   3e-73
KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {O...   208   1e-70
TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.16...    57   6e-11
CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {...    55   5e-10
Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON} com...    53   3e-09
KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON...    52   4e-09
Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON} ...    51   1e-08
YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA p...    51   1e-08
KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON...    51   2e-08
Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W...    51   2e-08
Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W...    50   3e-08
TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.16...    49   3e-08
AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON} Synt...    50   5e-08
Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W...    50   8e-08
ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {O...    47   3e-07
NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.16...    47   4e-07
SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {O...    47   4e-07
NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON...    46   1e-06
KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {O...    45   3e-06
TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.16...    45   3e-06
KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa] ...    44   7e-06
Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON...    43   2e-05
Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [78...    29   3.1  
KAFR0F01510 Chr6 complement(297704..298552) [849 bp, 282 aa] {ON...    28   5.2  
Kwal_23.5892 s23 (1358818..1360854) [2037 bp, 678 aa] {ON} YIL06...    28   6.7  
YHL030W Chr8 (40084..45690) [5607 bp, 1868 aa] {ON}  ECM29Scaffo...    28   7.1  
AGR316C Chr7 complement(1323148..1325289) [2142 bp, 713 aa] {ON}...    28   7.2  
NCAS0C05860 Chr3 complement(1204693..1210299) [5607 bp, 1868 aa]...    28   9.2  

>ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  251 bits (642), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 122/122 (100%), Positives = 122/122 (100%)

Query: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60
           MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120
           YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF
Sbjct: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  239 bits (609), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 112/122 (91%), Positives = 120/122 (98%)

Query: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60
           MNAPDRFELFLLGEGESKL+++PDTKAPNA+V+TFEKEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120
           YKVEHPLFARFKMRIQT+EGYDPKDALKNACNGIINKL VLKTNFETEWNLQTLASDDN+
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  234 bits (597), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 108/122 (88%), Positives = 119/122 (97%)

Query: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60
           MNAPDRFELFLLGEGESKL++DPDTK+PNA+V+TFEKEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120
           YKVEHP FARFK+R+QT+EGYDPK+ALKNACN IINKLG+LKTNFETEWNLQTLASD+NF
Sbjct: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {ON}
           YOL005C (REAL)
          Length = 120

 Score =  229 bits (583), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 114/120 (95%)

Query: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60
           MNAPDRFELFLLGEGESKL++DPDTKAPNA+V+TFEKEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120
           YKVEHP FARFK+RIQT EGYDPKDALKNACN IINKLG LKTNFETEWNLQTLA+DD F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLATDDAF 120

>YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}
           RPB11RNA polymerase II subunit B12.5; part of central
           core; similar to Rpc19p and bacterial alpha subunit
          Length = 120

 Score =  228 bits (582), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 114/120 (95%)

Query: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60
           MNAPDRFELFLLGEGESKL++DPDTKAPNA+V+TFEKEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120
           YKVEHP FARFK+RIQT EGYDPKDALKNACN IINKLG LKTNFETEWNLQTLA+DD F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

>NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  228 bits (581), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 106/122 (86%), Positives = 117/122 (95%)

Query: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60
           MNAPDRFELFLLGEGESKL++DPDTKAPNA+V+TFEKEDHTLGNLIR+ELLND +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120
           YKVEHP FARFK+RIQT+EGYDPKDALKNACN II+KLGVLK NFETEWNLQTLA+D+N 
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADENM 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  228 bits (581), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 115/120 (95%)

Query: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60
           MNAPDRFELFLLG+GESKL +DPDTK+PNAIV+TF KEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120
           YKVEHP FARFK+RIQT+EGYDPKDALKNACNGIINKLG+LKTNFETEWNLQTLA+DD F
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120

>Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  228 bits (580), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 107/122 (87%), Positives = 115/122 (94%)

Query: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60
           MNAPDRFELFLLGEGESKL+++PDTKAPNA+V+TFEKEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120
           YKVEHP FARFK+RIQT EGYDPKDALKNACN IINKLG LKTNFETEWNLQTLA+DD F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

Query: 121 GI 122
            +
Sbjct: 121 NM 122

>Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  228 bits (580), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 107/122 (87%), Positives = 115/122 (94%)

Query: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60
           MNAPDRFELFLLGEGESKL+++PDTKAPNA+V+TFEKEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120
           YKVEHP FARFK+RIQT EGYDPKDALKNACN IINKLG LKTNFETEWNLQTLA+DD F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

Query: 121 GI 122
            +
Sbjct: 121 NM 122

>Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON}
           complement(44216..44578) [363 nt, 121 aa]
          Length = 120

 Score =  227 bits (579), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 116/120 (96%)

Query: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60
           MNAPD+FELFLLGEGESKL ++PDTKAPNA+V+TFEKEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120
           YKVEHPLFARFK+RIQT+E YDPKDALKNACN IINKLG+LKTNFETEWNLQTLASD+NF
Sbjct: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

>NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30
           YOL005C
          Length = 122

 Score =  227 bits (578), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 107/122 (87%), Positives = 116/122 (95%)

Query: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60
           MNAPDRFELFLLGEGESKL +DPDTKAPNA+V+TF+KEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120
           YKVEHP FA FK+RIQT+EGYDPK ALKNACN IINKLG+LKTNFETEWNLQTLASD+NF
Sbjct: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005c RPB11 DNA-directed RNA polymerase II
          Length = 120

 Score =  225 bits (574), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 105/120 (87%), Positives = 115/120 (95%)

Query: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60
           MNAPDRFELFLLGEGESKL++DPDTKAPNA+V+TFEKEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDNKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120
           YKVEHP FARFK+RIQT+EGYDPKDAL+NAC+ IINKLG LK+NFETEWNLQTLA+DD F
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALRNACSSIINKLGALKSNFETEWNLQTLAADDAF 120

>TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON}
           Anc_6.30 YOL005C
          Length = 118

 Score =  222 bits (565), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 113/118 (95%)

Query: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60
           MNAPDRFE FLLGEGESKL+++PDTKAPN +V+TFEKEDHTLGNLI++ELL+DPKVLFAA
Sbjct: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDD 118
           YKVEHPLFARFKMRIQT+EGYDPKDAL+ ACN II KLG+LKTNFETEWNLQTLASDD
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118

>Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C
           (RPB11) - RNA polymerase II subunit, homologous to S.
           pombe Rpb11p subunit [contig 185] FULL
          Length = 122

 Score =  219 bits (558), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 102/122 (83%), Positives = 114/122 (93%)

Query: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60
           MNAPDRFELFLL EGE+KL++DPDTKAPNA++VTFEKEDHTL NLIRAELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120
           YKVEHPLFA+FKMRIQT EGYDPKDALKNACNGII+KLG L++NFETEWNLQTLAS+DN+
Sbjct: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 121 GI 122
            +
Sbjct: 121 AM 122

>SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly
           similar to uniprot|P38902 Saccharomyces cerevisiae
           YOL005C
          Length = 122

 Score =  218 bits (554), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 100/122 (81%), Positives = 114/122 (93%)

Query: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60
           MNAPDRFELFLL EGESKL ++PDTKAPNA+++TFEKEDHTLGNLIRAELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120
           YKVEHPLFARFKMRIQT+EGYDPKDALKNACN II KL  L++NFETEW+LQTLAS++N+
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120

Query: 121 GI 122
           G+
Sbjct: 121 GL 122

>KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  216 bits (551), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 100/122 (81%), Positives = 114/122 (93%)

Query: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60
           MNAPDRFELFLL EGE+KL++DPDTKAPNA++VTFEKEDHTL NLIR ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRGELLEDKGVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120
           YKVEHPLFA+FK+RIQT+EGYDPKDALKNACNGII+KLG L++NFETEWNLQTLAS+DN+
Sbjct: 61  YKVEHPLFAQFKLRIQTVEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 121 GI 122
            +
Sbjct: 121 AM 122

>ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL005C
           (RPB11)
          Length = 122

 Score =  216 bits (550), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 112/122 (91%)

Query: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60
           MNAPDRFELFLL EGESKL+++PDTKA NA+++TFEKEDHTLGN+IRAELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120
           YKVEHPLFARF+MRIQT EGYDPK+ALKNACN IINKL  LK+NFETEWNLQTLAS+D F
Sbjct: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120

Query: 121 GI 122
            +
Sbjct: 121 RL 122

>TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30
           YOL005C
          Length = 120

 Score =  215 bits (547), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 111/120 (92%)

Query: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60
           MNAPDRFELFLL EG+SKL+++ DTKA NA+V+TFEKEDHTLGNLIR ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120
           YKVEHPLFARFK+RIQT E YDPKDALK ACN IINKLG+LKTNF+TEWNLQTLASDDNF
Sbjct: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120

>KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 121

 Score =  208 bits (530), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 99/118 (83%), Positives = 109/118 (92%)

Query: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60
           MNAPDRFELFLL EGESKL+V+ DTKA +AI+VTFEKEDHTLGNLIRAELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDD 118
           YKVEHPLFA+FKMRIQT+EGYDPKDALKNACN IINKL  L++NFETEWNLQTLA++D
Sbjct: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED 118

>TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.163
           YNL113W
          Length = 130

 Score = 57.0 bits (136), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 56/106 (52%), Gaps = 2/106 (1%)

Query: 2   NAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFE--KEDHTLGNLIRAELLNDPKVLFA 59
           + P+  E+ +    E K+++ P+  +P+    +F+  +EDHTLGN +R  ++ +P+V F 
Sbjct: 18  SVPEVDEVDVNAVDEDKIKILPNATSPDGTSASFQISEEDHTLGNALRHIIMKNPEVEFC 77

Query: 60  AYKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNF 105
            Y + HP      +RIQT       +AL+     +++   V++  F
Sbjct: 78  GYSIPHPSETLLNLRIQTYGNTTAVEALQKGLKDLMDMCDVVEEKF 123

>CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {ON}
           similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113w RPC19 DNA-directed RNA polymerase I III
          Length = 137

 Score = 55.1 bits (131), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 49/92 (53%), Gaps = 2/92 (2%)

Query: 16  ESKLRVDPDTKAPNAIVVTFE--KEDHTLGNLIRAELLNDPKVLFAAYKVEHPLFARFKM 73
           ++K+++ P   + +    +F+  +EDHTLGN +R  ++ +P+V F  Y + HP      +
Sbjct: 40  KTKIKLLPQATSEDGTCASFQIAQEDHTLGNALRYIIMKNPEVEFCGYSIPHPSEELLNL 99

Query: 74  RIQTMEGYDPKDALKNACNGIINKLGVLKTNF 105
           RIQT       DAL+   + +I+    +K  F
Sbjct: 100 RIQTYGNITAVDALQKGLDDLIDLCDAVKDKF 131

>Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON}
           complement(2511..2897) [387 nt, 129 aa]
          Length = 128

 Score = 52.8 bits (125), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 16  ESKLRVDPDTKAPNAIVVTFE--KEDHTLGNLIRAELLNDPKVLFAAYKVEHPLFARFKM 73
           E K+++ P   + +    +F+   EDHTLGN +R  ++ +P+V F  Y + HP      +
Sbjct: 30  EDKIKILPQATSEDGTCASFQIMDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENLLNL 89

Query: 74  RIQTMEGYDPKDALKNACNGIINKLGVLKTNF 105
           RIQT       +AL+     +++   V++  F
Sbjct: 90  RIQTYGSTTAVEALQKGLGDLMDMCDVVEEKF 121

>KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON}
           Anc_2.163 YNL113W
          Length = 131

 Score = 52.4 bits (124), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 47/90 (52%), Gaps = 2/90 (2%)

Query: 18  KLRVDPDTKAPNAIVVTFE--KEDHTLGNLIRAELLNDPKVLFAAYKVEHPLFARFKMRI 75
           K+++ P   + +    +F+  +EDHTLGN +R  ++ +P+V F  Y + HP      +RI
Sbjct: 35  KIKILPQATSEDGTSASFQIVEEDHTLGNALRYIIMKNPQVEFCGYSIPHPSENLLNIRI 94

Query: 76  QTMEGYDPKDALKNACNGIINKLGVLKTNF 105
           QT       DALK     +++   V++  F
Sbjct: 95  QTYGEITAVDALKKGLADLMDLCDVVEETF 124

>Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON}
           similar to Ashbya gossypii AFL220C
          Length = 127

 Score = 51.2 bits (121), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 46/90 (51%), Gaps = 2/90 (2%)

Query: 18  KLRVDPDTKAPNAIVVTFE--KEDHTLGNLIRAELLNDPKVLFAAYKVEHPLFARFKMRI 75
           K+R+ P+  + +    +F+   EDHTLGN +R  ++ +P+V F  Y + HP      +RI
Sbjct: 31  KIRLLPEAASEDGTCASFQISDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSETVLNLRI 90

Query: 76  QTMEGYDPKDALKNACNGIINKLGVLKTNF 105
           QT       +AL      +++   V++  F
Sbjct: 91  QTYGKMTAVEALHKGLKDLMDLCDVVEDKF 120

>YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA
           polymerase subunit AC19, common to RNA polymerases I and
           III
          Length = 142

 Score = 51.2 bits (121), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAAYKV 63
           PDR ++ LL +  S    +  T A   IV    +EDHTLGN +R  ++ +P V F  Y +
Sbjct: 42  PDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYVIMKNPDVEFCGYSI 93

Query: 64  EHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNF 105
            HP      +RIQT       DAL+     +++   V+++ F
Sbjct: 94  PHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKF 135

>KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON}
           Anc_2.163 YNL113W
          Length = 134

 Score = 50.8 bits (120), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query: 18  KLRVDPDTKAPNAIVVTFE--KEDHTLGNLIRAELLNDPKVLFAAYKVEHPLFARFKMRI 75
           K+++ P+    +    +F+   EDHTLGN +R  ++ +P+V F  Y + HP      +RI
Sbjct: 38  KVKILPEATTEDGTCASFQILNEDHTLGNALRYVIMKNPEVEFCGYSIPHPSENWLNVRI 97

Query: 76  QTMEGYDPKDALKNACNGIINKLGVLKTNF 105
           QT       DA K     +++   V++  F
Sbjct: 98  QTYGKITAVDAFKKGLGDLMDMCDVVEDVF 127

>Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 50.8 bits (120), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAAYKV 63
           PDR ++ LL +  S    +  T A   IV    +EDHTLGN +R  ++ +P V F  Y +
Sbjct: 42  PDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYIIMKNPDVEFCGYSI 93

Query: 64  EHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNF 105
            HP      +RIQT       DAL+     +++   V+++ F
Sbjct: 94  PHPSENLLNIRIQTYGESTAVDALQKGLKDLMDLCDVVESKF 135

>Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 50.4 bits (119), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 53/104 (50%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAAY 61
           + PDR ++ LL +  S    +  T A   IV    +EDHTLGN +R  ++ +P+V F  Y
Sbjct: 40  DEPDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYIIMKNPEVEFCGY 91

Query: 62  KVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNF 105
            + HP      +RIQT       +AL+     +++   V+++ F
Sbjct: 92  SIPHPSENLLNVRIQTYGAITAVEALQKGLKDLMDLCDVVESKF 135

>TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.163
           YNL113W
          Length = 102

 Score = 49.3 bits (116), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 43/95 (45%), Gaps = 1/95 (1%)

Query: 12  LGEGESKLR-VDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAAYKVEHPLFAR 70
           +     K+R + P T   +A       EDHTLGN +R  L+ +P V F  Y + HP    
Sbjct: 1   MSAAPPKIRQLPPVTPDGSAASFQIRDEDHTLGNALRYLLMRNPAVEFCGYSIPHPSEPF 60

Query: 71  FKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNF 105
             +R+QT       DAL      +++   V++  F
Sbjct: 61  LNLRVQTYGDITASDALAQGLQDLMDLCDVVEDTF 95

>AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL113W
           (RPC19)
          Length = 135

 Score = 49.7 bits (117), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 18  KLRVDPDTKAPNAIVVTFE--KEDHTLGNLIRAELLNDPKVLFAAYKVEHPLFARFKMRI 75
           K+R+ P   + +     F+   EDHTLGN +R  ++ +P+V F  Y + HP      +RI
Sbjct: 39  KIRLLPQATSEDGTCAFFQITDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENFLNIRI 98

Query: 76  QTMEGYDPKDALKNACNGIINKLGVLKTNF 105
           QT       DAL      +++   V++  F
Sbjct: 99  QTYGKVTAVDALHKGLQDLMDMCDVVEDKF 128

>Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W
           (REAL)
          Length = 156

 Score = 49.7 bits (117), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 51/104 (49%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAAY 61
           + PDR ++ LL +  S    +  T A   IV    +EDHTLGN +R  ++ +P V F  Y
Sbjct: 54  DEPDREKIKLLTQATS----EDGTNASFQIV----EEDHTLGNALRYIIMKNPDVEFCGY 105

Query: 62  KVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNF 105
            + HP      +RIQT       DAL+     +++   V++  F
Sbjct: 106 SIPHPSENLLNIRIQTYGEITAVDALQKGLKDLMDLCDVVEAKF 149

>ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {ON}
           highly similar to uniprot|Q755Q7 Ashbya gossypii AFL220C
           AFL220Cp and similar to YNL113W uniprot|P28000
           Saccharomyces cerevisiae YNL113W RPC19 RNA polymerase
           subunit common to RNA polymerases I and III
          Length = 130

 Score = 47.4 bits (111), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 18  KLRVDPDTKAPNAIVVTFE--KEDHTLGNLIRAELLNDPKVLFAAYKVEHPLFARFKMRI 75
           K+++ P   + +    +F+  +EDHTLGN +R  ++ +P V F  Y + HP      +R+
Sbjct: 34  KIKILPQATSEDGTCASFQIAEEDHTLGNALRYMIMKNPDVEFCGYSIPHPSENLLNIRV 93

Query: 76  QTMEGYDPKDALKNACNGIINKLGVLKTNF 105
           QT       D L      +++    ++  F
Sbjct: 94  QTYGNVTAVDVLHKGLQDLMDLCDAVEDKF 123

>NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.163
           YNL113W
          Length = 150

 Score = 47.4 bits (111), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 49/104 (47%), Gaps = 12/104 (11%)

Query: 4   PDRFELFLLGEGESKLRVDPDTKAPNAIVVTFE--KEDHTLGNLIRAELLNDPKVLFAAY 61
           PDR ++ +L EG S+          +    +F+   EDHTLGN +R  ++ +P V F  Y
Sbjct: 50  PDREKVKILPEGASE----------DGTCASFQIVDEDHTLGNALRYIIMKNPNVEFCGY 99

Query: 62  KVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNF 105
            + HP      +RIQT       +A +     +++   V++  F
Sbjct: 100 SIPHPSENFLNVRIQTYGDITAVEAFQKGLQDLMDLCDVVEDKF 143

>SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {ON}
           highly similar to uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 131

 Score = 47.4 bits (111), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 46/90 (51%), Gaps = 2/90 (2%)

Query: 18  KLRVDPDTKAPNAIVVTFE--KEDHTLGNLIRAELLNDPKVLFAAYKVEHPLFARFKMRI 75
           K+++ P   + +    +F+  +EDHTLGN +R  ++ +P+V F  Y + HP      +RI
Sbjct: 35  KIKLLPQATSDDGTSASFQISEEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENLLNVRI 94

Query: 76  QTMEGYDPKDALKNACNGIINKLGVLKTNF 105
           QT       +AL+     +++    ++  F
Sbjct: 95  QTYGKITAVEALQKGLQDLMDMCDAVEDKF 124

>NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON}
           Anc_2.163 YNL113W
          Length = 149

 Score = 46.2 bits (108), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query: 18  KLRVDPDTKAPNAIVVTFE--KEDHTLGNLIRAELLNDPKVLFAAYKVEHPLFARFKMRI 75
           K+++     + +    +F+  +EDHTLGN +R  ++ +P+V F  Y + HP      +RI
Sbjct: 53  KIKILQQGASEDGCSASFQILQEDHTLGNALRYIIMKNPQVEFCGYSIPHPSEEFLNIRI 112

Query: 76  QTMEGYDPKDALKNACNGIINKLGVLKTNF 105
           QT       +AL      +++   V++  F
Sbjct: 113 QTYGEITAVEALHKGLQDLMDLCDVVEEKF 142

>KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {ON}
           some similarities with uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 146

 Score = 45.1 bits (105), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 43/89 (48%), Gaps = 2/89 (2%)

Query: 19  LRVDPDTKAPNAIVVTFE--KEDHTLGNLIRAELLNDPKVLFAAYKVEHPLFARFKMRIQ 76
           +R+     + +    +F+  +EDHTLGN +R  ++ +P V F  Y + HP      +RIQ
Sbjct: 51  IRLLSSATSEDGTCASFQISEEDHTLGNALRYIIMKNPDVEFCGYSIPHPSETLLNLRIQ 110

Query: 77  TMEGYDPKDALKNACNGIINKLGVLKTNF 105
           T   +   + L+     +++    ++  F
Sbjct: 111 TYGKFTAVEVLQKGLQDLMDLCDAVEDKF 139

>TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.163
           YNL113W
          Length = 129

 Score = 44.7 bits (104), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 18  KLRVDPDTKAPNAIVVTFE--KEDHTLGNLIRAELLNDPKVLFAAYKVEHPLFARFKMRI 75
           K+++ P   + +    +F+  +EDHTLGN +R  ++ +  V F  Y + HP      +RI
Sbjct: 33  KIKLLPQASSEDGTCASFQIAEEDHTLGNALRYVIMKNKDVEFCGYSIPHPSENLLNLRI 92

Query: 76  QTMEGYDPKDALKNACNGIINKLGVLKTNF 105
           QT       D L+     +++    ++  F
Sbjct: 93  QTYGATTAVDVLQKGLTDLMDLCDAVEDRF 122

>KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa]
           {ON} similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113W RPC19 RNA polymerase subunit common to RNA
           polymerases I and III
          Length = 127

 Score = 43.9 bits (102), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%)

Query: 38  EDHTLGNLIRAELLNDPKVLFAAYKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINK 97
           EDHTLGN +R  ++ +P+V F  Y + HP      +RIQT       +AL      +++ 
Sbjct: 53  EDHTLGNTLRYMIMKNPEVEFCGYSIPHPSENFLHIRIQTYGKITAVEALHKGLGDLMDM 112

Query: 98  LGVLKTNF 105
              ++  F
Sbjct: 113 CDAVEDRF 120

>Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON}
           YNL113W (RPC19) - subunit common to RNA polymerases I
           (A) and III (C) [contig 61] FULL
          Length = 150

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%)

Query: 35  FEKEDHTLGNLIRAELLNDPKVLFAAYKVEHPLFARFKMRIQTMEGYDPKDALKNACNGI 94
             +EDHTLGN +R  ++ +P V F  Y + HP      +RIQT   +   + L+     +
Sbjct: 73  ISEEDHTLGNSLRYIIMKNPDVEFCGYSIPHPSENLLNLRIQTYGKHTALEVLQKGLQDL 132

Query: 95  INKLGVLKTNF 105
           ++    ++  F
Sbjct: 133 MDLCDAVEDKF 143

>Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [786
           bp, 261 aa] {ON} similar to Ashbya gossypii ACL145W
           1-intron
          Length = 261

 Score = 28.9 bits (63), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%)

Query: 15  GESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVL 57
           G  ++ V P TK   A    +E +DHTL  LI+ + L  P +L
Sbjct: 94  GFYEVDVKPSTKEVRASYPIYELDDHTLVVLIKEDELQHPPIL 136

>KAFR0F01510 Chr6 complement(297704..298552) [849 bp, 282 aa] {ON}
          Anc_1.132 YJL203W
          Length = 282

 Score = 28.1 bits (61), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query: 43 GNLIRAELLNDPKVLFAAYKVEHPLFARFKMRIQTMEGYDPKDALKN 89
          G    A+LLNDP+  F+  + E+  +  +   I  +EG    D LKN
Sbjct: 23 GREFEAKLLNDPRDRFSFIRPENEHYEHY---ISLLEGTSTSDVLKN 66

>Kwal_23.5892 s23 (1358818..1360854) [2037 bp, 678 aa] {ON} YIL067C
           - Hypothetical ORF [contig 11] FULL
          Length = 678

 Score = 28.1 bits (61), Expect = 6.7,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 27/59 (45%)

Query: 41  TLGNLIRAELLNDPKVLFAAYKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLG 99
           T G+L+R E  N  K    AY  EHP    +++   T + ++  DA     N I   +G
Sbjct: 547 TRGSLLRGEAGNSWKPPVLAYNQEHPHLLNWQVTNSTEKSFEKLDAYSLLINDIERYVG 605

>YHL030W Chr8 (40084..45690) [5607 bp, 1868 aa] {ON}  ECM29Scaffold
           protein that assists in association of the proteasome
           core particle with the regulatory particle; degraded by
           the mature proteasome after assembly; contains HEAT-like
           repeats
          Length = 1868

 Score = 28.1 bits (61), Expect = 7.1,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 5/63 (7%)

Query: 11  LLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRA--ELLND---PKVLFAAYKVEH 65
           L  EG  KL++ P T A N  ++  + +  TLG++++   EL++D    + LF + K + 
Sbjct: 397 LHAEGWPKLQLGPQTPAFNTAILQRQLQYETLGDILKRDFELVSDLSYIEFLFESLKNDL 456

Query: 66  PLF 68
           P F
Sbjct: 457 PQF 459

>AGR316C Chr7 complement(1323148..1325289) [2142 bp, 713 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL012C
           (VTC4)
          Length = 713

 Score = 28.1 bits (61), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 15  GESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLND-PKVLFAAYKVEHPLFARFKM 73
           G++++R+  DT+        F+  D T GN  R ++  D P      + VE+  +A  ++
Sbjct: 368 GDARVRISLDTELTMVREDDFDGYDRTNGNWRRMDIGVDWPFKQLPEHDVEYFPYAVLEV 427

Query: 74  RIQTMEGYDPKDALK 88
           ++QT  G +P + ++
Sbjct: 428 KLQTQLGQEPPEWVR 442

>NCAS0C05860 Chr3 complement(1204693..1210299) [5607 bp, 1868 aa]
           {ON} Anc_4.15 YHL030W
          Length = 1868

 Score = 27.7 bits (60), Expect = 9.2,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 51/113 (45%), Gaps = 6/113 (5%)

Query: 11  LLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAE--LLNDPKVLFAAYKVEHPLF 68
           L  EG  KL++   T A N  ++    +  TLG+++  E  L+ D   +   +       
Sbjct: 391 LHAEGWPKLQLGESTPAFNTTILQRRLQYETLGDILMKEFSLVEDLSFIEFLFDSLQGDL 450

Query: 69  ARFKMRIQ-TMEGYDPKDALKNACNGIINKL-GVLKTNFETEWNLQTLASDDN 119
           + F+  IQ  +    P   L+   +   +KL G+LK     ++NLQ  +SD N
Sbjct: 451 SEFRASIQEALISLTPH--LRKLPSSSKDKLKGILKNLLSDDFNLQEASSDQN 501

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.138    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,587,106
Number of extensions: 515869
Number of successful extensions: 1166
Number of sequences better than 10.0: 48
Number of HSP's gapped: 1165
Number of HSP's successfully gapped: 48
Length of query: 122
Length of database: 53,481,399
Length adjustment: 91
Effective length of query: 31
Effective length of database: 43,046,793
Effective search space: 1334450583
Effective search space used: 1334450583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)