Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C07128gsingletonON41641619290.0
Suva_14.2632.220ON58779760.76
KLLA0E15511g5.88ON905120732.0
CAGL0I06072g1.193ON94149713.5
Skud_4.5915.364ON531135695.1
NCAS0A008401.119ON966100695.7
NDAI0A07090singletonON117097687.7
TBLA0A015508.495ON505104679.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C07128g
         (416 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C07128g Chr3 complement(538656..539906) [1251 bp, 416 aa] {...   747   0.0  
Suva_14.263 Chr14 (482296..484059) [1764 bp, 587 aa] {ON} YNL076...    34   0.76 
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    33   2.0  
CAGL0I06072g Chr9 (577324..580149) [2826 bp, 941 aa] {ON} simila...    32   3.5  
Skud_4.591 Chr4 complement(1048679..1050274) [1596 bp, 531 aa] {...    31   5.1  
NCAS0A00840 Chr1 (160625..163525) [2901 bp, 966 aa] {ON} Anc_1.1...    31   5.7  
NDAI0A07090 Chr1 complement(1613809..1617321) [3513 bp, 1170 aa]...    31   7.7  
TBLA0A01550 Chr1 (360647..362164) [1518 bp, 505 aa] {ON} Anc_8.4...    30   9.4  

>ZYRO0C07128g Chr3 complement(538656..539906) [1251 bp, 416 aa] {ON}
           no similarity
          Length = 416

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/416 (89%), Positives = 373/416 (89%)

Query: 1   MEXXXXXXXXXADNATLQDAIDYEMNICFDDDFQLNQKTIPIENGLLSCPQKISEGPTIS 60
           ME         ADNATLQDAIDYEMNICFDDDFQLNQKTIPIENGLLSCPQKISEGPTIS
Sbjct: 1   MESNSSFSPSSADNATLQDAIDYEMNICFDDDFQLNQKTIPIENGLLSCPQKISEGPTIS 60

Query: 61  LSKPANCIVTKDSVKAELISTKTNLTRYYEKENGFNGFVDQVFEVNYDVTMTNCNLVSKY 120
           LSKPANCIVTKDSVKAELISTKTNLTRYYEKENGFNGFVDQVFEVNYDVTMTNCNLVSKY
Sbjct: 61  LSKPANCIVTKDSVKAELISTKTNLTRYYEKENGFNGFVDQVFEVNYDVTMTNCNLVSKY 120

Query: 121 SDLQLENINLLETIAKMKTNHSQEITHLQDAFKKAKSENYEMSLTNSDLTLSNVDNRREI 180
           SDLQLENINLLETIAKMKTNHSQEITHLQDAFKKAKSENYEMSLTNSDLTLSNVDNRREI
Sbjct: 121 SDLQLENINLLETIAKMKTNHSQEITHLQDAFKKAKSENYEMSLTNSDLTLSNVDNRREI 180

Query: 181 IQLKDENRRLKQKETRFAPLDQTFNGTVPKKVIGDISLMNEDLSAKLARVTAEFKNWEIE 240
           IQLKDENRRLKQKETRFAPLDQTFNGTVPKKVIGDISLMNEDLSAKLARVTAEFKNWEIE
Sbjct: 181 IQLKDENRRLKQKETRFAPLDQTFNGTVPKKVIGDISLMNEDLSAKLARVTAEFKNWEIE 240

Query: 241 NNXXXXXXXXXXXXXXXXXXTLMNENVTLKTRVEQLQSTRKNNSXXXXXXXXXXXXXXXX 300
           NN                  TLMNENVTLKTRVEQLQSTRKNNS                
Sbjct: 241 NNLSKKQQQSKSLSDQLQIQTLMNENVTLKTRVEQLQSTRKNNSREHLLERLVELRELRE 300

Query: 301 QLSKDTKFISNAQQLQIDKENCLSDLTRLQRDYDELRRKSELLQVTKNFSGSSNNSFTER 360
           QLSKDTKFISNAQQLQIDKENCLSDLTRLQRDYDELRRKSELLQVTKNFSGSSNNSFTER
Sbjct: 301 QLSKDTKFISNAQQLQIDKENCLSDLTRLQRDYDELRRKSELLQVTKNFSGSSNNSFTER 360

Query: 361 STSPEFDNDIFDGLTPQTNVTEKTFKRKRFYKKGSLSPSNWSLRFAKNKFFRSLAS 416
           STSPEFDNDIFDGLTPQTNVTEKTFKRKRFYKKGSLSPSNWSLRFAKNKFFRSLAS
Sbjct: 361 STSPEFDNDIFDGLTPQTNVTEKTFKRKRFYKKGSLSPSNWSLRFAKNKFFRSLAS 416

>Suva_14.263 Chr14 (482296..484059) [1764 bp, 587 aa] {ON} YNL076W
           (REAL)
          Length = 587

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 37/79 (46%), Gaps = 7/79 (8%)

Query: 337 RRKSELLQVTKNFSGSSNNSFTERSTSPEFDN-DIFDGLTPQTNVTEKTFKRKRFYK--- 392
           RR     Q  ++ S +S ++ T +STSP FDN        PQ    E  F R R YK   
Sbjct: 213 RRSRSPFQHVRDMSMNSIDNETSKSTSPNFDNMGSRKSSLPQ---KESLFGRPRSYKNDQ 269

Query: 393 KGSLSPSNWSLRFAKNKFF 411
            G LS S  S R  KNK F
Sbjct: 270 SGQLSLSKTSSRKGKNKIF 288

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 57/120 (47%), Gaps = 18/120 (15%)

Query: 72  DSVKAELISTKTNLTRYYEKENGFNGFVDQVFEVNYDVTMTNCNLVSKYSDLQLENINLL 131
           D ++ +  + +T +TR+ E   G +  + +V   N ++T +   L ++YS L+ E+ +  
Sbjct: 742 DGMRQKQKAHETVVTRHKETMTGLDRKLSEVILQNKELTTSRDQLFTEYSKLKDEHASKH 801

Query: 132 ETIAKMKTNHSQEITHLQDAFKKAKSENYEMSLTNSDLTLSNVDNRREIIQLKDENRRLK 191
           E + KM+  +   I                 S+ NS   +  + N  EII+L+ EN RLK
Sbjct: 802 EELTKMEREYRSVID----------------SVHNSGNAMEKLQN--EIIKLRQENSRLK 843

>CAGL0I06072g Chr9 (577324..580149) [2826 bp, 941 aa] {ON} similar
           to uniprot|P34110 Saccharomyces cerevisiae YJL154c VPS35
           protein-sorting protein
          Length = 941

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 127 NINLLETIAK--MKTNHSQEITHLQDAFKKAKSENYEMSLTNSDLTLSN 173
           NI  L+T A+  M  + S EI+HL+ A  + K ++Y M L  S + +SN
Sbjct: 849 NIKALQTEAESYMSDDPSHEISHLESAVSQLKMQDYVMGLDGSLVQVSN 897

>Skud_4.591 Chr4 complement(1048679..1050274) [1596 bp, 531 aa] {ON}
           YDR323C (REAL)
          Length = 531

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 58/135 (42%), Gaps = 16/135 (11%)

Query: 108 DVTMTNCNLVSK-YSDLQLENINLLETIAKMKTNHSQEITHLQDAFKKAKSEN-YEMSLT 165
           D+  TNC    K Y    L N+  L+  A+    H +      D F K    N Y  ++ 
Sbjct: 104 DIGATNCRKCGKLYCRRHLPNMIKLDLSAQYDPKHGKWYNSCHDCFVKRPGYNDYGEAI- 162

Query: 166 NSDLTLSNVDNRREIIQLKDENRRLKQKETRFAPLDQTFNG--TVPKKVIGDISL---MN 220
             DLT      R   I+ +D+N RL Q E RF  L    NG  ++ KK  G I     MN
Sbjct: 163 --DLTREFFKVRS--IKKEDKNLRLLQLENRFVRL---VNGLISIYKKYNGSIIYNLKMN 215

Query: 221 EDLSAKLARVTAEFK 235
            ++S KL R    ++
Sbjct: 216 SEMS-KLERTVTPWR 229

>NCAS0A00840 Chr1 (160625..163525) [2901 bp, 966 aa] {ON} Anc_1.119
           YNL243W
          Length = 966

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 45/100 (45%), Gaps = 18/100 (18%)

Query: 91  KENGFNGFVDQ--VFEVNYDVTMTNCNLVSKYSDLQLENINLLETIAK--MKTNHSQEIT 146
           K+    G  DQ  V+E  YD      +L   YS L+ E++NLL    K  MK N +QE  
Sbjct: 458 KDEQMIGLQDQLTVWEKKYD------SLAKLYSQLRQEHLNLLPKFKKLQMKVNSAQESI 511

Query: 147 HLQDAFKKAKSENYEMSLTNSDLTLSNVDNRREIIQLKDE 186
                    + E  E  L N DL L+ +   R+  QL+ E
Sbjct: 512 K--------EKEQIENKLKNKDLQLAQLIKERDRAQLELE 543

>NDAI0A07090 Chr1 complement(1613809..1617321) [3513 bp, 1170 aa] {ON}
            
          Length = 1170

 Score = 30.8 bits (68), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 42/97 (43%), Gaps = 14/97 (14%)

Query: 97   GFVDQVFEVNYDVTMTNCNLVS-------KYSDLQLENINLLETIAKMKTNHSQEITHLQ 149
             F  Q+ E N    +TN  ++S       +YSD+  E  N   T+  ++TN S  IT   
Sbjct: 965  SFTKQLTETNNSGLLTNARVLSDVINWLLQYSDIMNETENYFHTVDNIRTNSSTIITAPH 1024

Query: 150  DAFKKAKSENYEMSLTNSDLTLSNVDNRREIIQLKDE 186
            D      S ++        + +S VD + EII+   E
Sbjct: 1025 DQHLAINSRSFP-------ILVSGVDPQHEIIRYLKE 1054

>TBLA0A01550 Chr1 (360647..362164) [1518 bp, 505 aa] {ON} Anc_8.495
           YDR255C
          Length = 505

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 51/104 (49%), Gaps = 17/104 (16%)

Query: 115 NLVSK-YSDLQLENINLLETIAKMKTNHSQEITHLQDA-----FKKAKSENYEMSLTNSD 168
           N++ K YSD +L++I+L ET   + T  S + +HL D+      K    ++Y   + N  
Sbjct: 114 NVIHKLYSDFKLDDISL-ETFYNINTGKSNKKSHLGDSSIDNEIKNIDDDDYSNGIRNG- 171

Query: 169 LTLSNVDNRREIIQLKDE-NRRLKQKETRFA----PLDQTFNGT 207
               N+ NR ++I++K   N  +    +R+     P+D   N T
Sbjct: 172 ----NIKNRMDLIEIKSHVNSAIDFHISRYIIENLPIDINLNDT 211

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,552,211
Number of extensions: 1832785
Number of successful extensions: 7000
Number of sequences better than 10.0: 205
Number of HSP's gapped: 7321
Number of HSP's successfully gapped: 218
Length of query: 416
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 304
Effective length of database: 40,638,807
Effective search space: 12354197328
Effective search space used: 12354197328
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)