Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07194g6.45ON55855824150.0
TDEL0G042506.45ON51740113231e-178
YOL013C (HRD1)6.45ON55141610781e-140
Smik_15.1576.45ON55041510571e-137
Suva_15.1596.45ON55041410561e-137
Skud_15.1486.45ON54841110561e-137
TPHA0F024806.45ON60540610451e-135
SAKL0E01958g6.45ON52440110111e-131
TBLA0B005606.45ON4924099791e-126
Kpol_1035.506.45ON6013899861e-126
KAFR0A052406.45ON5534219541e-122
CAGL0E02299g6.45ON5454168911e-113
NDAI0C027706.45ON6304508691e-108
NCAS0D020106.45ON5104238551e-108
KNAG0E027406.45ON5564318341e-104
Kwal_56.225226.45ON5134008261e-103
KLTH0C10604g6.45ON5153988201e-102
KLLA0C05874g6.45ON5534045335e-60
ACL019C6.45ON5753924942e-54
Ecym_30486.45ON6703974895e-53
Ecym_72412.545ON758751323e-07
TDEL0B063402.545ON762831313e-07
AFR275W2.545ON753751296e-07
KAFR0B014602.545ON761631271e-06
Smik_11.2132.545ON759631261e-06
Suva_11.1892.545ON758631262e-06
ZYRO0E05632g2.545ON765631252e-06
YKL034W (TUL1)2.545ON758631252e-06
Skud_11.1922.545ON758631252e-06
NCAS0A047602.545ON761631224e-06
KNAG0A070902.545ON762721215e-06
TBLA0I014902.545ON750631206e-06
Kwal_26.80992.545ON750631191e-05
TPHA0C042602.545ON757631162e-05
KLLA0F25674g2.545ON757741153e-05
CAGL0L01947g2.545ON757631143e-05
KLTH0D07216g2.545ON747631143e-05
NDAI0K018102.545ON762601144e-05
KLTH0G12408g8.317ON603571125e-05
Kpol_1002.72.545ON754631136e-05
Skud_4.4028.317ON612491091e-04
Kwal_56.239008.317ON589951091e-04
SAKL0A09812g2.545ON751631092e-04
KLLA0E04071g8.317ON704321092e-04
Ecym_42508.317ON6571801082e-04
Suva_2.3048.317ON624391073e-04
TDEL0F02870na 1ON260941043e-04
AGR034W3.279ON159811013e-04
Smik_4.3878.317ON634421054e-04
NCAS0C033108.317ON570391046e-04
SAKL0H15686g8.317ON5991741046e-04
KAFR0B030708.317ON643481010.001
SAKL0H17116gsingletonON544501000.002
YDR143C (SAN1)8.317ON61039970.004
TDEL0D034603.279ON14438910.005
Kwal_27.105463.279ON10437880.006
CAGL0E01441g8.317ON71731950.007
YBR062C3.279ON18075900.010
KAFR0C017803.28ON11871870.011
KNAG0A012803.28ON11471860.011
Skud_2.1863.279ON17868890.012
KNAG0G023908.317ON68831930.013
CAGL0M08690g5.628ON32829900.018
NCAS0A113503.405ON42865910.019
Suva_4.3023.279ON15027860.024
NDAI0H008405.628ON34135890.028
TPHA0C008508.317ON78131900.028
Kpol_1052.193.279ON10328820.029
CAGL0K02563g2.542ON58630890.033
KNAG0J008503.279ON16228850.037
TPHA0A033403.405ON38477880.037
ZYRO0C11176g5.628ON36870880.039
Smik_2.1963.279ON18527850.039
TBLA0A096405.628ON32529870.040
Kpol_526.345.628ON32829870.042
NDAI0A074503.279ON17337840.049
NDAI0G026308.317ON66131880.049
KLTH0C05258g3.279ON15238830.053
ZYRO0D05830g8.317ON78031870.056
TDEL0F044408.317ON55483870.056
CAGL0H10274g3.279ON17571830.071
Kpol_1036.668.317ON66829860.079
CAGL0E01567g3.28ON10271790.093
SAKL0G07370g5.628ON32129840.100
TPHA0A039903.279ON17528820.10
ABR104W3.405ON32829840.11
KLTH0E02464g5.628ON32929840.11
NDAI0D02810na 1ON252107830.11
NCAS0C044803.28ON10971780.14
NDAI0G038603.28ON12371780.15
Kwal_55.199995.628ON15236800.15
Skud_15.203.28ON12171780.15
KAFR0A019902.542ON56030830.16
TDEL0A004703.28ON11871780.17
TBLA0G023102.542ON67430830.19
Suva_15.263.28ON12271770.19
SAKL0D03058g3.279ON15533790.20
Ecym_13285.628ON32029810.21
AER390W5.628ON31629810.21
YOL133W (HRT1)3.28ON12171770.22
KAFR0H005605.628ON32746810.24
Kpol_1014.163.28ON10771760.24
KLLA0E16677g5.628ON30529810.25
TBLA0B087103.28ON12271770.25
Smik_15.203.28ON12171760.26
KNAG0A074303.405ON10274750.27
ZYRO0C03058g3.28ON11671760.27
KLLA0E07151g3.28ON11069750.30
KNAG0C056602.542ON50730810.32
NCAS0A04680singletonON27483800.32
TPHA0C042502.542ON55626810.34
NCAS0A125502.542ON57284810.35
CAGL0B05049g1.389ON147027810.36
YDR265W (PEX10)5.628ON33729790.38
Ecym_26583.279ON15928770.38
KNAG0I013801.389ON149326810.40
ZYRO0E06996g3.279ON17227770.41
Skud_4.5285.628ON33729790.43
Suva_2.4335.628ON33729790.45
Smik_4.5165.628ON33729790.47
Kpol_1002.82.542ON55826790.48
Kwal_26.8030na 2ON66030790.49
SAKL0A09526gna 2ON66230790.49
Ecym_54453.405ON32147780.51
TDEL0A049405.628ON32629780.51
TBLA0C013301.389ON145229800.52
ZYRO0B02244g2.542ON56326790.53
Kwal_55.220543.28ON11162730.54
Suva_8.422.542ON58526790.54
NCAS0C052905.628ON33029780.55
KLLA0F18458g3.279ON14024750.55
YHL010C (ETP1)2.542ON58526790.56
CAGL0K08052g3.405ON30565780.56
Smik_8.322.542ON58526780.61
KLTH0D06886gna 2ON66430780.63
Skud_8.352.542ON58526780.63
TBLA0I019603.279ON18434760.65
ZYRO0E05192g1.389ON152026780.70
TDEL0A031802.542ON56726780.76
KLLA0E18503gna 2ON65030780.77
Kwal_26.80902.542ON52026770.80
KLTH0F19228g3.28ON11058720.84
KAFR0F028406.332ON44524770.87
NCAS0A082803.279ON11834720.89
SAKL0C13178g3.28ON13862730.90
KLTH0D07150g2.542ON54026770.90
Kwal_55.21206singletonON27527760.90
TPHA0C003505.628ON27829760.93
SAKL0A09746g2.542ON54826770.97
Kwal_56.231123.190ON13527730.98
TDEL0A03090na 2ON58630761.1
Kpol_1048.731.389ON154926771.1
NCAS0A087801.389ON150227771.2
KLLA0F25740g2.542ON51725751.5
NDAI0B018202.542ON62526751.5
YPR093C (ASR1)3.405ON28827741.5
CAGL0I04576g3.190ON14927721.6
CAGL0B02013g8.288ON112033751.7
TBLA0I023606.332ON64424751.7
NDAI0E004408.808ON41632741.8
KLLA0E17711g3.190ON16227712.0
KLLA0C08756g6.332ON42724742.0
KLTH0A06556g6.332ON46024742.1
SAKL0A01474g6.332ON46824742.1
TPHA0P014703.28ON11126692.2
NDAI0I004006.332ON48126742.2
ABR040W2.549ON41256732.5
AGL217W8.808ON41435732.5
SAKL0C01760gsingletonON147427742.5
SAKL0C03586gsingletonON147427742.5
KNAG0J015605.628ON30929722.6
Suva_15.223.22ON133625742.6
KLLA0F12166g1.389ON152826732.8
Kpol_1033.198.288ON113921732.9
AAL030C1.389ON153978733.0
KLLA0E06469g7.440ON96568733.0
AGL191W8.317ON58231733.1
KAFR0C004603.279ON15724703.1
TDEL0A074706.332ON40824723.4
KLTH0C04664g8.808ON30638713.5
ZYRO0B02046gna 2ON44530723.6
KAFR0I020901.389ON146626723.6
SAKL0D08272g1.389ON149127723.7
KNAG0I028806.332ON46124723.8
Ecym_7253na 2ON61730723.8
Ecym_20293.28ON11458674.0
ZYRO0C17424g3.405ON27363704.2
ADL181W3.28ON10858664.6
TDEL0B061701.389ON147026724.7
Ecym_26848.808ON38638714.7
KNAG0B054704.149ON60869715.1
SAKL0B08976g3.405ON32236705.3
CAGL0J03586g6.332ON41124705.6
Kwal_27.104198.808ON30038696.0
Kpol_1028.466.332ON44824706.3
TBLA0A039008.317ON69829706.3
KLTH0F18502gsingletonON26734696.7
Kwal_14.12871.389ON151827708.0
KLTH0G18150g1.389ON155427698.3
KLTH0F11044g3.405ON29129689.4
ZYRO0D08404g6.332ON40924689.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C07194g
         (558 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {...   934   0.0  
TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {O...   514   e-178
YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON} ...   419   e-140
Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {...   411   e-137
Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {...   411   e-137
Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {...   411   e-137
TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.4...   407   e-135
SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} simila...   394   e-131
TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.4...   381   e-126
Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON} (1244...   384   e-126
KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6...   372   e-122
CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {...   347   e-113
NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.4...   339   e-108
NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {O...   333   e-108
KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {O...   325   e-104
Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013...   322   e-103
KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {...   320   e-102
KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {...   209   5e-60
ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON} S...   194   2e-54
Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to ...   192   5e-53
Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar t...    55   3e-07
TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa] ...    55   3e-07
AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-synteni...    54   6e-07
KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.5...    54   1e-06
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    53   1e-06
Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034...    53   2e-06
ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {...    53   2e-06
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    53   2e-06
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    53   2e-06
NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.5...    52   4e-06
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    51   5e-06
TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.5...    51   6e-06
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    50   1e-05
TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {O...    49   2e-05
KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} simi...    49   3e-05
CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} simil...    49   3e-05
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    49   3e-05
NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2....    49   4e-05
KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weak...    48   5e-05
Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON} (19006.....    48   6e-05
Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON...    47   1e-04
Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {...    47   1e-04
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    47   2e-04
KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some s...    47   2e-04
Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 b...    46   2e-04
Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON...    46   3e-04
TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON}      45   3e-04
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    44   3e-04
Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON...    45   4e-04
NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317     45   6e-04
SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, ...    45   6e-04
KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {O...    44   0.001
SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]...    43   0.002
YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}  ...    42   0.004
TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.27...    40   0.005
Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {O...    39   0.006
CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some s...    41   0.007
YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, ...    39   0.010
KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON...    38   0.011
KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28 Y...    38   0.011
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    39   0.012
KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {O...    40   0.013
CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {...    39   0.018
NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa] ...    40   0.019
Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 b...    38   0.024
NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {O...    39   0.028
TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.3...    39   0.028
Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON} (60008.....    36   0.029
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    39   0.033
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    37   0.037
TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.4...    39   0.037
ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 ...    39   0.039
Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}...    37   0.039
TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [...    38   0.040
Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON} (83624..84...    38   0.042
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    37   0.049
NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317     39   0.049
KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459...    37   0.053
ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some s...    38   0.056
TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {O...    38   0.056
CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483) ...    37   0.071
Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa] ...    38   0.079
CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar...    35   0.093
SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 a...    37   0.100
TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.27...    36   0.10 
ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic hom...    37   0.11 
KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 a...    37   0.11 
NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON}      37   0.11 
NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28       35   0.14 
NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28...    35   0.15 
Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W...    35   0.15 
Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W (R...    35   0.15 
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    37   0.16 
TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28 Y...    35   0.17 
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    37   0.19 
Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W (R...    34   0.19 
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    35   0.20 
Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp...    36   0.21 
AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa...    36   0.21 
YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING fin...    34   0.22 
KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}...    36   0.24 
Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON...    34   0.24 
KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa] ...    36   0.25 
TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {...    34   0.25 
Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W (R...    34   0.26 
KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {...    33   0.27 
ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {O...    34   0.27 
KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar...    33   0.30 
KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa] ...    36   0.32 
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      35   0.32 
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    36   0.34 
NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON} Anc_2...    36   0.35 
CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some ...    36   0.36 
YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}  PEX10Perox...    35   0.38 
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    34   0.38 
KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1....    36   0.40 
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    34   0.41 
Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W ...    35   0.43 
Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W ...    35   0.45 
Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W ...    35   0.47 
Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON...    35   0.48 
Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig...    35   0.49 
SAKL0A09526g Chr1 (834338..836326) [1989 bp, 662 aa] {ON} conser...    35   0.49 
Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON} ...    35   0.51 
TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa...    35   0.51 
TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1....    35   0.52 
ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} simila...    35   0.53 
Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa] ...    33   0.54 
Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON} Y...    35   0.54 
NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5....    35   0.55 
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    33   0.55 
YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}  ET...    35   0.56 
CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {...    35   0.56 
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    35   0.61 
KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conser...    35   0.63 
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    35   0.63 
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    34   0.65 
ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} simil...    35   0.70 
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    35   0.76 
KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]...    35   0.77 
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    34   0.80 
KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa] ...    32   0.84 
KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {O...    34   0.87 
NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3....    32   0.89 
SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa] ...    33   0.90 
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    34   0.90 
Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {O...    34   0.90 
TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON} ...    34   0.93 
SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} simila...    34   0.97 
Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {O...    33   0.98 
TDEL0A03090 Chr1 (550834..552594) [1761 bp, 586 aa] {ON}               34   1.1  
Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON} (207...    34   1.1  
NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_...    34   1.2  
KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]...    33   1.5  
NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542     33   1.5  
YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}  ...    33   1.5  
CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar...    32   1.6  
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    33   1.7  
TBLA0I02360 Chr9 (541190..543124) [1935 bp, 644 aa] {ON} Anc_6.3...    33   1.7  
NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808...    33   1.8  
KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa] ...    32   2.0  
KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {...    33   2.0  
KLTH0A06556g Chr1 (545636..547018) [1383 bp, 460 aa] {ON} simila...    33   2.1  
SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {...    33   2.1  
TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {O...    31   2.2  
NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}...    33   2.2  
ABR040W Chr2 (470152..471390) [1239 bp, 412 aa] {ON} Syntenic ho...    33   2.5  
AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic ho...    33   2.5  
SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] ...    33   2.5  
SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakl...    33   2.5  
KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.6...    32   2.6  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    33   2.6  
KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa...    33   2.8  
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    33   2.9  
AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON} ...    33   3.0  
KLLA0E06469g Chr5 complement(581935..584832) [2898 bp, 965 aa] {...    33   3.0  
AGL191W Chr7 (339295..341043) [1749 bp, 582 aa] {ON} Syntenic ho...    33   3.1  
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    32   3.1  
TDEL0A07470 Chr1 (1302286..1303512) [1227 bp, 408 aa] {ON} Anc_6...    32   3.4  
KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some si...    32   3.5  
ZYRO0B02046g Chr2 (164680..166017) [1338 bp, 445 aa] {ON} conser...    32   3.6  
KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {...    32   3.6  
SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] ...    32   3.7  
KNAG0I02880 Chr9 complement(562281..563666) [1386 bp, 461 aa] {O...    32   3.8  
Ecym_7253 Chr7 complement(534000..535853) [1854 bp, 617 aa] {ON}...    32   3.8  
Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to A...    30   4.0  
ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa] ...    32   4.2  
ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic hom...    30   4.6  
TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_...    32   4.7  
Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {O...    32   4.7  
KNAG0B05470 Chr2 complement(1068236..1070062) [1827 bp, 608 aa] ...    32   5.1  
SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {O...    32   5.3  
CAGL0J03586g Chr10 complement(343893..345128) [1236 bp, 411 aa] ...    32   5.6  
Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W...    31   6.0  
Kpol_1028.46 s1028 complement(110464..110775,110777..111811) [13...    32   6.3  
TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {O...    32   6.3  
KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON} conse...    31   6.7  
Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247...    32   8.0  
KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa...    31   8.3  
KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly ...    31   9.4  
ZYRO0D08404g Chr4 complement(728281..729510) [1230 bp, 409 aa] {...    31   9.6  

>ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 558

 Score =  934 bits (2415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/558 (83%), Positives = 464/558 (83%)

Query: 1   MATSDTRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNS 60
           MATSDTRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNS
Sbjct: 1   MATSDTRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNS 60

Query: 61  AVLWKLSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDXXXXXXXXXXXXYMK 120
           AVLWKLSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQD            YMK
Sbjct: 61  AVLWKLSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDFFTVTLFGLLLLYMK 120

Query: 121 VFHWILKDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCITNSLSNSFGA 180
           VFHWILKDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCITNSLSNSFGA
Sbjct: 121 VFHWILKDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCITNSLSNSFGA 180

Query: 181 STSVHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQVDAHLXXXXXXXXXXXXXXXXXX 240
           STSVHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQVDAHL                  
Sbjct: 181 STSVHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQVDAHLSSVDTDTDGGDEENEDED 240

Query: 241 XXXXXFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLCQIVS 300
                FAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLCQIVS
Sbjct: 241 VNGSSFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLCQIVS 300

Query: 301 SLWRIWQNNKQLDDKLKTMSPVELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGKY 360
           SLWRIWQNNKQLDDKLKTMSPVELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGKY
Sbjct: 301 SLWRIWQNNKQLDDKLKTMSPVELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGKY 360

Query: 361 KPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVVXXXXXXXXXXXXXXXXXXX 420
           KPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVV                   
Sbjct: 361 KPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVVQSQSSTTNRTTQATNQSTN 420

Query: 421 XXXXXXXXXXXXXXXXXXXXXEMDXXXXXXXXXXXXXXXXXXXLGDLTPTPTTADSNSNI 480
                                EMD                   LGDLTPTPTTADSNSNI
Sbjct: 421 VTTTAATTTTTTTTTTTTSTTEMDSSGGSTASTPSSRQSTQQTLGDLTPTPTTADSNSNI 480

Query: 481 ANLWYSYPIQEAKDGVVTFSLRDSVSGNPVRAKLTLNNDNETQRITIPNECIHHLESIQG 540
           ANLWYSYPIQEAKDGVVTFSLRDSVSGNPVRAKLTLNNDNETQRITIPNECIHHLESIQG
Sbjct: 481 ANLWYSYPIQEAKDGVVTFSLRDSVSGNPVRAKLTLNNDNETQRITIPNECIHHLESIQG 540

Query: 541 LKRRISELEAQVREMSEH 558
           LKRRISELEAQVREMSEH
Sbjct: 541 LKRRISELEAQVREMSEH 558

>TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {ON}
           Anc_6.45 YOL013C
          Length = 517

 Score =  514 bits (1323), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 252/401 (62%), Positives = 299/401 (74%), Gaps = 20/401 (4%)

Query: 1   MATSDTRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNS 60
           MA S+TR+RQ   F++ VYALTIY+VYN+ RTS+SFLQ  ++LT GFN+VI+TVF  LNS
Sbjct: 1   MAISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNS 60

Query: 61  AVLWKLSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDXXXXXXXXXXXXYMK 120
            +LWKLST++LFG+L L+EYEHIFERLPFTIINT+ MSSMF E D            +MK
Sbjct: 61  VLLWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMK 120

Query: 121 VFHWILKDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCITNSLSNSFGA 180
           VFHWIL+DRLEALLQ+I ESTTL  LI TRF+FNLVLLAI DY+I+S C++NSL NSFGA
Sbjct: 121 VFHWILRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCVSNSLDNSFGA 180

Query: 181 STSVHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQVDAHLXXXXXXXXXXXXXXXXXX 240
           S SVHLM+GMEFA+LLIDLLN  +H  L FYEFY++Q                       
Sbjct: 181 SASVHLMMGMEFALLLIDLLNTTLHAALCFYEFYQSQTHGR------------RNAVNDD 228

Query: 241 XXXXXFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLCQIVS 300
                F+GLEGKF+YERVID+ TRFLKT++HA++L+PFRM I+LIKDV WD LTL Q   
Sbjct: 229 EDDTQFSGLEGKFIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQNAK 288

Query: 301 SLWRIWQNNKQLDDKLKTMSPVELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGKY 360
            LW+IW+NNKQLDDKL TMS  +L   DN+CI+CMDEL  + +E   G  R       K 
Sbjct: 289 GLWKIWRNNKQLDDKLPTMSEDQLRNIDNMCIICMDELIPEQDE---GHTR-----NTKN 340

Query: 361 KPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVV 401
           KPKRLPCGHVLHL+CLKNWMERSQTCPICRL VFDE GNVV
Sbjct: 341 KPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVV 381

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 54/84 (64%), Gaps = 10/84 (11%)

Query: 484 WYSYPIQEAKDGVVTFSLRDSVSGNPVRAKLTL----------NNDNETQRITIPNECIH 533
           WYS+P++E  + +VTFS+++S +   V A L +          ++D++ + I IP+E + 
Sbjct: 429 WYSFPVEETSENLVTFSMKNSATNETVPASLLIERTNASERYDDDDDQVETIIIPDEVVD 488

Query: 534 HLESIQGLKRRISELEAQVREMSE 557
             ++I+ LKRR+SELE+QV  +++
Sbjct: 489 QAQTIENLKRRVSELESQVEHLNK 512

>YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON}
           HRD1Ubiquitin-protein ligase; required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins; genetically linked to the unfolded protein
           response (UPR); regulated through association with
           Hrd3p; contains an H2 ring finger; likely plays a
           general role in targeting proteins that persistently
           associate with and potentially obstruct the ER-localized
           translocon
          Length = 551

 Score =  419 bits (1078), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 229/416 (55%), Positives = 292/416 (70%), Gaps = 27/416 (6%)

Query: 5   DTRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLW 64
           + RR+Q+A F +  Y LT Y VY++ +TSVSFLQ T+KL  GFN+++L++F +LNS +LW
Sbjct: 4   ENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLW 63

Query: 65  KLSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDXXXXXXXXXXXXYMKVFHW 124
           +L T +LFG L L+E+EHIFERLPFTIINT+FMSS+FHE+             Y+KVFHW
Sbjct: 64  QLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKVFHW 123

Query: 125 ILKDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCITNSLSNSFG--AST 182
           ILKDRLEALLQSI++STT+K+LI +RFSFNLVLLA++DY+I++ CI++  +N      ST
Sbjct: 124 ILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISSIYTNQKSDIEST 183

Query: 183 SVHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQV-----DAHL---------XXXXXX 228
           S++L+  MEF MLLIDLLNL + T LNF+EFYR+Q      + H+               
Sbjct: 184 SLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNENNHIVHGDPTDENTVESDQ 243

Query: 229 XXXXXXXXXXXXXXXXXFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDV 288
                            F GLEGKFMYE+ IDVFTRFLKT +H  MLIPFRM ++L+KDV
Sbjct: 244 SQPVLNDDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDV 303

Query: 289 FWDVLTLCQIVSSLWRIWQNNKQLDDKLKTMSPVELSAT---DNICIVCMDELCADLEEV 345
            WD+L L Q  +SLW+IW+NNKQLDD L T++  +L  +   DNICI+CMDEL       
Sbjct: 304 VWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDEL------- 356

Query: 346 VQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVV 401
           +  P+++      K KPKRLPCGH+LHL CLKNWMERSQTCPICRLPVFDE GNVV
Sbjct: 357 IHSPNQQTWKNKNK-KPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVV 411

>Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  411 bits (1057), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 227/415 (54%), Positives = 282/415 (67%), Gaps = 26/415 (6%)

Query: 5   DTRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLW 64
           + RR+Q+  F +  Y LT Y VY++ +TSVSFLQ T+KL  GFN+++L++F +LNS +LW
Sbjct: 4   ENRRKQLVVFIVITYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFVLLNSTLLW 63

Query: 65  KLSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDXXXXXXXXXXXXYMKVFHW 124
            L T +LFG L L+E+EHIFERLPFTIINT+FMSSMFHE+             Y+KVFHW
Sbjct: 64  HLLTRLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHW 123

Query: 125 ILKDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCITNSLSNSF--GAST 182
           ILKDRLEALLQSI++STT+K+LI +RFS NLVLLA LDY+I+  CI++  +N      ST
Sbjct: 124 ILKDRLEALLQSINDSTTMKTLIFSRFSLNLVLLAALDYQIIVHCISSIYTNQKIDIVST 183

Query: 183 SVHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQVDA-----HLXXXXXXX-------- 229
           S++LM  MEF MLLIDLLNL + T LNF+EFYR+Q        H+               
Sbjct: 184 SLYLMQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSDDGNHIVHDDLSDGNRVDFDG 243

Query: 230 XXXXXXXXXXXXXXXXFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVF 289
                           F GLEGKFMYE+ IDVFTRFLKT +H  MLIPFRM ++L+KDV 
Sbjct: 244 SQHALNDDGDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDVI 303

Query: 290 WDVLTLCQIVSSLWRIWQNNKQLDDKLKTMSPVELSAT---DNICIVCMDELCADLEEVV 346
           WD+L L Q  + LW+IW+NNKQLDD L T++  +L  +   DNICI+CMDEL        
Sbjct: 304 WDILALYQSATGLWKIWRNNKQLDDSLLTVTVEQLQNSANEDNICIICMDELIHS----- 358

Query: 347 QGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVV 401
                ++  K    KPKRLPCGH+LHL CLKNWMERSQTCPICRLPVFD+ GNVV
Sbjct: 359 ---TNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDDKGNVV 410

>Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  411 bits (1056), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 226/414 (54%), Positives = 285/414 (68%), Gaps = 25/414 (6%)

Query: 5   DTRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLW 64
           + RR+Q+  F +  Y LT Y VY++ +TSVSFLQ T+KL  GFN+++L++F +LNS +LW
Sbjct: 4   ENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLW 63

Query: 65  KLSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDXXXXXXXXXXXXYMKVFHW 124
           +L T +LFG L L+E+EHIFERLPFTIINT+FMSSMFHE+             Y+KVFHW
Sbjct: 64  QLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHW 123

Query: 125 ILKDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCITNSLSNSF--GAST 182
           I+KDRLEALLQSI++STTLK+LI +RFSFNL LLA+ DY+I++ CI++  +N      ST
Sbjct: 124 IIKDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCISSIYTNKNIDVVST 183

Query: 183 SVHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQV-----DAHLXXXXXXXXXX----- 232
           S++LM  MEF MLLIDLLNL + T LNF+EFY +Q      + H+               
Sbjct: 184 SLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIVQDEVEDENEVDSGE 243

Query: 233 --XXXXXXXXXXXXXFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFW 290
                          F GLEGKFMYE+ IDVFTRFLKT +H  MLIPFRM ++L+KDV W
Sbjct: 244 PHAELDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDVVW 303

Query: 291 DVLTLCQIVSSLWRIWQNNKQLDDKLKTMSPVELSAT---DNICIVCMDELCADLEEVVQ 347
           DVL L Q  ++LW+IW+NNKQLDD L T++  ++  +   DNICI+CMDEL         
Sbjct: 304 DVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSA----- 358

Query: 348 GPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVV 401
               ++  K    KPKRLPCGH+LHL CLKNWMERSQTCPICRLPVFDE GNVV
Sbjct: 359 ---NQQAWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVV 409

>Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {ON}
           YOL013C (REAL)
          Length = 548

 Score =  411 bits (1056), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 228/411 (55%), Positives = 285/411 (69%), Gaps = 22/411 (5%)

Query: 5   DTRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLW 64
           + RR+Q+  F +  Y LT Y VY++ +TSVSFLQ T+KL  GFN+++L++F +LNS +LW
Sbjct: 4   ENRRKQLIVFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLW 63

Query: 65  KLSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDXXXXXXXXXXXXYMKVFHW 124
           +L T +LFG L L+E+EHIFERLPFTIINT+FMSSMFHE+             Y+KVFHW
Sbjct: 64  QLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHW 123

Query: 125 ILKDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCITNSLSNSF--GAST 182
           ILKDRLEALLQSI++STT+K+LI +RFSFNLVLLA++D++I+  CI++  +N      ST
Sbjct: 124 ILKDRLEALLQSINDSTTMKNLILSRFSFNLVLLAVVDFQILIRCISSIYTNQNIDIIST 183

Query: 183 SVHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQVDA-----HL----XXXXXXXXXXX 233
           S++LM  MEF MLLIDLLNL + T LNF+EFYR+Q        H+               
Sbjct: 184 SLYLMQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSNESNHIVHDDTPNGVGFEEAH 243

Query: 234 XXXXXXXXXXXXFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVL 293
                       F GLEGKFMYE+ IDVFTRFLKT +H  MLIPFRM ++L+KDV WDVL
Sbjct: 244 AVLNDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPLMLLKDVVWDVL 303

Query: 294 TLCQIVSSLWRIWQNNKQLDDKLKTMSPVELSAT---DNICIVCMDELCADLEEVVQGPD 350
            L Q  +SLW+IW+NNKQLDD L T++  +L  +   DNICI+CMDEL            
Sbjct: 304 ALYQSGTSLWKIWRNNKQLDDALITVTAEQLQNSANEDNICIICMDELMHS--------Q 355

Query: 351 REKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVV 401
            ++  K    KPKRLPCGH+LHL CLKNWMERSQTCPICRL VFDE GNVV
Sbjct: 356 ADQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLSVFDEKGNVV 406

>TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.45
           YOL013C
          Length = 605

 Score =  407 bits (1045), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 208/406 (51%), Positives = 277/406 (68%), Gaps = 17/406 (4%)

Query: 6   TRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLWK 65
           TR+ Q+A     +Y  TI+  Y + ++S S+LQ TIKLT G NV+IL +F +LN A +WK
Sbjct: 7   TRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAFIWK 66

Query: 66  LSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDXXXXXXXX-XXXXYMKVFHW 124
               +LF +L L+EYEHI ERLPFTIIN   +SSMF+E+D             +MKV HW
Sbjct: 67  GLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKVAHW 126

Query: 125 ILKDRLEALLQSIHESTTLKSLI-CTRFSFNLVLLAILDYKIVSGCITNSLSNSFGASTS 183
           +LKDRLE+LLQS++++++++SLI   RF  NL L A++DY+++  C+TNS+ NS GASTS
Sbjct: 127 VLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNSIKNSMGASTS 186

Query: 184 VHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQVDAHLXXXXXXXXXXXXXXXXXXXXX 243
           +HL++G+EF MLL+DL+NL +HT LN YEF+++  D +L                     
Sbjct: 187 IHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKSIEDRNLNIVGEDEDGLVDDEEE----- 241

Query: 244 XXFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLCQIVSSLW 303
             F  LEGKFMYE+ ID+FTRFLKTL+H +M IPFRM I+L+KDV WDV+TL Q   SLW
Sbjct: 242 --FNELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVITLYQSTVSLW 299

Query: 304 RIWQNNKQLDDKLKTMSPVELSATDN-ICIVCMDELCA-DLEEVVQGPDRE------KVA 355
           + W+N+KQLD+KL T+S  EL ++DN +CIVCMD L   D     +  ++E        A
Sbjct: 300 KTWRNSKQLDEKLPTVSLEELKSSDNDMCIVCMDSLINIDFNSTEETENKEKEEQIYNAA 359

Query: 356 KTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVV 401
              K KPK+LPC H+LHL CLKNWMERSQTCPICRL VFD NGN++
Sbjct: 360 IHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNIL 405

>SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} similar
           to uniprot|Q08109 Saccharomyces cerevisiae YOL013C HRD1
           Ubiquitin-protein ligase required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins genetically linked to the unfolded protein
           response (UPR) regulated through association with Hrd3p
           contains an H2 ring finger
          Length = 524

 Score =  394 bits (1011), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 196/401 (48%), Positives = 271/401 (67%), Gaps = 32/401 (7%)

Query: 1   MATSDTRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNS 60
           M  S  RR Q   +++  Y+  I++VY+S  +SV+FLQ TIKL  G N++IL  F +LN 
Sbjct: 1   MPVSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNG 60

Query: 61  AVLWKLSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDXXXXXXXXXXXXYMK 120
            +LWKL T +LFG L L+EYEH+FERL FTI+N++F+SSMF EQD            ++K
Sbjct: 61  VLLWKLLTRLLFGELRLIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLK 120

Query: 121 VFHWILKDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCITNSLSNSFGA 180
           VFHWILKDRLE + Q+ +E+T LK ++ +RF+FNL+ LA +DY++V  C++NS+SN    
Sbjct: 121 VFHWILKDRLEFVFQNANENTNLKKMLFSRFNFNLLFLASVDYQMVRYCLSNSISNDQWT 180

Query: 181 STSVHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQV-DAHLXXXXXXXXXXXXXXXXX 239
           S+SV+LM G++FAMLL+D L++ +H V+NF E YR Q  ++H                  
Sbjct: 181 SSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQSHNSHYDEE-------------- 226

Query: 240 XXXXXXFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLCQIV 299
                 F GLEGKFMYE++ID+  R LK L+H  +LIPFRM I++IKD+ WD ++L Q  
Sbjct: 227 ------FLGLEGKFMYEKLIDMGARLLKMLLHIALLIPFRMPIMIIKDIIWDAISLYQTA 280

Query: 300 SSLWRIWQNNKQLDDKLKTMSPVELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGK 359
           +SLW+ W+N K+LD+KL  ++  EL+  +N+CIVCMD++  + E            +   
Sbjct: 281 TSLWKTWKNAKKLDEKLPDVTEEELNQGNNMCIVCMDDMLPNSE-----------TRNAN 329

Query: 360 YKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNV 400
            KPK+LPCGH+LHL CLK+WMERSQTCPICRLPVFDE GNV
Sbjct: 330 LKPKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERGNV 370

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 55/113 (48%), Gaps = 20/113 (17%)

Query: 464 LGDLTPTPTTADSN------SNIANLWYSYPI---QEAKDGVVTFSLRDSVSGNPVRAKL 514
           +G  + TPT A+ +        +   WY++PI   Q  KD VV F L DS   N + A L
Sbjct: 410 VGPTSTTPTQANRSVIMPQVPRVPQDWYAFPIEATQTTKDKVV-FKLVDS-DNNEITANL 467

Query: 515 TLNNDNE---------TQRITIPNECIHHLESIQGLKRRISELEAQVREMSEH 558
                 +          QRITIP  CI   E I+ LKR+ISE+E ++  +++ 
Sbjct: 468 LTKTRPQFQKVTEVSGGQRITIPQSCIEQKEEIESLKRKISEMENKLDALTKR 520

>TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.45
           YOL013C
          Length = 492

 Score =  381 bits (979), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 205/409 (50%), Positives = 283/409 (69%), Gaps = 31/409 (7%)

Query: 1   MATSDTRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNS 60
           M    +R  Q   F L +Y LT  +VY +  +S+SFLQ TIKLT GFN++I+++F+I+NS
Sbjct: 1   MPFYQSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGFNIIIISIFSIINS 60

Query: 61  AVLWKLSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDXXXXXXXXXXXXYMK 120
            +LWK S  +LFG L L+EYEH+ ERLPFT+IN VFMSSMF+E D            YMK
Sbjct: 61  IILWKFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIILSLLLLYMK 120

Query: 121 VFHWILKDRLEALLQSIHESTTLKSLI-CTRFSFNLVLLAILDYKIVSGCITNS-LSNS- 177
           V +WIL+DRLE+LLQ++++STT+ +LI  T+F FNL+L +++DY +++ CI+NS LSNS 
Sbjct: 121 VSNWILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCISNSLLSNSN 180

Query: 178 FGASTSVHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRT---QVDAHLXXXXXXXXXXXX 234
            G+S SV+L++GMEF MLL+DL N+  H++LN YEFY++    +D HL            
Sbjct: 181 IGSSASVYLLMGMEFTMLLVDLFNILCHSILNIYEFYKSSLVSLDTHL------------ 228

Query: 235 XXXXXXXXXXXFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLT 294
                      F GLEGKF+YE++ID FTRFLKT+IH ++LIPF M ++L KDV  D++T
Sbjct: 229 TSEDEEDDESGFNGLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVT 288

Query: 295 LCQIVSSLWRIWQNNKQLDDKLKTMSPVEL-SATDNICIVCMDELCADLEEVVQGPDREK 353
           L Q ++++W+IW NN++LDD+L T++  +L S  D ICI+CMD+L  +            
Sbjct: 289 LSQNINTIWKIWVNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSIN-----------S 337

Query: 354 VAKT-GKYKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVV 401
           + K   K KPK LPCGH+LH+ CLKNWMERSQTCP+CRLPVF+E G V+
Sbjct: 338 IQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKGEVL 386

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 55/92 (59%), Gaps = 11/92 (11%)

Query: 468 TPTPTTADSNSNIANL-WYSYPIQEAKDGVVTFSLRDSVSGNPVRAKLTLNNDNETQRIT 526
           TP P+T+ S+ +  N  W S+PI+   D  +TF+L +   G  ++++L +N+  +T +  
Sbjct: 395 TPEPSTSTSSDSEENEEWVSFPIETIDDSTITFNLAND-DGRILKSRLLINSTTDTTQ-- 451

Query: 527 IPNECIHHLESIQGLKRRISELEAQVREMSEH 558
                  + + I GLK++I++L+ Q+ +++++
Sbjct: 452 -------NSDDILGLKQKINQLQDQINQLNKN 476

>Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON}
           (124427..126232) [1806 nt, 602 aa]
          Length = 601

 Score =  384 bits (986), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 205/389 (52%), Positives = 263/389 (67%), Gaps = 16/389 (4%)

Query: 22  TIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLWKLSTAILFGNLSLLEYE 81
           T  ++Y +  +S S+LQ TIKL+ GFN ++L +F ILN   +W+    + FGNL L+EYE
Sbjct: 24  TFLSIYFAVLSSTSYLQVTIKLSQGFNAIVLVLFAILNGTYVWRFFIWLAFGNLRLIEYE 83

Query: 82  HIFERLPFTIINTVFMSSMFHEQDXXXXXXXXXX-XXYMKVFHWILKDRLEALLQSIHES 140
           H+ ERLPFTI+N V   SMF+++              +MKV HWIL+DRL+A++QS ++S
Sbjct: 84  HVMERLPFTILNMVITYSMFNDKSIAFTGSIFGFFLIFMKVLHWILRDRLDAIVQSFNDS 143

Query: 141 TTLKSLICTR-FSFNLVLLAILDYKIVSGCITNSLSNSFGASTSVHLMVGMEFAMLLIDL 199
           +TL S+I +  F  NL++  I+DYK+VS C++NSLSNS GAST+VHL++GMEF MLLIDL
Sbjct: 144 STLTSIILSNNFFLNLIIFTIVDYKMVSYCVSNSLSNSMGASTTVHLLLGMEFTMLLIDL 203

Query: 200 LNLAMHTVLNFYEFYRTQVDAHLXXXXXXXXXXXXXXXXXXXXXXXFAGLEGKFMYERVI 259
           LNL +HT LN YEF+ T ++                          F  LEGKFMYE+ I
Sbjct: 204 LNLFLHTCLNLYEFHLTTLER------SSNIIQEDGEDDEEDDELQFNSLEGKFMYEKTI 257

Query: 260 DVFTRFLKTLIHAIMLIPFRMS-ILLIKDVFWDVLTLCQIVSSLWRIWQNNKQLDDKLKT 318
           DVFTRFLKT IH +MLIP RM   LL+KDV W+V++L +   SLW+ W+NNKQLDDKL T
Sbjct: 258 DVFTRFLKTFIHILMLIPLRMKFFLLLKDVIWNVISLYKHTGSLWKTWKNNKQLDDKLPT 317

Query: 319 MSPVELSATD-NICIVCMDELCADLEEVVQGPDREK-----VAKTGKYKPKRLPCGHVLH 372
            S  EL  TD NICIVCMD+L   +        REK     + K+ K KPK+LPCGH+LH
Sbjct: 318 ASIEELKNTDNNICIVCMDDLLPRINSEKYDSQREKELYDHIMKS-KQKPKKLPCGHILH 376

Query: 373 LFCLKNWMERSQTCPICRLPVFDENGNVV 401
           L CLKNWMERSQTCPICRLPVFD+ GNV+
Sbjct: 377 LNCLKNWMERSQTCPICRLPVFDDKGNVM 405

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 49/88 (55%), Gaps = 17/88 (19%)

Query: 484 WYSYPIQEAKDGVVTFSLRDSVSGNPVR---AKL---------TLNNDNETQRITIPNEC 531
           WYS+PI+ + D  +TF + D  + +P +   AKL         TLN+D    ++ I ++ 
Sbjct: 509 WYSFPIKTSSDSSITFDISD--AHDPAKVYPAKLSVEEKVSSRTLNSDGGMLQVVIKDKD 566

Query: 532 IHHL---ESIQGLKRRISELEAQVREMS 556
           I  +   ++I  LK+RI+ELE +V  ++
Sbjct: 567 IKTVTDSKTIDLLKKRITELEEKVDSLA 594

>KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6.45
           YOL013C
          Length = 553

 Score =  372 bits (954), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 201/421 (47%), Positives = 272/421 (64%), Gaps = 26/421 (6%)

Query: 6   TRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLWK 65
           +R++Q+  F++ +Y LTI  ++ S ++S +FLQ TIKLT G NV+IL +FT LN  +LW+
Sbjct: 5   SRKQQLVIFSMIIYLLTIITIFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLFLLWE 64

Query: 66  LSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDXXXXXXXXXXXXYMKVFHWI 125
               ILFG L L+E+EHIFERLPFTIIN +FM S+F+E               +KVFHWI
Sbjct: 65  FLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKVFHWI 124

Query: 126 LKDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCI--------------- 170
           LKDRLE+LLQSI+++T LK+LI +R+  NL + ++LD+ I S                  
Sbjct: 125 LKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYDNNNSTNNN 184

Query: 171 ----TNSLSNSFGAS----TSVHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQVDAHL 222
               +++L N    +     ++ L+ GMEF +L +DL+NLAMHTVLNFYEFY +Q     
Sbjct: 185 QNADSSNLMNKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQRATAH 244

Query: 223 XXXXXXXXXXXXXXXXXXXXXXXFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSI 282
                                  F GLEGKFMYE++IDV T+F KT++H  +LI  ++ I
Sbjct: 245 HNVNAGTDEESEEEADGDDDDANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLIQTKLQI 304

Query: 283 LLIKDVFWDVLTLCQIVSSLWRIWQNNKQLDDKLKTMSPVEL-SATDNICIVCMDELCAD 341
           +++KDV WD LTL Q   SLW+I++NNKQLDDKL T+S  ++ +  DNICIVCMD+L   
Sbjct: 305 MVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDDLVPS 364

Query: 342 L--EEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGN 399
           L  +E V+    +  + +   +PK+LPCGH+LHL CLKNWMERSQTCPICRLPVFDENGN
Sbjct: 365 LHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFDENGN 424

Query: 400 V 400
           V
Sbjct: 425 V 425

>CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013c HRD1
          Length = 545

 Score =  347 bits (891), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/416 (46%), Positives = 263/416 (63%), Gaps = 31/416 (7%)

Query: 7   RRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLWKL 66
            +R+   F    Y LTIY V ++ ++SVSFLQ  +KL+ GFN++I+TVFT+LNS +LW+ 
Sbjct: 6   HKREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNSTLLWQF 65

Query: 67  STAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDXXXXXXXXXXXXYMKVFHWIL 126
            T++LFG L ++E+EHIFERLPF +INT+FM S F+E+             YMKVFHWIL
Sbjct: 66  LTSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMKVFHWIL 125

Query: 127 KDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCIT---NSLSNSFGASTS 183
           +DRL+ LLQ I+E T  K L+  R+  NL+LL ++D  ++S C++   N  S+ F A T+
Sbjct: 126 RDRLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSYVISFCVSTAYNIASSIFTAGTN 185

Query: 184 ---------------VHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQVDAHLXXXXXX 228
                          +++M  MEF  L+IDL+NL ++T L FYEF+ ++  +        
Sbjct: 186 SIVLGGGSPLTQRALIYIMQAMEFTNLMIDLVNLILNTGLQFYEFHLSRKFSQ-NNPTFN 244

Query: 229 XXXXXXXXXXXXXXXXXFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDV 288
                            F GLEGKFMYE++IDV TRFL+TL+H +M +   + ++L+KD+
Sbjct: 245 SISAEDADTESEDGDSQFNGLEGKFMYEKLIDVVTRFLQTLVHVVMAMVLNLPLMLVKDI 304

Query: 289 FWDVLTLCQIVSSLWRIWQNNKQLDDKLKTMSPVELSAT---DNICIVCMDELCADLEEV 345
           F DV  L     SL  IW+N+KQLD KL TM+  +L+     DN+CIVCMDEL      V
Sbjct: 305 FVDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPNFDNVCIVCMDEL------V 358

Query: 346 VQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVV 401
            + P   +    GK KPK+LPCGHVLHL CLKNWMERSQTCPICRLPVFDENG ++
Sbjct: 359 SENPHHHQ--SDGK-KPKKLPCGHVLHLSCLKNWMERSQTCPICRLPVFDENGEIL 411

>NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.45
           YOL013C
          Length = 630

 Score =  339 bits (869), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 172/450 (38%), Positives = 268/450 (59%), Gaps = 54/450 (12%)

Query: 5   DTRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLW 64
           ++++ Q   F++SVY +T + + N+A +S SFL   +KL  GFN++I+T+F +LNS + W
Sbjct: 9   NSKKFQFVIFSISVYLITFFTIINAANSSTSFLHLCLKLNEGFNIMIITIFILLNSLLSW 68

Query: 65  KLSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDXXXXXXXXXXXXYMKVFHW 124
           KL T  LF +L L+E EHI ERLPFT+IN + M++MF+E+              ++V+HW
Sbjct: 69  KLITWFLFNDLRLIEQEHIMERLPFTVINFIVMATMFNERFFFTLTIYGLLLISLRVYHW 128

Query: 125 ILKDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCIT------------- 171
           ILKDRLE ++Q+I++ST++  +I ++FSFNL+ L++++ K++  C+T             
Sbjct: 129 ILKDRLEFIIQTINDSTSMTKIIFSKFSFNLISLSLINLKLIQNCLTWDDINFWKNNQNL 188

Query: 172 -----NSLSNSFGAST----------SVHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRT 216
                N L N   ++T           V+LM+GMEF++LL++  N+  H++L+ +EFY++
Sbjct: 189 FNSIMNYLINPISSTTISNGINNHSNPVYLMLGMEFSILLLEYFNVLFHSLLSLFEFYKS 248

Query: 217 QVDAHLXXXXXXXXXXXXXXXXXX------------------XXXXXFAGLEGKFMYERV 258
           +  +                                           F GLEGKF+YE++
Sbjct: 249 KQFSIQQQQIRQNNLINRAQTTQNDENEINIGLDIDIDDDEEDDDETFNGLEGKFIYEKI 308

Query: 259 IDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLCQIVSSLWRIWQNNKQLDDKLKT 318
           ID+FTRFL T+IH  +L+P  + ++L+KD+ WD  +L +   SL++IW+NN++L+  L  
Sbjct: 309 IDLFTRFLMTIIHVSLLLPLNIPMILVKDILWDFFSLYRNAMSLYKIWKNNQKLESALPN 368

Query: 319 MSPVELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGKY--------KPKRLPCGHV 370
           M+P +L  +DN+CI+CMD+L   LE +    +      +  +        KPK+LPCGH 
Sbjct: 369 MTPDDLQHSDNVCIICMDDLLPSLETLEHATNVSSTTPSSNHYLNIKKKKKPKKLPCGHF 428

Query: 371 LHLFCLKNWMERSQTCPICRLPVFDENGNV 400
           LH  CLKNWMERSQTCPICRL VFD+NGNV
Sbjct: 429 LHFSCLKNWMERSQTCPICRLDVFDKNGNV 458

>NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {ON}
           Anc_6.45 YOL013C
          Length = 510

 Score =  333 bits (855), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 177/423 (41%), Positives = 253/423 (59%), Gaps = 46/423 (10%)

Query: 6   TRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLWK 65
           TRR Q+  F   +Y LTI  + NSA  S SFL  ++KL  GFNV+I+T+F +LN+ +LWK
Sbjct: 4   TRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMIITIFILLNALLLWK 63

Query: 66  LSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDXXXXXXXXXXXXYMKVFHWI 125
               +LF  L L+E EHI ERLPFTIIN +F+S+MF+E+             YMK+F+WI
Sbjct: 64  FLNFLLFKELRLIEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYWI 123

Query: 126 LKDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCIT-------------- 171
           LKDRLE L+QS + + ++   I ++F  NL++L+ ++ +++  CI               
Sbjct: 124 LKDRLEFLIQS-NTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNST 182

Query: 172 ---NSLSNSFGASTS-----------VHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQ 217
               SL N    S++           ++LM+ MEFA+LLI+ +NL +H++L+ YE Y++ 
Sbjct: 183 SILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAILLINFINLFLHSILSLYEIYKSN 242

Query: 218 VDAHLXXXXXXXXXXXXXXXXXXXXXXXFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIP 277
               L                       F GLE KF+YE++ID+FTR L T+IH  + +P
Sbjct: 243 QYDQL---NAIIEDIEDENDDDDDTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALP 299

Query: 278 FRMSILLIKDVFWDVLTLCQIVSSLWRIWQNNKQLDDKLKTMSPVELSATDNICIVCMDE 337
             + ++++KD+ WD+++L Q    L++I +NNK LD KL  M P +L  +DN+CIVCMD+
Sbjct: 300 LNLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDNVCIVCMDD 359

Query: 338 LCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDEN 397
           L ++              +  K K KRLPCGH LHL CLKNWMERSQTCPICRLPVFDE+
Sbjct: 360 LLSE--------------EHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDES 405

Query: 398 GNV 400
           GNV
Sbjct: 406 GNV 408

 Score = 34.7 bits (78), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 10/69 (14%)

Query: 467 LTPTPTTADSNSNIANLWYSYPIQEA-KD-GVVTFSLRDSVSGNPVRAKLTLNNDNETQR 524
           L P   + D+N+     WYS+PI    KD  V++F LRD    +     + L  + +T+ 
Sbjct: 449 LEPEEASIDNNT-----WYSFPITHINKDKSVISFELRDDKESS---ETVQLIRETKTEN 500

Query: 525 ITIPNECIH 533
           + IP++ IH
Sbjct: 501 VIIPDDHIH 509

>KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {ON}
           Anc_6.45 YOL013C
          Length = 556

 Score =  325 bits (834), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 176/431 (40%), Positives = 250/431 (58%), Gaps = 41/431 (9%)

Query: 6   TRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLWK 65
           +R++Q A   + +Y LT + V N+   S +FL+ T  LT G N VI+  F++LN  +LWK
Sbjct: 8   SRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLLWK 67

Query: 66  LSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDXXXXXXXXXXXXYMKVFHWI 125
             T ++FG+L L+E EHIFER+P T+IN + +SS+  ++              +KV HWI
Sbjct: 68  GFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIVLLGGLLLVLKVSHWI 127

Query: 126 LKDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCITNSLSNSF---GAST 182
           L+DRLE  LQ I+++TTL SL+ ++FS NL++  ILDY +   C  N   N +     S 
Sbjct: 128 LRDRLEGFLQRINDTTTLTSLLFSKFSRNLLIFGILDYFVTKICFFNHFGNFYHHGDFSN 187

Query: 183 SVHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQVDAHLXXXXXXXXXXXXXXXXXXXX 242
              +M G+E+A++ IDL+N+  HTVLNFY F+RTQ+ +                      
Sbjct: 188 ITQIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSEDENDSGVN 247

Query: 243 XXXFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLCQIVSSL 302
                GLEGKF+YE++ID     L+T +H  MLIP R   +L+KD  WD+  L    +SL
Sbjct: 248 AD--GGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDFVWDLFNLVNNGNSL 305

Query: 303 WRIWQNNKQLDDKLKTMSPVELSATDNICIVCMDELC----------------------- 339
           W+I++NN+QL+ KL  ++  +L   DN+CIVCMD+L                        
Sbjct: 306 WKIYKNNRQLNKKLPNIAIEDLLDHDNMCIVCMDDLVLVHHPTKRRQSVQEECDDEKNTE 365

Query: 340 --------ADLEEV--VQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPIC 389
                    DL EV   QG D +++A +   KPK+LPCGH+LH  CLKNWMERSQTCPIC
Sbjct: 366 KDKPSTTEEDLSEVEPTQG-DIDRMADSK--KPKKLPCGHMLHFSCLKNWMERSQTCPIC 422

Query: 390 RLPVFDENGNV 400
           R+PVFD++GNV
Sbjct: 423 RVPVFDKDGNV 433

>Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013C
           (HRD1) - required to degrade misfolded ER lumenal and
           integral membrane proteins [contig 185] FULL
          Length = 513

 Score =  322 bits (826), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 163/400 (40%), Positives = 236/400 (59%), Gaps = 35/400 (8%)

Query: 7   RRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLWKL 66
           +RRQ A +  + YA   +A+  + + S+SFL+ + +L  G N+++L  F  +N  +LWK 
Sbjct: 6   QRRQFAAYVFASYAAAAWAIIGTVQESLSFLELSARLCEGLNLILLCNFAAVNGVLLWKA 65

Query: 67  STAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDXXXXXXXXXXXXYMKVFHWIL 126
            T +LFG L LLEYEHIFERL FTI+N  FMSS F E +            ++KVFHW+L
Sbjct: 66  LTHLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFSESEFMSVMAFSAALIFVKVFHWVL 125

Query: 127 KDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCITN----SLSNSFGAST 182
           +DRLE + Q   E T    L+ +RF FN+ LL  LD+++   CI      S S  + +S 
Sbjct: 126 RDRLEHVFQHTDEHTNFARLLLSRFFFNIFLLGFLDFQMTKFCIQGTRFFSRSGFYSSSL 185

Query: 183 SVHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQVDAHLXXXXXXXXXXXXXXXXXXXX 242
           SVHLM  +EFAMLL+D+  +AM +++N  E Y+ +                         
Sbjct: 186 SVHLMFAVEFAMLLVDVTEVAMKSIINLVEVYQCK-------------------RSFARD 226

Query: 243 XXXFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLCQIVSSL 302
              + GLEGKFMYE+V+ +  +  +  +H ++++PF M +++ KD+ WD   +     SL
Sbjct: 227 GEDYTGLEGKFMYEKVVQLICQLTRMGLHIMLMMPFSMPLMIAKDILWDAFAVFHTAKSL 286

Query: 303 WRIWQNNKQLDDKLKTMSPVELSATDN-ICIVCMDELCADLEEVVQGPDREKVAKTGKYK 361
              W++N+Q+D+KL  +S  +L+A+D+ +CIVCMD++ A  E               K K
Sbjct: 287 LLTWKSNRQIDEKLPDVSEAQLAASDDKMCIVCMDDMLAPSE-----------CTNAKQK 335

Query: 362 PKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVV 401
           PKRLPC H LHL CLK+WMERSQTCPICR+PVFD+ GNVV
Sbjct: 336 PKRLPCNHCLHLGCLKSWMERSQTCPICRVPVFDKKGNVV 375

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 49/85 (57%), Gaps = 12/85 (14%)

Query: 484 WYSYP-IQEAKDGVVTFSLRDSVSGNPVRAKLTLNNDNE----------TQRITIPNECI 532
           WY++P +Q   +G +   + D+ SG  ++A L   + +E           +++ + N+C+
Sbjct: 425 WYAFPTVQVHDEGSIDIKVTDT-SGAEIKATLVCKDRHEFEAIETDAQGPRKVVVKNDCV 483

Query: 533 HHLESIQGLKRRISELEAQVREMSE 557
           +  + I+ LKRRISELE +V E+S+
Sbjct: 484 YQNQDIERLKRRISELENKVDELSK 508

>KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 515

 Score =  320 bits (820), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 160/398 (40%), Positives = 237/398 (59%), Gaps = 33/398 (8%)

Query: 7   RRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLWKL 66
           +RRQ   + +  Y    ++V +  + S+SFL A +KL  G N+V+L  F I+NS +LWK 
Sbjct: 6   QRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSILLWKG 65

Query: 67  STAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDXXXXXXXXXXXXYMKVFHWIL 126
            T +LFG L LLEYEHIFERL FTI+N  FMSS F E              +++VFHW+L
Sbjct: 66  LTRLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRVFHWVL 125

Query: 127 KDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCITNSLSNSFGASTS--V 184
           KDRLE + Q   E T +  L+C+RF  N+++ A++DY++V  C+ NSL+N    S S  V
Sbjct: 126 KDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSLTNKHDPSPSAPV 185

Query: 185 HLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQVDAHLXXXXXXXXXXXXXXXXXXXXXX 244
           +++  ++F+MLL+D+  +AM +V+N  E  + +                           
Sbjct: 186 YILFCVDFSMLLVDVAEVAMKSVINLIELIQCK-------------------RAFERDGD 226

Query: 245 XFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLCQIVSSLWR 304
            F GL+GKFMYE+++ +  + LK  +    L PF M +++ KD+ WD + L     S+WR
Sbjct: 227 DFVGLDGKFMYEKLVQLVCQVLKLGLRVASLAPFSMPLMIAKDIIWDGIALFHTGKSVWR 286

Query: 305 IWQNNKQLDDKLKTMSPVELSAT-DNICIVCMDELCADLEEVVQGPDREKVAKTGKYKPK 363
            W++N+Q+D+KL  ++  +L+A+ D +CIVCM+++    E           A + K+KPK
Sbjct: 287 TWKSNRQIDEKLPDVTEAQLNASEDKMCIVCMEDMLPPSE-----------ATSAKHKPK 335

Query: 364 RLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVV 401
           +LPC H LHL CLK+WMERSQTCPICR+ VFD  GNV 
Sbjct: 336 KLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVA 373

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 51/97 (52%), Gaps = 13/97 (13%)

Query: 472 TTADSNSNIANLWYSYPIQ-EAKDGVVTFSLRDSVSGNPVRAKLTLN----------NDN 520
             + SN N    WY++P+     DG V F +RD ++G  + AKL +            D 
Sbjct: 416 AVSSSNPNFPT-WYTFPVTLSDNDGAVDFKVRD-INGVEINAKLIIKKRPGFDVPKEQDQ 473

Query: 521 ETQRITIPNECIHHLESIQGLKRRISELEAQVREMSE 557
           E+QR+ I +      + I+ LKRRISELE +V E+++
Sbjct: 474 ESQRVVINDPPATQYQDIERLKRRISELENKVDELTK 510

>KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {ON}
           weakly similar to uniprot|Q08109 Saccharomyces
           cerevisiae YOL013C HRD1 Ubiquitin-protein ligase
           required for endoplasmic reticulum-associated
           degradation (ERAD) of misfolded proteins genetically
           linked to the unfolded protein response (UPR) regulated
           through association with Hrd3p contains an H2 ring
           finger
          Length = 553

 Score =  209 bits (533), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 132/404 (32%), Positives = 204/404 (50%), Gaps = 26/404 (6%)

Query: 9   RQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLWKLST 68
           ++   ++L  Y    ++++    TS S+L A  K+T G + +I     +LNS ++ K   
Sbjct: 24  QKFIAYSLMSYTAAAWSLHYCVTTSFSYLHAMTKITEGIHAMIWGNLFLLNSVLILKGVI 83

Query: 69  AILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDXXXXXXXXXXXXYMKVFHWILKD 128
            +LFG L L+EYEHI ER+ +T+I T+ +S                     +  HWILKD
Sbjct: 84  HMLFGQLRLIEYEHILERISYTVI-TLLLSCSSMNGLISVMQIHCVLFVCCRTLHWILKD 142

Query: 129 RLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCITNSLSNSFGASTSVHLMV 188
           R+E   Q+     TLK ++ +RF FNL++L  +D  IV+  +   L  S     +  L +
Sbjct: 143 RMEVTFQANDMRLTLKDILLSRFMFNLLVLTAVDGIIVAYYVNKILYKS-NIDVTYTLFI 201

Query: 189 GMEFAMLLIDLLNLAMHTVLNFYEF--------YRTQVDAHLXXXXXXXXXXXXXXXXXX 240
             ++A+L  DLL + + T LN +E          R   D H+                  
Sbjct: 202 ISQYAILGTDLLQVILRTGLNLFELSTIQNRARIRRNADHHVDEPVINHEERPNAVAIEE 261

Query: 241 XXXXXF--AGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLCQI 298
                   AGLEGKF+YE++IDVF   +K +I       F    +++  V W+ +T  + 
Sbjct: 262 DEDEDEENAGLEGKFIYEKLIDVFISTVKVIIK--FASSFSTGRVMMVTVLWEAITTFKS 319

Query: 299 VSSLWRIWQNNKQLDDKLKTMSPVELSATD-NICIVCMDELCADLEEVVQGPDREKVAKT 357
              LW+ W+++K LD  L   + +++ + + +ICIVCM++           P  ++  K+
Sbjct: 320 ARGLWKNWKSSKSLDASLMDATDIQIESGEIDICIVCMEDFL---------PSHQR--KS 368

Query: 358 GKYKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVV 401
              K K LPC H LHL CLKNW+ RS TCPICRLP+FDENGNV+
Sbjct: 369 DGKKVKILPCTHALHLSCLKNWIARSPTCPICRLPIFDENGNVM 412

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 41/72 (56%), Gaps = 4/72 (5%)

Query: 488 PIQEAKDGVVTFSLRDSVSGNPVRAKLTLNNDNETQR--ITIPNECIHHLESIQGLKRRI 545
           PIQ   +    F +  + SG  +   L L N+ +T +  + +P + +   ++ Q LKR+I
Sbjct: 479 PIQREDEHKHKFKIL-TESGKEIEGSLILRNNIDTTKGSVVLPQDLLIDQDASQ-LKRKI 536

Query: 546 SELEAQVREMSE 557
           ++LE+++ E+S+
Sbjct: 537 ADLESKLEELSK 548

>ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL013C
           (HRD1)
          Length = 575

 Score =  194 bits (494), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 122/392 (31%), Positives = 203/392 (51%), Gaps = 29/392 (7%)

Query: 12  ACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLWKLSTAIL 71
           A F  + YAL  ++ Y+ A +    L A    ++G + VI   F I++  +       +L
Sbjct: 11  AMFITATYALAGWSAYSCATSFDDPLSALFMASSGVHFVIWGNFLIVHYCLFVWAIIRVL 70

Query: 72  FGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDXXXXXXXXXXXXYMK--VFHWILKDR 129
           FG L+ +EY+HIFERL   ++    ++S+                 Y    V HW+L+DR
Sbjct: 71  FGQLTAIEYDHIFERLHVVLVT---LASIVITMRKTYMAGHMTILFYTLCLVAHWVLRDR 127

Query: 130 LEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCITNSLSNSFGASTSVHLMVG 189
           ++ + Q     ++L  ++C+RF F+L++L ++DYK++  C+ N+  N  G    ++LM+ 
Sbjct: 128 MDFVFQVHGTDSSLLGILCSRFMFSLLVLGMVDYKMLKFCVQNT--NVDGKRHELYLMLA 185

Query: 190 MEFAMLLIDLLNLAMHTVLNFYEFYRTQV--DAHLXXXXXXXXXXXXXXXXXXXXXXXFA 247
           + FA L++D+L++ + T LN +E  R++    A+L                         
Sbjct: 186 LSFAQLILDVLHVVLLTSLNLFEMVRSRRTRSANLVYEGGTTDDDADDEVFI-------- 237

Query: 248 GLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLCQIVSSLWRIWQ 307
            LEGK++YE V D+    LK ++  I  +    SI ++  +F   +   +    ++  W+
Sbjct: 238 -LEGKYIYETVFDLTITVLKVILDIIQEVFVPWSITVVYSIFVRSIKAGESFLLVYNYWK 296

Query: 308 NNKQLDDKLKTMSPVELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPC 367
           NNK+L +KL  +S  +L  TD++CI+CMD++    E            K  + + K LPC
Sbjct: 297 NNKKLYEKLSDVSEEQLDDTDSMCIICMDDMLPTTE----------TTKMNR-RAKMLPC 345

Query: 368 GHVLHLFCLKNWMERSQTCPICRLPVFDENGN 399
           GH+LH  CLK+WMERSQTCPICRL VF  + N
Sbjct: 346 GHMLHFGCLKSWMERSQTCPICRLSVFANDSN 377

>Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to
           Ashbya gossypii ACL019C
          Length = 670

 Score =  192 bits (489), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 118/397 (29%), Positives = 199/397 (50%), Gaps = 35/397 (8%)

Query: 14  FALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLWKLSTAILFG 73
           F    YAL  +++YN   TS+SFLQA  K T G +++I   F +++  +   L   +LFG
Sbjct: 13  FIAVTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLVVRMLFG 72

Query: 74  NLSLLEYEHIFERLPFTIINTVFMSSMFHEQDXXXXXXXXXXXXYMKVFHWILKDRLEAL 133
            L+LLEYEHIFERL  T+++++ +      ++              +V HW+++DR+E +
Sbjct: 73  RLTLLEYEHIFERLHLTVLSSLSVLITMDRKNSKIGVIAIPFHVLCQVLHWVVRDRMEFV 132

Query: 134 LQS-IHESTTLKSLICTRFSFNLVLLAILDYKIV----------SGCITNSLSNSFGAST 182
               I     +K L+ +RF  ++V+L ++D+K++           G +   L +  G +T
Sbjct: 133 FAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMMYFYRQHQAEQGYLYYLLFSDNGQNT 192

Query: 183 S---VHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRT--QVDAHLXXXXXXXXXXXXXXX 237
           S   + L +G++F +L +D L + +   L F E ++   +V  H                
Sbjct: 193 SEDRLSLSLGVDFGLLFLDWLQVVLLNCLKFVELFKAGRRVQEHQLLDNNELENDIEDDG 252

Query: 238 XXXXXXXXFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLCQ 297
                      LE KF+YE++++     LK L++  ++     S ++  ++F   +  C+
Sbjct: 253 AFI--------LEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIFIKSIETCE 304

Query: 298 IVSSLWRIWQNNKQLDDKLKTMSPVELSATDNICIVCMDELCADLEEVVQGPDREKVAKT 357
               L+  W+NN++L +KL  ++   L   D  C +CMD++              K  K 
Sbjct: 305 RCVLLFNYWKNNRRLHEKLLDVTAGHLDGVDITCTICMDDMLPS-----------KDVKV 353

Query: 358 GKYKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVF 394
              K K LPCGH+LH  CLK+WM+R+QTCPICR PVF
Sbjct: 354 NNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVF 390

>Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AFR275W
          Length = 758

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 38/75 (50%), Gaps = 9/75 (12%)

Query: 322 VELSATDNICI---VCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKN 378
           +E  AT N CI   +CM E+   +E++ +        KT   +    PC HV H  CL+N
Sbjct: 687 LEHGATGNYCIDCAICMSEVAIYVEDIPE------THKTNPNEYMVTPCAHVFHTECLEN 740

Query: 379 WMERSQTCPICRLPV 393
           WM     CP+CR P+
Sbjct: 741 WMSYKLQCPVCRAPL 755

>TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 42/83 (50%), Gaps = 12/83 (14%)

Query: 317 KTMSPVEL----SATDNI--CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHV 370
           K MS  EL    S+ D+   C +CM E+   +E+V   P+  KV           PCGHV
Sbjct: 683 KPMSAQELMEHGSSVDHTVDCAICMSEVPVYVEDV---PETHKVDLQTYMT---TPCGHV 736

Query: 371 LHLFCLKNWMERSQTCPICRLPV 393
            H  CL+NWM     CP+CR P+
Sbjct: 737 FHTQCLENWMSYKLQCPVCRSPL 759

>AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKL034W (TUL1)
          Length = 753

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 39/75 (52%), Gaps = 9/75 (12%)

Query: 322 VELSATDNICI---VCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKN 378
           +E  A DN C+   +CM EL   +E++   P+  K A    Y     PC H+ H  CL+N
Sbjct: 682 LEHGANDNYCVSCAICMSELAIHVEDI---PETHK-ANIHDYM--VTPCSHLFHTGCLEN 735

Query: 379 WMERSQTCPICRLPV 393
           WM     CP+CR P+
Sbjct: 736 WMSYKLQCPVCRAPL 750

>KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 6/63 (9%)

Query: 331 CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           C +CM E+   +EE+   P+  KV    ++     PC H+ H  CL+NWM     CP+CR
Sbjct: 702 CSICMSEIPVYVEEL---PETHKV---DQHSYMVTPCNHIFHTSCLENWMSYKLQCPVCR 755

Query: 391 LPV 393
            P+
Sbjct: 756 APL 758

>Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034W
           (REAL)
          Length = 759

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 6/63 (9%)

Query: 331 CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           C +CM ++   +EEV   P+  KV    ++     PC HV H  CL+NWM     CP+CR
Sbjct: 700 CAICMSDVPIYIEEV---PETHKV---DQHSYMVTPCNHVFHTPCLENWMSYKLQCPVCR 753

Query: 391 LPV 393
            P+
Sbjct: 754 SPL 756

>Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 6/63 (9%)

Query: 331 CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           C +CM ++   +EE+   P+  KV    ++     PC HV H  CL+NWM     CP+CR
Sbjct: 699 CAICMSDVPIYIEEI---PETHKV---DQHSYMVTPCNHVFHTSCLENWMSYKLQCPVCR 752

Query: 391 LPV 393
            P+
Sbjct: 753 SPL 755

>ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 765

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 6/63 (9%)

Query: 331 CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           C +CM E+   +EEV   P+  KV +         PC H+ H  CL+NWM     CP+CR
Sbjct: 706 CAICMSEVPIRVEEV---PETHKVDEQTYMV---TPCAHIFHTQCLENWMSYKLQCPVCR 759

Query: 391 LPV 393
            P+
Sbjct: 760 SPL 762

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 6/63 (9%)

Query: 331 CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           C +CM ++   +EE+   P+  KV    ++     PC HV H  CL+NWM     CP+CR
Sbjct: 699 CAICMSDVPIYIEEI---PETHKV---DQHSYMVTPCNHVFHTSCLENWMNYKLQCPVCR 752

Query: 391 LPV 393
            P+
Sbjct: 753 SPL 755

>Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 6/63 (9%)

Query: 331 CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           C +CM ++   +EE+   P+  KV    ++     PC HV H  CL+NWM     CP+CR
Sbjct: 699 CTICMSDVPIYIEEI---PETHKV---DQHSYMVTPCDHVFHTSCLENWMSYKLQCPVCR 752

Query: 391 LPV 393
            P+
Sbjct: 753 SPL 755

>NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 331 CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           C +CM E+   +EE       E+     ++     PC H+ H  CL+NWM     CP+CR
Sbjct: 702 CAICMSEVPVYIEEA------EETHNIDQHSYMVTPCDHIFHTDCLENWMGYKLQCPVCR 755

Query: 391 LPV 393
            P+
Sbjct: 756 TPL 758

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 8/72 (11%)

Query: 322 VELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWME 381
           VE ++ D  C +CM  +   ++      D+ +  K  +Y     PC H+ H  CL+NWM 
Sbjct: 696 VETNSVD--CSICMSGIPLYVD------DKPETHKVDQYSYMVTPCNHIFHTECLENWMS 747

Query: 382 RSQTCPICRLPV 393
               CP+CR P+
Sbjct: 748 YKLQCPVCRTPL 759

>TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.545
           YKL034W
          Length = 750

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 331 CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           C +CM E+   ++++      E+     K      PC H+ H  CL+NWM     CP+CR
Sbjct: 691 CTICMSEVPVYIQDI------EETHNIDKDTYMITPCNHIFHTTCLENWMSYKLQCPVCR 744

Query: 391 LPV 393
            P+
Sbjct: 745 APL 747

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 6/63 (9%)

Query: 331 CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           C +CM E+   ++++   P+  KV K         PC H+ H  CL++WM     CP+CR
Sbjct: 691 CAICMSEVAVYVDDI---PETHKVDKDDYMI---TPCSHIFHTQCLESWMSYKLQCPVCR 744

Query: 391 LPV 393
            P+
Sbjct: 745 APL 747

>TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {ON}
           Anc_2.545 YKL034W
          Length = 757

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 6/63 (9%)

Query: 331 CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           C +CM E+   ++++   P+   V +         PC H+ H  CL+NWM     CP+CR
Sbjct: 698 CAICMSEVPVYVKDI---PETHAVDQQSY---MVTPCNHIFHTACLENWMGYKLQCPVCR 751

Query: 391 LPV 393
            P+
Sbjct: 752 APL 754

>KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034W TUL1
           Transmembrane Ubiquitin Ligase
          Length = 757

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 8/74 (10%)

Query: 322 VELSATDN--ICIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNW 379
           +E  + +N  +C +CM ++   +EE       E+  K         PC H+ H  CL+NW
Sbjct: 687 MEYGSQNNCFVCPICMVDVPVYVEET------EETHKIDAQSYMITPCSHIFHTECLENW 740

Query: 380 MERSQTCPICRLPV 393
           M     CP+CR P+
Sbjct: 741 MSYKLQCPVCRAPL 754

>CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034w
          Length = 757

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 6/63 (9%)

Query: 331 CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           C +CM E    +EE+   P+  +V K         PC H+ H  CL++WM     CP+CR
Sbjct: 698 CAICMAEFPVYVEEL---PETHQVDKDSY---MITPCDHMFHTSCLESWMSYKLQCPVCR 751

Query: 391 LPV 393
            P+
Sbjct: 752 SPL 754

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 6/63 (9%)

Query: 331 CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           C +CM+++   ++++       K  K  K      PC H+ H  CL++WM     CP+CR
Sbjct: 688 CAICMNDVPVYVDDI------PKTHKVDKESYMITPCSHIFHTQCLESWMSYKLQCPVCR 741

Query: 391 LPV 393
            P+
Sbjct: 742 APL 744

>NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2.545
           YKL034W
          Length = 762

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 6/60 (10%)

Query: 331 CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           C +CM  +   +EEV      E   K   +     PC H+ H  CL+NWM     CP+CR
Sbjct: 703 CAICMSPVPVYIEEV------EGTHKVDIHSYMVTPCNHIFHTECLENWMGYKLQCPVCR 756

>KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weakly
           similar to uniprot|P22470 Saccharomyces cerevisiae
           YDR143C SAN1 Ubiquitin-protein ligase controls turnover
           of a specific class of unstable nuclear proteins
           including Sir4p but not Sir2p or Sir3p san1 mutations
           suppress sir4 spt16 and cdc68 mutations suggesting a
           role in chromatin silencing
          Length = 603

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 7/57 (12%)

Query: 349 PDREKVAKTG-------KYKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENG 398
           P +E  A T        K+ P +LPCGH+    C++ W     TCPICR  +   +G
Sbjct: 206 PPKENEADTNNQESIAYKHSPLKLPCGHIFGRECIRQWTNEHNTCPICRARIVGADG 262

>Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON}
           (19006..21270) [2265 nt, 755 aa]
          Length = 754

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 331 CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           C +CM E+   +++V   P   KV           PC HV H  CL+NWM     CP+CR
Sbjct: 695 CAICMSEVPVYVDDV---PTTHKVDLDSF---MITPCNHVFHTQCLENWMGYKLQCPVCR 748

Query: 391 LPV 393
            P+
Sbjct: 749 APL 751

>Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON}
           YDR143C (REAL)
          Length = 612

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%)

Query: 342 LEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           L +    P+ E+   + K+ P +LPCGH+    C+  W +   +CP+CR
Sbjct: 231 LADQPHAPNDEETNPSYKHSPIKLPCGHIFGRECIYKWSKLENSCPLCR 279

>Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {ON}
           YDR143C (SAN1) - (putative) transcriptional regulator
           [contig 171] FULL
          Length = 589

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 40/95 (42%), Gaps = 9/95 (9%)

Query: 304 RIWQNNKQLDDKLKTMSPVELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGKYKPK 363
           R  Q+  ++DD+          A D        E     +    G D+ KV  T K+ P 
Sbjct: 173 RYEQDESEVDDQ-------NGPANDGETASSPPEQEQPKDNENSGDDQGKV--TYKHSPV 223

Query: 364 RLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENG 398
           +LPC HV    C++ W     TCPICR  +   +G
Sbjct: 224 QLPCSHVFGRECIRQWTNLHNTCPICRANIVGADG 258

>SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 751

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 331 CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           C +CM ++   + ++      E+  K         PCGH+ H  CL++WM     CP+CR
Sbjct: 692 CAICMTDVPIYVSDI------EETHKVDINSYMVTPCGHIFHTQCLESWMSYKLQCPVCR 745

Query: 391 LPV 393
            P+
Sbjct: 746 APL 748

>KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 704

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 18/32 (56%)

Query: 365 LPCGHVLHLFCLKNWMERSQTCPICRLPVFDE 396
           LPCGHV    CL  W     +CPICR P+  E
Sbjct: 217 LPCGHVFGRECLYKWTTEHNSCPICRAPILSE 248

>Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 bp,
           657 aa] {ON} similar to Ashbya gossypii AGL191W 1-intron
          Length = 657

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/180 (20%), Positives = 71/180 (39%), Gaps = 35/180 (19%)

Query: 248 GLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLC----QIVSSLW 303
           G+  +F   RV   F+ F      +   +P +     + ++  D+ ++C    +  +S+W
Sbjct: 139 GIAAQFAVSRVTRRFSLFRGLSKESFEKLPLKS----LNEINGDICSICYEDFEDDASVW 194

Query: 304 RIWQNNKQLDDKLKTM---------SPVELSATDNICIVCMDELCADLEEVVQ------- 347
              + N+ LD +   +         +P++  +     +   +   A   EV +       
Sbjct: 195 --SKRNRSLDGETSVVKRQRVEGNSTPLQNPSRSTPSVQSPEAADAGTNEVSEVSASGPF 252

Query: 348 -----GPDREKVAKTGK--YK--PKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENG 398
                 PD      + +  YK  P  LPCGH+    C+  W +   +CPICR  + ++ G
Sbjct: 253 APGADAPDTPAPETSNQMDYKHCPTELPCGHIFGRDCIFKWTKEHNSCPICRSRIVEDEG 312

>Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON}
           YDR143C (REAL)
          Length = 624

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%)

Query: 352 EKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           E+   + K+ P RLPCGHV    CL  W     +CP+CR
Sbjct: 260 EETNPSYKHSPIRLPCGHVFGRECLYKWSRLENSCPLCR 298

>TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON} 
          Length = 260

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 39/94 (41%), Gaps = 15/94 (15%)

Query: 315 KLKTMSPVELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRL--------P 366
           +L+  +P EL+  D  C +C++ L     + +   D  +V   G    K +        P
Sbjct: 125 ELEKRNPNELANDDETCCICLELLKTQEYDTITTQDGMRVKTKGGPPTKSIKDTDIVMIP 184

Query: 367 CGHVLHLFCLKNWM-------ERSQTCPICRLPV 393
           C H  H  CLK W         R   CP+CR+ +
Sbjct: 185 CQHYFHAGCLKEWFSPQRRGKRRPLVCPLCRMDI 218

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 33/81 (40%), Gaps = 16/81 (19%)

Query: 314 DKLKTMSPVELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHL 373
           D L  +    L+  DN  I C   L  +   VV+ P+                CGH   L
Sbjct: 74  DTLPRVPKKRLAEGDNCAICCCGYLEDEYPLVVELPN----------------CGHTFDL 117

Query: 374 FCLKNWMERSQTCPICRLPVF 394
            C+  W+ RS TCP+CR  V 
Sbjct: 118 QCVSVWLSRSTTCPMCRSDVL 138

>Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON}
           YDR143C (REAL)
          Length = 634

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%)

Query: 349 PDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           P+ E+   + K+ P +LPCGH+    C+  W     +CP+CR
Sbjct: 249 PNDEETNPSYKHSPIKLPCGHIFGRECIYKWSRLENSCPLCR 290

>NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317
          Length = 570

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%)

Query: 352 EKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           E+   T  + P +LPCGH+    CL  W +   TCP+CR
Sbjct: 220 EEAHPTYNHSPTKLPCGHIFGRECLYRWCKLENTCPLCR 258

>SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, 599
           aa] {ON} some similarities with uniprot|P22470
           Saccharomyces cerevisiae YDR143C SAN1 Ubiquitin-protein
           ligase controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 599

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 63/174 (36%), Gaps = 36/174 (20%)

Query: 257 RVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLC---------------QIVSS 301
           R+     RF      A   +P    +  +KDV  +V ++C                    
Sbjct: 109 RLTRRLQRFRGVGKEAFEALP----VKRLKDVHGEVCSICYDNFEEENEEEAKEEVNEDD 164

Query: 302 LWRIWQN--NKQLDDKLKTMSPVELSATDNICI-----VCMDELCADL-EEVVQGPD--- 350
           +    QN  +K L  K +     E    DN+ +     V  +E  +   E++ Q P    
Sbjct: 165 IKSREQNTKDKTLKSKKRARGEHEKEEEDNLNVKKQRSVGPEEGSSSTGEQLQQEPHTLA 224

Query: 351 ------REKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENG 398
                 +EK +   K+ P +L CGH     C+  W +   +CPICR  +    G
Sbjct: 225 NIVEEHKEKPSPEYKHSPTQLKCGHRFGRMCIYQWTKEHNSCPICRAEIVGREG 278

>KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {ON}
           Anc_8.317 YDR143C
          Length = 643

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%)

Query: 352 EKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGN 399
           E    T  + P +LPCGH+    CL  W +   TCP+CR  + + N N
Sbjct: 289 ENEVPTYSHSPLKLPCGHIFGRECLFKWSKVENTCPLCRHVIIENNQN 336

>SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]
           {ON} weakly similar to uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 544

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 349 PDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENG 398
           P +E    T K+ P  L CGHV    C+  W + + +CPICR  +    G
Sbjct: 214 PKKEHTP-TYKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREG 262

>YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}
           SAN1Ubiquitin-protein ligase; involved in the
           proteasome-dependent degradation of aberrant nuclear
           proteins; targets substrates with regions of exposed
           hydrophobicity containing 5 or more contiguous
           hydrophobic residues; contains intrinsically disordered
           regions that contribute to substrate recognition
          Length = 610

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%)

Query: 352 EKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           E+   + K+ P +LPCGH+    C+  W     +CP+CR
Sbjct: 242 EETNPSYKHSPIKLPCGHIFGRECIYKWSRLENSCPLCR 280

>TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.279
           YBR062C
          Length = 144

 Score = 39.7 bits (91), Expect = 0.005,   Method: Composition-based stats.
 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 364 RLP-CGHVLHLFCLKNWMERSQTCPICRLPVFDENGNV 400
           RLP CGH   L CL  W  +S +CP+CR  V      V
Sbjct: 92  RLPHCGHDFDLECLSVWFSKSTSCPLCRDDVLSHRAEV 129

>Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {ON}
           YBR062C - Hypothetical ORF [contig 35] FULL
          Length = 104

 Score = 38.5 bits (88), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 365 LP-CGHVLHLFCLKNWMERSQTCPICRLPVFDENGNV 400
           LP C H   L C+  W+ +S+TCP+CR  V     NV
Sbjct: 53  LPHCNHRFDLECVAVWLSKSRTCPLCRDDVLSHKPNV 89

>CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143c SAN1 mating-type regulation protein
          Length = 717

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 360 YKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           + P ++PCGH+    CL  W     +CP+CR
Sbjct: 288 HSPVKIPCGHIFGRSCLYEWTRLENSCPLCR 318

>YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, 180
           aa] {ON} Protein of unknown function that interacts with
           Msb2p; may play a role in activation of the filamentous
           growth pathway.
          Length = 180

 Score = 39.3 bits (90), Expect = 0.010,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 32/75 (42%), Gaps = 16/75 (21%)

Query: 316 LKTMSPVELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFC 375
           L  ++  +L ATDN  I   + L  +   VV+ P                 C H   L C
Sbjct: 95  LPRINKKKLKATDNCSICYTNYLEDEYPLVVELPH----------------CHHKFDLEC 138

Query: 376 LKNWMERSQTCPICR 390
           L  W+ RS TCP+CR
Sbjct: 139 LSVWLSRSTTCPLCR 153

>KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON}
           Anc_3.28 YOL133W
          Length = 118

 Score = 38.1 bits (87), Expect = 0.011,   Method: Composition-based stats.
 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 12/71 (16%)

Query: 326 ATDNICIVCMD---ELCADLE-EVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWME 381
           A DN C +C +   E C + + + +  PD E VA  G        C H  HL C+  W++
Sbjct: 48  AVDN-CAICRNHIMEPCIECQPKAMTDPDNECVAAWGV-------CNHAFHLHCINKWIK 99

Query: 382 RSQTCPICRLP 392
               CP+   P
Sbjct: 100 TRDACPLDNQP 110

>KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28
           YOL133W
          Length = 114

 Score = 37.7 bits (86), Expect = 0.011,   Method: Composition-based stats.
 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 12/71 (16%)

Query: 326 ATDNICIVCMD---ELCADLE-EVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWME 381
           A DN C +C +   E C + + + +   D E VA  G        CGH  HL C+  W++
Sbjct: 44  AVDN-CAICRNHIMEPCIECQPKAMTDTDNECVAAWGA-------CGHAFHLHCINKWIK 95

Query: 382 RSQTCPICRLP 392
               CP+   P
Sbjct: 96  TRDACPLDNQP 106

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 38.9 bits (89), Expect = 0.012,   Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 16/68 (23%)

Query: 323 ELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMER 382
           +L++TDN  I   + L  +   VV+ P                 C H   L CL  W+ R
Sbjct: 100 KLNSTDNCSICYTNYLEDEYPLVVELPH----------------CNHRFDLECLSVWLSR 143

Query: 383 SQTCPICR 390
           S TCP+CR
Sbjct: 144 STTCPLCR 151

>KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {ON}
           Anc_8.317 YDR143C
          Length = 688

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 360 YKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           + P +LPCGH+    C+  W     +CP+CR
Sbjct: 333 HSPTKLPCGHIFGRDCIFKWSHLENSCPLCR 363

>CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {ON}
           similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265w peroxisomal assembly protein - peroxin
          Length = 328

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 362 PKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           P  LPCGHV    C+ +W + +  CP+CR
Sbjct: 287 PSCLPCGHVFCWDCITDWTKENPECPLCR 315

>NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa]
           {ON} Anc_3.405 YPR093C
          Length = 428

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 18/65 (27%)

Query: 328 DNICIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQT-- 385
           DNIC +C D+L  +  +++QG              K  PC H  H  C++ W   S    
Sbjct: 9   DNICPICFDDL--NDTDILQG--------------KLKPCNHKYHYDCIRRWHGYSDNSD 52

Query: 386 CPICR 390
           CP+CR
Sbjct: 53  CPLCR 57

>Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 bp,
           150 aa] {ON} YBR062C (REAL)
          Length = 150

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 365 LP-CGHVLHLFCLKNWMERSQTCPICR 390
           LP C H   L CL  W+ RS TCP+CR
Sbjct: 97  LPHCHHKFDLECLSVWLSRSTTCPLCR 123

>NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {ON}
           Anc_5.628 YDR265W
          Length = 341

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 362 PKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDE 396
           P   PCGH+    CL +W +    CP+CR P   +
Sbjct: 300 PSCSPCGHIFCWRCLMDWCQERAECPLCRQPCLPQ 334

>TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.317
           YDR143C
          Length = 781

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 16/31 (51%)

Query: 360 YKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           + P  LPC H+    CL  W     TCP+CR
Sbjct: 274 HSPTELPCKHIFGRECLYKWTRVQNTCPLCR 304

>Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON}
           (60008..60319) [312 nt, 104 aa]
          Length = 103

 Score = 36.2 bits (82), Expect = 0.029,   Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%)

Query: 364 RLP-CGHVLHLFCLKNWMERSQTCPICR 390
           +LP CGH     CL  W+ +++TCP+CR
Sbjct: 51  KLPHCGHNFDYECLSIWLSKNKTCPMCR 78

>CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa]
           {ON} similar to uniprot|P38748 Saccharomyces cerevisiae
           YHL010c
          Length = 586

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 2/30 (6%)

Query: 365 LPCGHVLHLFCLKNWMERSQTCPICRLPVF 394
           +PC H  H  CL  W  ++  CP+CRL  F
Sbjct: 264 IPCQHTFHCQCLDKW--KNSKCPVCRLSSF 291

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 37.4 bits (85), Expect = 0.037,   Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 364 RLP-CGHVLHLFCLKNWMERSQTCPICR 390
           +LP CGH+  L C+  W+    TCP+CR
Sbjct: 109 QLPHCGHIFDLQCISMWLSNQVTCPMCR 136

>TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.405
           YPR093C
          Length = 384

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 31/77 (40%), Gaps = 21/77 (27%)

Query: 317 KTMSPVELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCL 376
           K + P +L+   +IC +C+D +                    K   K  PC H  H+ C+
Sbjct: 5   KPIKPTKLTMVSSICAICLDAI-------------------DKSIAKLEPCNHKYHIDCI 45

Query: 377 KNWMERSQ--TCPICRL 391
           + W   S    CP CR+
Sbjct: 46  RTWHNYSNDLNCPTCRI 62

>ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import,
           interacts with Pex12p, links ubiquitin-conjugating Pex4p
           to protein import machinery; mutations in human homolog
           cause a variety of peroxisomal disorders
          Length = 368

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 30/70 (42%), Gaps = 22/70 (31%)

Query: 321 PVELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWM 380
           P   SA+ N CI+C++E+                       P   PCGH+    C+ NW 
Sbjct: 309 PFIPSASRN-CILCLNEMT---------------------DPSCPPCGHLFCWACIMNWC 346

Query: 381 ERSQTCPICR 390
           +  + CP+CR
Sbjct: 347 KEREECPLCR 356

>Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}
           YBR062C (REAL)
          Length = 185

 Score = 37.4 bits (85), Expect = 0.039,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 365 LP-CGHVLHLFCLKNWMERSQTCPICR 390
           LP C H   L CL  W+ RS TCP+CR
Sbjct: 132 LPHCHHKFDLECLSVWLSRSTTCPLCR 158

>TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [978
           bp, 325 aa] {ON} Anc_5.628 YDR265W
          Length = 325

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 362 PKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           P   PCGH+    CL NW +  + CP+CR
Sbjct: 285 PSCAPCGHIYCWNCLINWCKEKEECPLCR 313

>Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON}
           (83624..84610) [987 nt, 329 aa]
          Length = 328

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 362 PKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           P   PCGH+    C+ NW +    CP+CR
Sbjct: 288 PSAAPCGHIFCWDCIINWCKERPECPLCR 316

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 37.0 bits (84), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 365 LP-CGHVLHLFCLKNWMERSQTCPICRLPVFDENGNV 400
           LP CGH   L C+  W+ +S TCP+CR  V     ++
Sbjct: 122 LPHCGHRFDLECISVWLSKSDTCPLCRDSVLSHKTDI 158

>NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317
          Length = 661

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 360 YKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           + P +LPC H+    CL  W +   +CP+CR
Sbjct: 239 HSPVKLPCDHIFGRECLYKWSKLENSCPLCR 269

>KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459
           bp, 152 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 152

 Score = 36.6 bits (83), Expect = 0.053,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 364 RLP-CGHVLHLFCLKNWMERSQTCPICRLPVFDENGNV 400
           +LP C H   L C+  W+ +S+TCP+CR  V      V
Sbjct: 100 KLPHCSHRFDLECVAVWLSKSRTCPLCRDDVLSHKPKV 137

>ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 780

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 360 YKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           + P +LPC H+    CL  W +   +CP+CR
Sbjct: 296 HSPVQLPCAHIFGRECLDKWSQIENSCPLCR 326

>TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {ON}
           Anc_8.317 YDR143C
          Length = 554

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 36/83 (43%), Gaps = 17/83 (20%)

Query: 312 LDDKLKTMSPV----ELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPC 367
           L  K ++ SPV    E S++        DE       V++ P       T K+ P  LPC
Sbjct: 172 LQKKQRSESPVVVPTEQSSSQ------QDENTEQAPNVMEPP-------TYKHSPVVLPC 218

Query: 368 GHVLHLFCLKNWMERSQTCPICR 390
            HV    CL  W +   +CP+CR
Sbjct: 219 NHVFGRECLFKWSQLENSCPLCR 241

>CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483)
           [528 bp, 175 aa] {ON} similar to uniprot|P38239
           Saccharomyces cerevisiae YBR062c
          Length = 175

 Score = 36.6 bits (83), Expect = 0.071,   Method: Composition-based stats.
 Identities = 19/71 (26%), Positives = 29/71 (40%), Gaps = 17/71 (23%)

Query: 321 PVELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLP-CGHVLHLFCLKNW 379
           P +   +D+ C +C     AD   +V                  LP CGH     C+  W
Sbjct: 94  PQKKLKSDDTCPICCSNFIADEYPLVV----------------ELPHCGHKFDFECVSMW 137

Query: 380 MERSQTCPICR 390
           + ++ TCP+CR
Sbjct: 138 LTKNTTCPMCR 148

>Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa]
           {ON} complement(182540..184546) [2007 nt, 669 aa]
          Length = 668

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 15/29 (51%)

Query: 362 PKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           P  LPC H+    CL  W     TCP+CR
Sbjct: 259 PVELPCHHIFGRECLYKWTRHENTCPLCR 287

>CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133w HRT1
           RING-box protein
          Length = 102

 Score = 35.0 bits (79), Expect = 0.093,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 12/71 (16%)

Query: 326 ATDNICIVCMD---ELCADLE-EVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWME 381
           A DN C +C +   E C + + + +   D E VA  G        C H  HL C+  W++
Sbjct: 32  AVDN-CAICRNHIMEPCIECQPKAMTDTDNECVAAWGT-------CNHAFHLHCINKWIK 83

Query: 382 RSQTCPICRLP 392
               CP+   P
Sbjct: 84  TRDACPLDNQP 94

>SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import
          Length = 321

 Score = 37.0 bits (84), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 362 PKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           P   PCGH+    C+ NW +    CP+CR
Sbjct: 281 PSCAPCGHIFCWNCIINWCKERSECPLCR 309

>TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.279
           YBR062C
          Length = 175

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%)

Query: 364 RLP-CGHVLHLFCLKNWMERSQTCPICR 390
           +LP CGH     C+  W+ +++TCPICR
Sbjct: 123 QLPHCGHHFDFECISIWLSKNETCPICR 150

>ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR093C
          Length = 328

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 3/29 (10%)

Query: 365 LPCGHVLHLFCLKNWME---RSQTCPICR 390
           +PCGH  HL C++ W      +++CP+CR
Sbjct: 33  MPCGHEYHLACIRKWFHLHSGNRSCPVCR 61

>KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 329

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 362 PKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           P   PCGH+    CL NW +    CP+CR
Sbjct: 289 PSCAPCGHLFCWDCLLNWSKERPECPLCR 317

>NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON} 
          Length = 252

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 45/107 (42%), Gaps = 29/107 (27%)

Query: 312 LDDKLKTMSPVELSATDN------ICIVCMDEL-----CADLEEVVQGPDREKVAKTGKY 360
           +D K+     VE+S  D+       CI+C++ +       DLE+   G   E+       
Sbjct: 124 MDKKIPIDRFVEMSTKDDRIPINECCIICLERVKVVPSTNDLEKQQNG--TEQTTDMIPS 181

Query: 361 KPKRLPCGHVLHLFCLKNWME------RSQT----------CPICRL 391
           K  +LPC H  H  C+K+W        +S T          CP+CRL
Sbjct: 182 KVVKLPCEHYFHKCCIKDWFSTIRKGMKSSTHSFAIGPTYFCPLCRL 228

>NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28
          Length = 109

 Score = 34.7 bits (78), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 12/71 (16%)

Query: 326 ATDNICIVCMD---ELCADLE-EVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWME 381
           A DN C +C +   E C + + + +   D E VA  G        C H  HL C+  W++
Sbjct: 39  AVDN-CAICRNHIMEPCIECQPKAMTDTDNECVAAWGT-------CNHAFHLHCINKWIK 90

Query: 382 RSQTCPICRLP 392
               CP+   P
Sbjct: 91  TRDACPLDNQP 101

>NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28
           YOL133W
          Length = 123

 Score = 34.7 bits (78), Expect = 0.15,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 12/71 (16%)

Query: 326 ATDNICIVCMD---ELCADLE-EVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWME 381
           A DN C +C +   E C + + + +   D E VA  G        C H  HL C+  W++
Sbjct: 53  AVDN-CAICRNHIMEPCIECQPKAMTDTDNECVAAWGV-------CNHAFHLHCINKWIQ 104

Query: 382 RSQTCPICRLP 392
               CP+   P
Sbjct: 105 TRDACPLDNQP 115

>Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W
           (PEX10) - C3HC4 zinc-binding integral peroxisomal
           membrane protein [contig 157] PARTIAL
          Length = 152

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 17/36 (47%)

Query: 362 PKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDEN 397
           P   PCGHV    CL +W      CP+CR     +N
Sbjct: 112 PSCAPCGHVFCWKCLLSWCNERPECPLCRQTCHAQN 147

>Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 34.7 bits (78), Expect = 0.15,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 12/71 (16%)

Query: 326 ATDNICIVCMD---ELCADLE-EVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWME 381
           A DN C +C +   E C + + + +   D E VA  G        C H  HL C+  W++
Sbjct: 51  AVDN-CAICRNHIMEPCIECQPKAMTDTDNECVAAWGV-------CNHAFHLHCINKWIK 102

Query: 382 RSQTCPICRLP 392
               CP+   P
Sbjct: 103 TRDACPLDNQP 113

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 2/30 (6%)

Query: 365 LPCGHVLHLFCLKNWMERSQTCPICRLPVF 394
           +PC H  H  CL  W  ++  CP+CR   F
Sbjct: 258 IPCQHTFHCQCLDKW--KNSQCPVCRYSSF 285

>TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28
           YOL133W
          Length = 118

 Score = 34.7 bits (78), Expect = 0.17,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 12/71 (16%)

Query: 326 ATDNICIVCMD---ELCADLEEV-VQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWME 381
           A DN C +C +   E C + + + +   D E VA  G        C H  HL C+  W++
Sbjct: 48  AVDN-CAICRNHIMEPCIECQPLAMTDTDNECVAAWGT-------CNHAFHLHCINKWIK 99

Query: 382 RSQTCPICRLP 392
               CP+   P
Sbjct: 100 TRDACPLDNQP 110

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 2/30 (6%)

Query: 365 LPCGHVLHLFCLKNWMERSQTCPICRLPVF 394
           +PC H  H  CL  W  ++  CPICR    
Sbjct: 300 IPCQHTFHCQCLNKW--KNSKCPICRFSTL 327

>Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W
           (REAL)
          Length = 122

 Score = 34.3 bits (77), Expect = 0.19,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 12/71 (16%)

Query: 326 ATDNICIVCMD---ELCADLE-EVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWME 381
           A DN C +C +   E C + + + +   D E VA  G        C H  HL C+  W++
Sbjct: 52  AVDN-CAICRNHIMEPCIECQPKAMTDTDNECVAAWGV-------CNHAFHLHCINKWIK 103

Query: 382 RSQTCPICRLP 392
               CP+   P
Sbjct: 104 TRDACPLDNQP 114

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 35.0 bits (79), Expect = 0.20,   Method: Composition-based stats.
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 365 LP-CGHVLHLFCLKNWMERSQTCPICRLPVFDE 396
           LP C H   L CL  W+ ++ TCP+CR  V ++
Sbjct: 104 LPHCSHRFDLECLTPWLLKNSTCPLCRDDVMEK 136

>Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp,
           320 aa] {ON} similar to Ashbya gossypii AER390W
           1-intron
          Length = 320

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 362 PKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           P  LPCGH+    C+ +W      CP+CR
Sbjct: 280 PSCLPCGHLFCWNCIMHWCTERSECPLCR 308

>AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR265W (PEX10); 1-intron
          Length = 316

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 15/29 (51%)

Query: 362 PKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           P  LPCGH+    C+  W      CP+CR
Sbjct: 276 PSCLPCGHMFCWACVMQWCNERNECPLCR 304

>YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING finger
           containing subunit of Skp1-Cullin-F-box ubiquitin
           protein ligases (SCF); required for Gic2p, Far1p, Sic1p
           and Cln2p degradation; may tether Cdc34p (a ubiquitin
           conjugating enzyme or E2) and Cdc53p (a cullin) subunits
           of SCF
          Length = 121

 Score = 34.3 bits (77), Expect = 0.22,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 12/71 (16%)

Query: 326 ATDNICIVCMD---ELCADLE-EVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWME 381
           A DN C +C +   E C + + + +   D E VA  G        C H  HL C+  W++
Sbjct: 51  AVDN-CAICRNHIMEPCIECQPKAMTDTDNECVAAWGV-------CNHAFHLHCINKWIK 102

Query: 382 RSQTCPICRLP 392
               CP+   P
Sbjct: 103 TRDACPLDNQP 113

>KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}
           Anc_5.628 YDR265W
          Length = 327

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 1/46 (2%)

Query: 346 VQGPDREKVAKTGK-YKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           +QG  R  +    K   P   PCGH+    C+ NW      CP+CR
Sbjct: 270 IQGASRTCILCLSKIVDPSCAPCGHLYCWDCILNWCNEKPECPLCR 315

>Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON}
           complement(29615..29938) [324 nt, 108 aa]
          Length = 107

 Score = 33.9 bits (76), Expect = 0.24,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 12/71 (16%)

Query: 326 ATDNICIVCMD---ELCADLE-EVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWME 381
           A DN C +C +   E C + +   +   D E VA  G        C H  HL C+  W++
Sbjct: 37  AVDN-CAICRNHIMEPCIECQPNAMTETDNECVAAWGT-------CNHAFHLHCINKWIK 88

Query: 382 RSQTCPICRLP 392
               CP+   P
Sbjct: 89  TRDACPLDNQP 99

>KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 305

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 15/29 (51%)

Query: 362 PKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           P   PCGH+    C+  W    Q CP+CR
Sbjct: 265 PSATPCGHLFCWDCIMEWTLERQECPLCR 293

>TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {ON}
           Anc_3.28 YOL133W
          Length = 122

 Score = 34.3 bits (77), Expect = 0.25,   Method: Composition-based stats.
 Identities = 20/71 (28%), Positives = 32/71 (45%), Gaps = 12/71 (16%)

Query: 326 ATDNICIVCMD---ELCADLE-EVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWME 381
           A DN C +C +   E C + + + +   D + VA  G        C H  HL C+  W++
Sbjct: 52  AVDN-CAICRNHIMEPCIECQPKAMTDTDTDCVAAWGT-------CNHAFHLHCINKWIK 103

Query: 382 RSQTCPICRLP 392
             + CP+   P
Sbjct: 104 TREACPLDNQP 114

>Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 33.9 bits (76), Expect = 0.26,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 12/71 (16%)

Query: 326 ATDNICIVCMD---ELCADLE-EVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWME 381
           A DN C +C +   E C + + + +   D E VA  G        C H  HL C+  W++
Sbjct: 51  AVDN-CAICRNHIMEPCIECQPKAMTDTDNECVAAWGV-------CNHAFHLHCINKWIK 102

Query: 382 RSQTCPICRLP 392
               CP+   P
Sbjct: 103 TRDACPLDNQP 113

>KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {ON}
           Anc_3.405 YPR093C
          Length = 102

 Score = 33.5 bits (75), Expect = 0.27,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 29/74 (39%), Gaps = 27/74 (36%)

Query: 325 SATDNICIVCMDELCADLEEVVQGPDREKVAKTGKYKP--KRLPCGHVLHLFCLKNWME- 381
           +AT   C +CM+E+                   G ++P  + LPC H  H  C++ W   
Sbjct: 4   TATVTECPICMEEI-------------------GPHEPLGELLPCHHKFHSDCIRKWHTT 44

Query: 382 -----RSQTCPICR 390
                R   CP CR
Sbjct: 45  TTGEIRRPLCPFCR 58

>ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {ON}
           highly similar to uniprot|Q08273 Saccharomyces
           cerevisiae YOL133W HRT1 RING finger containing subunit
           of Skp1-Cullin-F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 116

 Score = 33.9 bits (76), Expect = 0.27,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 12/71 (16%)

Query: 326 ATDNICIVCMD---ELCADLEEV-VQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWME 381
           A DN C +C +   E C + + + +   D E VA  G        C H  HL C+  W++
Sbjct: 46  AVDN-CAICRNHIMEPCIECQPMAMTDTDNECVAAWGV-------CNHAFHLHCINKWIK 97

Query: 382 RSQTCPICRLP 392
               CP+   P
Sbjct: 98  TRDACPLDNQP 108

>KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133W HRT1
           RING finger containing subunit of Skp1-Cullin- F-box
           ubiquitin protein ligases (SCF) required for Gic2p Far1p
           Sic1p and Cln2p degradation may tether Cdc34p (a
           ubiquitin conjugating enzyme or E2) and Cdc53p (a
           cullin) subunits of SCF
          Length = 110

 Score = 33.5 bits (75), Expect = 0.30,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 12/69 (17%)

Query: 328 DNICIVCMD---ELCADLE-EVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERS 383
           DN C +C +   E C + + E     + E VA  G+       C H  HL C+  W++  
Sbjct: 42  DN-CAICRNHIMEPCVNCQQEATFNSEHECVAAWGE-------CNHAFHLHCITQWIKSR 93

Query: 384 QTCPICRLP 392
             CP+   P
Sbjct: 94  NVCPLDNKP 102

>KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa]
           {ON} Anc_2.542 YHL010C
          Length = 507

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 2/30 (6%)

Query: 365 LPCGHVLHLFCLKNWMERSQTCPICRLPVF 394
           +PC H  H  CL  W  ++  CP+CR   F
Sbjct: 188 IPCQHTFHCQCLNRW--KNSKCPVCRYSSF 215

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 36/83 (43%), Gaps = 17/83 (20%)

Query: 314 DKLKTMSPVELSATDNICIVCMDELCADLE-EVVQGPDREKVAKTGKYKPKRLPCGHVLH 372
           ++L   +  ELS + + C +C      D E E+   P+                C H  H
Sbjct: 193 EQLPRTNCAELSNSSDECPICRIAYSDDFETEITCLPN----------------CSHHFH 236

Query: 373 LFCLKNWMERSQTCPICRLPVFD 395
             C+K W++++  CP+CR  V +
Sbjct: 237 FECIKLWLQKNSLCPLCRDNVME 259

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 365 LPCGHVLHLFCLKNWMERSQTCPICR 390
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 258 IPCSHTFHCQCLDKW--KNSKCPVCR 281

>NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON}
           Anc_2.542
          Length = 572

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 24/84 (28%)

Query: 307 QNNKQLDDKLKTMSPVELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLP 366
           + N+Q   K+K  +PVEL      C VC+++L  +   ++                  +P
Sbjct: 219 EQNEQNKMKVKK-NPVELPT----CPVCLEQLDCETTGLI-----------------TIP 256

Query: 367 CGHVLHLFCLKNWMERSQTCPICR 390
           C H  H  CL  W  ++  CP+CR
Sbjct: 257 CQHTFHCQCLDKW--KNSRCPVCR 278

>CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some
            similarities with uniprot|Q06554 Saccharomyces cerevisiae
            YLR247c
          Length = 1470

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 18/27 (66%)

Query: 367  CGHVLHLFCLKNWMERSQTCPICRLPV 393
            CGH+    C+ +W++  +TCP+C+ P 
Sbjct: 1179 CGHLFCTSCIFSWLKNRKTCPLCKHPT 1205

>YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}
           PEX10Peroxisomal membrane E3 ubiquitin ligase, required
           for for Ubc4p-dependent Pex5p ubiquitination and
           peroxisomal matrix protein import; contains zinc-binding
           RING domain; mutations in human homolog cause various
           peroxisomal disorders
          Length = 337

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 362 PKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           P   PCGH+    CL +W +    CP+CR
Sbjct: 296 PSCAPCGHLFCWSCLMSWCKERPECPLCR 324

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 364 RLP-CGHVLHLFCLKNWMERSQTCPICR 390
           +LP C H   L C+  W+ +S TCP+CR
Sbjct: 107 KLPNCNHKFDLQCITLWLSKSSTCPMCR 134

>KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1.389
            YLR247C
          Length = 1493

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 17/26 (65%)

Query: 365  LPCGHVLHLFCLKNWMERSQTCPICR 390
            + CGH     C+ +W++  +TCPIC+
Sbjct: 1190 MKCGHFFCRDCIHSWLKNQRTCPICK 1215

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 34.3 bits (77), Expect = 0.41,   Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 365 LP-CGHVLHLFCLKNWMERSQTCPICR 390
           LP C H   L C+  W+ +S +CP+CR
Sbjct: 121 LPHCNHKFDLECISVWLSKSTSCPLCR 147

>Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 362 PKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           P   PCGH+    CL +W +    CP+CR
Sbjct: 296 PSCTPCGHLFCWNCLMSWCKERPECPLCR 324

>Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 362 PKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           P   PCGH+    CL +W +    CP+CR
Sbjct: 296 PSCTPCGHLFCWDCLMSWCKERPECPLCR 324

>Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 362 PKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           P   PCGH+    CL +W +    CP+CR
Sbjct: 296 PSCAPCGHLFCWDCLMSWCKERPECPLCR 324

>Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON}
           complement(21450..23126) [1677 nt, 559 aa]
          Length = 558

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 365 LPCGHVLHLFCLKNWMERSQTCPICR 390
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 252 IPCQHTFHCQCLDKW--KNSKCPVCR 275

>Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig
           55] FULL
          Length = 660

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 366 PCGHVLHLFCLKNWMERSQTCPICRLPVFD 395
           PCGH +H  C   + + S  CP C++ V +
Sbjct: 405 PCGHAIHQHCFDEYTKHSYKCPSCQVSVLN 434

>SAKL0A09526g Chr1 (834338..836326) [1989 bp, 662 aa] {ON} conserved
           hypothetical protein
          Length = 662

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 366 PCGHVLHLFCLKNWMERSQTCPICRLPVFD 395
           PCGH +H  C   + + S  CP C++ V +
Sbjct: 399 PCGHAIHQHCFDEYTKHSYKCPHCQVTVLN 428

>Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON}
           similar to Ashbya gossypii ABR104W
          Length = 321

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 8/47 (17%)

Query: 362 PKRLPCGHVLHLFCLKNWME---RSQTCPICRLPV-----FDENGNV 400
            K +PC H  HL C++ W       +TCP CR+ +      D N N+
Sbjct: 21  AKLIPCQHEFHLSCIRKWYHSRISDRTCPNCRVEIRELIDMDHNVNI 67

>TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa]
           {ON} Anc_5.628 YDR265W
          Length = 326

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 362 PKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           P   PCGH+    C+ +W +    CP+CR
Sbjct: 286 PSCAPCGHIFCWDCILSWCKERPECPLCR 314

>TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1.389
            YLR247C
          Length = 1452

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 2/29 (6%)

Query: 365  LPCGHVLHLFCLKNWMERS--QTCPICRL 391
            L CGH     C+ NW+E+S  + CPIC++
Sbjct: 1150 LKCGHYYCQDCIWNWLEKSKKKNCPICKI 1178

>ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38748 YHL010C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 365 LPCGHVLHLFCLKNWMERSQTCPICR 390
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 251 IPCQHTFHCQCLDKW--KNSKCPVCR 274

>Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa]
           {ON} YOL133W (HRT1) - subunit of Skp1-Cullin-F-box
           ubiquitin protein ligase (SCF) [contig 124] FULL
          Length = 111

 Score = 32.7 bits (73), Expect = 0.54,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 22/62 (35%), Gaps = 14/62 (22%)

Query: 331 CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           CI C      D        D E VA  G        C H  HL C+  W++    CP+  
Sbjct: 56  CIQCQPTAMTD-------TDNECVAAWGT-------CNHAFHLHCINKWLQTRNACPLDN 101

Query: 391 LP 392
            P
Sbjct: 102 QP 103

>Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 365 LPCGHVLHLFCLKNWMERSQTCPICR 390
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5.628
           YDR265W
          Length = 330

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 362 PKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           P   PCGH+    C+ +W +    CP+CR
Sbjct: 290 PSCSPCGHIFCWECILDWCKERPECPLCR 318

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 15/24 (62%)

Query: 367 CGHVLHLFCLKNWMERSQTCPICR 390
           C H   L CL  W++ + TCP+CR
Sbjct: 92  CNHKFDLECLSIWLQNNHTCPMCR 115

>YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}
           ETP1Putative protein of unknown function that is
           required for growth on ethanol; contains a zinc finger
           region and has homology to human BRAP2, which is a
           cytoplasmic protein that binds nuclear localization
           sequences
          Length = 585

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 365 LPCGHVLHLFCLKNWMERSQTCPICR 390
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093c
          Length = 305

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 29/65 (44%), Gaps = 21/65 (32%)

Query: 330 ICIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRL-PCGHVLHLFCLKNWMERSQ--TC 386
           +C +C++++C                  GK     L PCGH  H  C++ W   ++   C
Sbjct: 5   VCAICLEDIC------------------GKSSTSYLKPCGHEYHSDCIRKWHGHAEDLKC 46

Query: 387 PICRL 391
           P+CR+
Sbjct: 47  PMCRI 51

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 365 LPCGHVLHLFCLKNWMERSQTCPICR 390
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conserved
           hypothetical protein
          Length = 664

 Score = 34.7 bits (78), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 17/30 (56%)

Query: 366 PCGHVLHLFCLKNWMERSQTCPICRLPVFD 395
           PCGH +H  C   + + S  CP C++ + +
Sbjct: 404 PCGHAIHQHCFDEYTKHSYKCPSCQVSILN 433

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 34.7 bits (78), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 365 LPCGHVLHLFCLKNWMERSQTCPICR 390
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 364 RLP-CGHVLHLFCLKNWMERSQTCPICRLPVFDE 396
            LP C H   L C+  W++++ +CPICR  V ++
Sbjct: 132 ELPNCKHYFDLECITLWLQKNSSCPICRNDVLEK 165

>ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} similar to
            uniprot|Q06554 Saccharomyces cerevisiae YLR247C
            Hypothetical ORF
          Length = 1520

 Score = 34.7 bits (78), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 18/26 (69%)

Query: 365  LPCGHVLHLFCLKNWMERSQTCPICR 390
            + CGH     C+ +W++ +Q+CP+C+
Sbjct: 1214 IKCGHFFCRKCIHSWLKNNQSCPLCK 1239

>TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.542
           YHL010C
          Length = 567

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 365 LPCGHVLHLFCLKNWMERSQTCPICR 390
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 251 IPCQHTFHCQCLDKW--KNSRCPVCR 274

>KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]
           {ON} conserved hypothetical protein
          Length = 650

 Score = 34.7 bits (78), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 366 PCGHVLHLFCLKNWMERSQTCPICRLPVFD 395
           PCGH +H  C   +++ S  CP C + V +
Sbjct: 390 PCGHAIHQHCFDEYIKHSYKCPNCNVSVIN 419

>Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {ON}
           YHL010C - Hypothetical ORF [contig 55] FULL
          Length = 520

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 2/26 (7%)

Query: 365 LPCGHVLHLFCLKNWMERSQTCPICR 390
           +PC H  H  CL  W +    CP+CR
Sbjct: 244 IPCQHTFHCVCLNKWGD--NRCPVCR 267

>KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 110

 Score = 32.3 bits (72), Expect = 0.84,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 21/58 (36%), Gaps = 14/58 (24%)

Query: 331 CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPI 388
           CI C      D        D E VA  G        C H  HL C+  W++    CP+
Sbjct: 55  CIQCQPTAMTD-------TDNECVAAWGA-------CNHAFHLHCINKWLQTRNACPL 98

>KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {ON}
           Anc_6.332 YCR066W
          Length = 445

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 14/24 (58%)

Query: 366 PCGHVLHLFCLKNWMERSQTCPIC 389
           PCGH     C++ ++ R   CP+C
Sbjct: 42  PCGHTFCSICIREYINRQSKCPLC 65

>NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3.279
           YBR062C
          Length = 118

 Score = 32.3 bits (72), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 367 CGHVLHLFCLKNWMERSQTCPICRLPVFDENGNV 400
           C H   L C+  W+ +S TCP+CR  V +   N+
Sbjct: 70  CNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNI 103

>SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 138

 Score = 32.7 bits (73), Expect = 0.90,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 22/62 (35%), Gaps = 14/62 (22%)

Query: 331 CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           CI C      D        D E VA  G        C H  HL C+  W++    CP+  
Sbjct: 83  CIQCQPTAMTD-------TDNECVAAWGT-------CNHAFHLHCINKWLQTRNACPLDN 128

Query: 391 LP 392
            P
Sbjct: 129 QP 130

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 34.3 bits (77), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 2/26 (7%)

Query: 365 LPCGHVLHLFCLKNWMERSQTCPICR 390
           +PC H  H  CL  W  +   CP+CR
Sbjct: 264 IPCQHTFHCQCLNKW--KDSRCPVCR 287

>Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {ON}
           [contig 295] FULL
          Length = 275

 Score = 33.9 bits (76), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 365 LPCGHVLHLFCLKNWMER-SQTCPICR 390
           L C HV H +C+  W+ R S  CP+C+
Sbjct: 136 LGCNHVFHTYCIDQWICRNSACCPLCK 162

>TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON}
           Anc_5.628 YDR265W
          Length = 278

 Score = 33.9 bits (76), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 14/29 (48%)

Query: 362 PKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           P   PCGH+    C+ +W      CP CR
Sbjct: 238 PSVGPCGHIFCWDCIVDWCRERPECPFCR 266

>SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 548

 Score = 34.3 bits (77), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 2/26 (7%)

Query: 365 LPCGHVLHLFCLKNWMERSQTCPICR 390
           +PC H  H  CL  W  +   CP+CR
Sbjct: 254 IPCQHTFHCQCLDKW--KDSRCPVCR 277

>Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {ON}
           YDL008W (APC11) - subunit of the anaphase promoting
           complex (APC) [contig 183] FULL
          Length = 135

 Score = 32.7 bits (73), Expect = 0.98,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 367 CGHVLHLFCLKNWMERSQT---CPICR 390
           C H  H+ C++ W+E +     CP+CR
Sbjct: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88

>TDEL0A03090 Chr1 (550834..552594) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 366 PCGHVLHLFCLKNWMERSQTCPICRLPVFD 395
           PCGH +H  C   +   S  CP C++ V +
Sbjct: 350 PCGHAIHQHCFDEYTRHSYKCPHCQVTVLN 379

>Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON}
            (207883..212532) [4650 nt, 1550 aa]
          Length = 1549

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 8/26 (30%), Positives = 17/26 (65%)

Query: 365  LPCGHVLHLFCLKNWMERSQTCPICR 390
            + CGH     C+++W++   +CP+C+
Sbjct: 1239 IKCGHFFCKKCIQSWLKNKNSCPLCK 1264

>NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_1.389
          Length = 1502

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 17/27 (62%)

Query: 365  LPCGHVLHLFCLKNWMERSQTCPICRL 391
            L CGH     C+ +W++  + CP+C++
Sbjct: 1204 LKCGHFFCKRCITSWLKNKKNCPMCKM 1230

>KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]
           {ON} similar to uniprot|P38748 YHL010C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 517

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 14/25 (56%), Gaps = 2/25 (8%)

Query: 366 PCGHVLHLFCLKNWMERSQTCPICR 390
           PC H  H  CL  W  ++  CP+CR
Sbjct: 233 PCQHTFHCKCLDQW--KNGNCPVCR 255

>NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542
          Length = 625

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 13/26 (50%), Gaps = 2/26 (7%)

Query: 365 LPCGHVLHLFCLKNWMERSQTCPICR 390
           +PC H  H  CL  W      CP+CR
Sbjct: 285 IPCQHTFHCSCLDKW--NDSRCPVCR 308

>YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}
           ASR1Ubiquitin ligase that modifies and regulates RNA Pol
           II; involved in a putative alcohol-responsive signaling
           pathway; accumulates in the nucleus under alcohol
           stress; contains a Ring/PHD finger domain similar to the
           mammalian rA9 protein
          Length = 288

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 2/27 (7%)

Query: 367 CGHVLHLFCLKNWMERS--QTCPICRL 391
           CGH  HL C++ W + S    CPICR+
Sbjct: 23  CGHKFHLNCIREWHKYSINLKCPICRV 49

>CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008w APC11
           subunit of the anaphase promoting complex
          Length = 149

 Score = 32.3 bits (72), Expect = 1.6,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 367 CGHVLHLFCLKNWMERSQT---CPICR 390
           CGH  H+ C+  W++   +   CP+CR
Sbjct: 65  CGHNFHVHCISRWVDTPTSKGLCPMCR 91

>CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highly
            similar to uniprot|Q03897 Saccharomyces cerevisiae
            YDR128w
          Length = 1120

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 4/33 (12%)

Query: 367  CGHVLHLFCLKNWMERSQTCPI---CRLP-VFD 395
            C HVLHL C K W   S+ CP    C  P +FD
Sbjct: 1086 CQHVLHLKCSKEWWNVSKECPTGCGCNCPNMFD 1118

>TBLA0I02360 Chr9 (541190..543124) [1935 bp, 644 aa] {ON} Anc_6.332
           YCR066W
          Length = 644

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 8/24 (33%), Positives = 14/24 (58%)

Query: 366 PCGHVLHLFCLKNWMERSQTCPIC 389
           PCGH     C++ ++ +   CP+C
Sbjct: 42  PCGHTFCSLCIRGYLNKEPKCPLC 65

>NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808
           YOL054W
          Length = 416

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 3/32 (9%)

Query: 362 PKRLPCGHVLHLFCLKNWM---ERSQTCPICR 390
           P   PCGH     CL NW+    +   CP CR
Sbjct: 40  PMMTPCGHNFCYGCLNNWITGGSKDLNCPQCR 71

>KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa]
           {ON} similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 162

 Score = 32.0 bits (71), Expect = 2.0,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 367 CGHVLHLFCLKNWMERSQT---CPICR 390
           C H  H+ C+K W+    +   CP+CR
Sbjct: 87  CNHNFHVHCIKQWLSTETSKGLCPLCR 113

>KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {ON}
           similar to uniprot|Q75EN0 Ashbya gossypii AAR049C RAD18
           Postreplication repair ubiquitin-protein ligase E3 RAD18
           and weakly similar to YCR066W uniprot|P10862
           Saccharomyces cerevisiae YCR066W RAD18 Protein involved
           in postreplication repair binds single-stranded DNA and
           has single-stranded DNA dependent ATPase activity forms
           heterodimer with Rad6p contains RING-finger motif
          Length = 427

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 8/24 (33%), Positives = 15/24 (62%)

Query: 366 PCGHVLHLFCLKNWMERSQTCPIC 389
           PCGH     C++ ++++   CP+C
Sbjct: 46  PCGHSFCSICIRKYLQKESKCPLC 69

>KLTH0A06556g Chr1 (545636..547018) [1383 bp, 460 aa] {ON} similar
           to uniprot|P10862 Saccharomyces cerevisiae YCR066W RAD18
           Protein involved in postreplication repair binds
           single-stranded DNA and has single-stranded DNA
           dependent ATPase activity forms heterodimer with Rad6p
           contains RING-finger motif
          Length = 460

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 14/24 (58%)

Query: 366 PCGHVLHLFCLKNWMERSQTCPIC 389
           PCGH     C++ ++ R   CP+C
Sbjct: 51  PCGHTFCSLCIREYLNRELKCPLC 74

>SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {ON}
           similar to gnl|GLV|CAGL0J03586g Candida glabrata
           CAGL0J03586g and weakly similar to YCR066W
           uniprot|P10862 Saccharomyces cerevisiae YCR066W RAD18
           Protein involved in postreplication repair binds
           single-stranded DNA and has single-stranded DNA
           dependent ATPase activity forms heterodimer with Rad6p
           contains RING-finger motif
          Length = 468

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 14/24 (58%)

Query: 366 PCGHVLHLFCLKNWMERSQTCPIC 389
           PCGH     C++ ++ R   CP+C
Sbjct: 58  PCGHTFCSLCIREYLNRELKCPLC 81

>TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {ON}
           Anc_3.28 YOL133W
          Length = 111

 Score = 31.2 bits (69), Expect = 2.2,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 367 CGHVLHLFCLKNWMERSQTCPICRLP 392
           C H  HL C+  W++    CP+   P
Sbjct: 78  CNHAFHLHCINKWIKTRDACPLDNQP 103

>NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}
           Anc_6.332 YCR066W
          Length = 481

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 16/26 (61%)

Query: 366 PCGHVLHLFCLKNWMERSQTCPICRL 391
           PCGH     C++ +++ +  CP+C L
Sbjct: 42  PCGHTFCSVCIREYLQSNSKCPLCLL 67

>ABR040W Chr2 (470152..471390) [1239 bp, 412 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL014C (YLF2)
          Length = 412

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 492 AKDGVVTF--SLRDSVSGNPVRAKLTLNNDNETQRITIPNECIHHLESIQGLKRRI 545
           A  G VTF  ++  S  GNP       N D E  ++ +P+E + HL+ + G +++I
Sbjct: 29  ANGGKVTFFQAITKSTLGNPANYPFA-NIDPEEAKVLVPSEHLDHLQKLYGSRKKI 83

>AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL054W (PSH1)
          Length = 414

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 4/35 (11%)

Query: 360 YKPKRLPCGHVLHLFCLKNWMERSQT----CPICR 390
           Y P    CGH    FC+ NW+  + +    CP CR
Sbjct: 46  YVPVMTGCGHNYCYFCISNWLNNTSSTELNCPQCR 80

>SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] {ON}
            weakly similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 15/27 (55%)

Query: 367  CGHVLHLFCLKNWMERSQTCPICRLPV 393
            CGH     C+  W++   TCP+C+  V
Sbjct: 1179 CGHFFCYSCIHTWLKEHNTCPLCKTNV 1205

>SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakly
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 15/27 (55%)

Query: 367  CGHVLHLFCLKNWMERSQTCPICRLPV 393
            CGH     C+  W++   TCP+C+  V
Sbjct: 1179 CGHFFCYSCIHTWLKEHNTCPLCKTNV 1205

>KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.628
           YDR265W
          Length = 309

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 13/29 (44%)

Query: 362 PKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           P   PCGH     CL  W      CP+CR
Sbjct: 268 PSCAPCGHTYCWDCLFKWCNERPECPLCR 296

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
            YOL138C (REAL)
          Length = 1336

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 2/25 (8%)

Query: 365  LPCGHVLHLFCLKNWM--ERSQTCP 387
            LPCGH  H  C++ W   E+ + CP
Sbjct: 1303 LPCGHEGHFQCIQEWFLNEKERECP 1327

>KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1528

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 17/26 (65%)

Query: 365  LPCGHVLHLFCLKNWMERSQTCPICR 390
            L CGH     C+ +W +++ +CP+C+
Sbjct: 1221 LKCGHFFCKDCVTHWFKKNTSCPMCK 1246

>Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON}
            (40266..43685) [3420 nt, 1140 aa]
          Length = 1139

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 10/21 (47%), Positives = 12/21 (57%)

Query: 367  CGHVLHLFCLKNWMERSQTCP 387
            C HV+H +C K W   S  CP
Sbjct: 1105 CQHVMHSYCAKEWWNSSNECP 1125

>AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR247C
          Length = 1539

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 35/78 (44%), Gaps = 24/78 (30%)

Query: 316  LKTMSPVELSATDNI---CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLH 372
            L+ ++ +E +  DN+   C +C+ ++C               A  G+        GH   
Sbjct: 1201 LQNLTKLEQALKDNMRFNCTICLCDICDG-------------AIIGR--------GHFYC 1239

Query: 373  LFCLKNWMERSQTCPICR 390
              C+ +W+E  Q+CP+C+
Sbjct: 1240 QECISSWLETKQSCPLCK 1257

>KLLA0E06469g Chr5 complement(581935..584832) [2898 bp, 965 aa] {ON}
           similar to uniprot|P38164 Saccharomyces cerevisiae
           YBL104C Hypothetical ORF
          Length = 965

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 5/68 (7%)

Query: 321 PVELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWM 380
           P+ ++ T N C V +D+  A + EV +     K  K  ++    L C H +H    + W 
Sbjct: 894 PIVINGTTNSCEVRIDD-DAKINEVKE----RKRLKMNEWFSFCLKCNHGMHAGHAEEWF 948

Query: 381 ERSQTCPI 388
           ER   CP+
Sbjct: 949 ERHSICPV 956

>AGL191W Chr7 (339295..341043) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR143C (SAN1)
          Length = 582

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 15/31 (48%)

Query: 359 KYKPKRLPCGHVLHLFCLKNWMERSQTCPIC 389
           K+ P  LPCGHV    C+  W +   +   C
Sbjct: 218 KHSPTELPCGHVFGRDCIFRWTQEHNSLSYC 248

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 14/24 (58%)

Query: 367 CGHVLHLFCLKNWMERSQTCPICR 390
           C H   L C+  W+  + TCP+CR
Sbjct: 108 CSHKFDLQCISVWLSSNSTCPVCR 131

>TDEL0A07470 Chr1 (1302286..1303512) [1227 bp, 408 aa] {ON}
           Anc_6.332 YCR066W
          Length = 408

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 8/24 (33%), Positives = 14/24 (58%)

Query: 366 PCGHVLHLFCLKNWMERSQTCPIC 389
           PCGH     C++ ++ +   CP+C
Sbjct: 42  PCGHTFCSLCIRQYLRQDPKCPLC 65

>KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some
           similarities with uniprot|Q12161 Saccharomyces
           cerevisiae YOL054W PSH1 Nuclear protein putative RNA
           polymerase II elongation factor isolated as
           Pob3p/Spt16p- binding protein
          Length = 306

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 4/38 (10%)

Query: 360 YKPKRLPCGHVLHLFCLKNWMERSQ----TCPICRLPV 393
           Y P    CGH     C+ NW+  +     TCP CR P+
Sbjct: 2   YVPVMTSCGHNYCYECISNWLVSNNANELTCPQCRSPL 39

>ZYRO0B02046g Chr2 (164680..166017) [1338 bp, 445 aa] {ON} conserved
           hypothetical protein
          Length = 445

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 366 PCGHVLHLFCLKNWMERSQTCPICRLPVFD 395
           PCGH +H  C +     S  CP C++ V +
Sbjct: 239 PCGHAIHQHCFEEHTRHSYKCPHCQVTVLN 268

>KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1466

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 15/26 (57%)

Query: 365  LPCGHVLHLFCLKNWMERSQTCPICR 390
            + CGH     C+ +W++    CPIC+
Sbjct: 1164 IKCGHFFCKHCIFSWLKNKSVCPICK 1189

>SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] {ON}
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1491

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 8/27 (29%), Positives = 15/27 (55%)

Query: 365  LPCGHVLHLFCLKNWMERSQTCPICRL 391
            + CGH     C+ +W+     CP+C++
Sbjct: 1177 IKCGHFFCKSCIHSWLRNKNACPLCKM 1203

>KNAG0I02880 Chr9 complement(562281..563666) [1386 bp, 461 aa] {ON}
           Anc_6.332 YCR066W
          Length = 461

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 14/24 (58%)

Query: 366 PCGHVLHLFCLKNWMERSQTCPIC 389
           PCGH     C++  + +S  CP+C
Sbjct: 42  PCGHTFCSICIREAINKSAKCPLC 65

>Ecym_7253 Chr7 complement(534000..535853) [1854 bp, 617 aa] {ON}
           similar to KLTH0D06886g KLTH0D06886p Lachancea
           thermotolerans
          Length = 617

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 366 PCGHVLHLFCLKNWMERSQTCPICRLPVFD 395
           PCGH +H  C  +    S  CP C++ V +
Sbjct: 388 PCGHAIHQHCFNDHTRHSYKCPQCQVTVVN 417

>Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to
           Ashbya gossypii ADL181W
          Length = 114

 Score = 30.4 bits (67), Expect = 4.0,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 20/58 (34%), Gaps = 14/58 (24%)

Query: 331 CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPI 388
           CI C      D        D E VA  G        C H  HL C+  W+     CP+
Sbjct: 59  CIQCQPNAMTD-------TDNECVAAWGT-------CNHAFHLHCINKWLLTRNACPL 102

>ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa]
           {ON} weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 273

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 25/63 (39%), Gaps = 18/63 (28%)

Query: 331 CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNW--MERSQTCPI 388
           C +C+D+            DR  +   G  +P    C H  H  CL+ W        CPI
Sbjct: 5   CPICLDD------------DRTNIESIGTLQP----CNHKFHRDCLRRWHLYAHDLVCPI 48

Query: 389 CRL 391
           CR+
Sbjct: 49  CRV 51

>ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL133W (HRT1)
          Length = 108

 Score = 30.0 bits (66), Expect = 4.6,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 20/58 (34%), Gaps = 14/58 (24%)

Query: 331 CIVCMDELCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPI 388
           CI C      D E        E VA  G        C H  HL C+  W+     CP+
Sbjct: 53  CIQCQPNAMTDTEN-------ECVAAWGT-------CNHAFHLHCINKWLLTRNACPL 96

>TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_1.389
            YLR247C
          Length = 1470

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 8/26 (30%), Positives = 16/26 (61%)

Query: 365  LPCGHVLHLFCLKNWMERSQTCPICR 390
            + CGH     C+ +W++   +CP+C+
Sbjct: 1167 IKCGHFFCRSCIHSWLKNHNSCPMCK 1192

>Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {ON}
           similar to Ashbya gossypii AGL217W
          Length = 386

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 17/38 (44%), Gaps = 4/38 (10%)

Query: 360 YKPKRLPCGHVLHLFCLKNWMERSQ----TCPICRLPV 393
           Y P    CGH    +C+ NW+  +      CP CR  +
Sbjct: 2   YVPVMTSCGHNYCYYCISNWLNNNNATELNCPQCRTTI 39

>KNAG0B05470 Chr2 complement(1068236..1070062) [1827 bp, 608 aa]
           {ON} Anc_4.149 YGR013W
          Length = 608

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 4/69 (5%)

Query: 309 NKQLDDKLKTMSPVELSATDNICIVCMDELCADLEEV---VQGPDREKVAKTGKYKPKRL 365
           NK+ D+ ++T   V+L    +I    +D+LC D++E    V   +REK+ K    + KR+
Sbjct: 242 NKEHDNNVETEYKVDLRTLSDIPTDSLDQLCKDIKEFRTKVVSIEREKMTKEHFEESKRM 301

Query: 366 PCGHVLHLF 374
              H++ +F
Sbjct: 302 KQ-HMMKMF 309

>SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 322

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 2/36 (5%)

Query: 358 GKYKPKRLPCGHVLHLFCLKNWMERSQ--TCPICRL 391
           G+   + + C H  HL C++ W   SQ   CP CR+
Sbjct: 14  GQNIGRLVTCQHEYHLECIREWHNHSQDFKCPTCRV 49

>CAGL0J03586g Chr10 complement(343893..345128) [1236 bp, 411 aa]
           {ON} similar to uniprot|P10862 Saccharomyces cerevisiae
           YCR066w RAD18 DNA repair protein
          Length = 411

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 8/24 (33%), Positives = 13/24 (54%)

Query: 366 PCGHVLHLFCLKNWMERSQTCPIC 389
           PCGH     C++ ++     CP+C
Sbjct: 41  PCGHTFCSLCIRGYLSNEPKCPLC 64

>Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W -
           Hypothetical ORF [contig 36] FULL
          Length = 300

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 4/38 (10%)

Query: 360 YKPKRLPCGHVLHLFCLKNWMERSQ----TCPICRLPV 393
           Y P    CGH     C+ NW+  +     TCP CR P+
Sbjct: 2   YVPVMTTCGHNYCYDCISNWLVSNNANELTCPQCRSPL 39

>Kpol_1028.46 s1028 complement(110464..110775,110777..111811) [1347
           bp, 448 aa] {ON}
           complement(110464..110775,110777..111811) [1347 nt, 449
           aa]
          Length = 448

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 8/24 (33%), Positives = 14/24 (58%)

Query: 366 PCGHVLHLFCLKNWMERSQTCPIC 389
           PCGH     C+++++     CP+C
Sbjct: 43  PCGHTFCSICIRSYVNSESKCPLC 66

>TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {ON}
           Anc_8.317 YDR143C
          Length = 698

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 362 PKRLPCGHVLHLFCLKNWMERSQTCPICR 390
           P +L C H+    CL  W +   +CP+CR
Sbjct: 332 PVQLSCKHIFCRSCLYEWSKLKNSCPLCR 360

>KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON}
           conserved hypothetical protein
          Length = 267

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 5/34 (14%)

Query: 365 LPCGHVLHLFCLKNWMER-SQTCPICR----LPV 393
           L C H+ H  C+  W+ R S  CP+C+    LPV
Sbjct: 126 LGCSHIFHSHCIDRWICRNSACCPLCKRSYSLPV 159

>Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247C -
            Hypothetical ORF [contig 244] FULL
          Length = 1518

 Score = 31.6 bits (70), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 8/27 (29%), Positives = 17/27 (62%)

Query: 365  LPCGHVLHLFCLKNWMERSQTCPICRL 391
            + CGH     C+ +W++   +CP+C++
Sbjct: 1202 IKCGHFFCQDCICSWLKNHSSCPLCKM 1228

>KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1554

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 8/27 (29%), Positives = 17/27 (62%)

Query: 365  LPCGHVLHLFCLKNWMERSQTCPICRL 391
            + CGH     C+ +W++   +CP+C++
Sbjct: 1236 IKCGHFFCQSCIFSWLKNHASCPLCKM 1262

>KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly
           similar to uniprot|Q06834 Saccharomyces cerevisiae
           YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 291

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 2/29 (6%)

Query: 365 LPCGHVLHLFCLKNWMERSQT--CPICRL 391
           + CGH  H  C++ W   S+   CP CR+
Sbjct: 19  VECGHKYHFNCIRRWHYHSKNLQCPTCRI 47

>ZYRO0D08404g Chr4 complement(728281..729510) [1230 bp, 409 aa] {ON}
           similar to uniprot|P10862 Saccharomyces cerevisiae
           YCR066W RAD18 Protein involved in postreplication repair
           binds single-stranded DNA and has single-stranded DNA
           dependent ATPase activity forms heterodimer with Rad6p
           contains RING-finger motif
          Length = 409

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 8/24 (33%), Positives = 13/24 (54%)

Query: 366 PCGHVLHLFCLKNWMERSQTCPIC 389
           PC H     C++ ++ R   CP+C
Sbjct: 42  PCSHTFCSLCIREYLTREPKCPLC 65

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.137    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,703,319
Number of extensions: 1672145
Number of successful extensions: 6815
Number of sequences better than 10.0: 204
Number of HSP's gapped: 6932
Number of HSP's successfully gapped: 226
Length of query: 558
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 443
Effective length of database: 40,294,809
Effective search space: 17850600387
Effective search space used: 17850600387
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)