Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C06336g3.455ON1189118960220.0
Kpol_1050.883.455ON1213121327680.0
TDEL0F034003.455ON1170119627400.0
Smik_16.3713.455ON1208121327110.0
YPR122W (AXL1)3.455ON1208121127090.0
NCAS0A116303.455ON1201119127020.0
Skud_16.4123.455ON1208120526910.0
NDAI0A046503.455ON1199119626670.0
Suva_16.4513.455ON1218121826640.0
KAFR0A053703.455ON1201120825690.0
SAKL0F06886g3.455ON1183115724980.0
Ecym_44043.455ON1196120023740.0
KNAG0A077403.455ON1197117522930.0
TBLA0C054503.455ON1202120722890.0
Kwal_55.204643.455ON1189119022820.0
KLTH0E05104g3.455ON1185119522670.0
AGR251C3.455ON1193118722070.0
TPHA0D040603.455ON1201116021210.0
KLLA0D15631g3.455ON1170116517400.0
CAGL0D04686g3.455ON1181118413891e-171
KNAG0B060804.246ON9963914411e-43
TDEL0E012504.246ON9954044402e-43
KLLA0E05105g4.246ON10043934331e-42
Skud_12.4744.246ON10224604332e-42
KAFR0A059704.246ON10113984313e-42
Suva_10.5064.246ON10234574242e-41
NDAI0J022404.246ON9993864214e-41
TBLA0I029404.246ON9654034188e-41
TPHA0B022604.246ON10414064171e-40
NCAS0J014704.246ON9954044171e-40
YLR389C (STE23)4.246ON10274554152e-40
Kpol_1055.834.246ON10204024143e-40
Smik_12.4764.246ON10253924072e-39
AER053C4.246ON10135094062e-39
ZYRO0B12320g4.246ON9943924063e-39
SAKL0H03124g4.246ON10063944011e-38
KLTH0D14278g4.246ON10013933973e-38
CAGL0H06457g4.246ON10084033964e-38
Kwal_23.42374.246ON10013953865e-37
Ecym_32734.246ON10234493813e-36
TBLA0A080504.246ON9953913312e-30
AGL138C8.376ON4702041165e-05
YLR163C (MAS1)8.376ON4622191102e-04
Smik_12.2258.376ON4622191075e-04
Kwal_23.33458.376ON4582001076e-04
NCAS0F011405.541ON988143890.089
SAKL0G05236g5.541ON986129801.1
TBLA0A069405.541ON991129772.3
KLLA0B00957g5.541ON982129763.5
TPHA0B008404.237ON111953746.3
Kpol_1033.248.295ON491583738.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C06336g
         (1189 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} simil...  2324   0.0  
Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON} (199...  1070   0.0  
TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3....  1060   0.0  
Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR12...  1048   0.0  
YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Hapl...  1048   0.0  
NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_...  1045   0.0  
Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR12...  1041   0.0  
NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa]...  1031   0.0  
Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR12...  1030   0.0  
KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_...   994   0.0  
SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} simil...   966   0.0  
Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON...   919   0.0  
KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa]...   887   0.0  
TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa]...   886   0.0  
Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] ...   883   0.0  
KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] ...   877   0.0  
AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON...   854   0.0  
TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3....   821   0.0  
KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} sim...   674   0.0  
CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} simil...   539   e-171
KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa] ...   174   1e-43
TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.2...   174   2e-43
KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} simil...   171   1e-42
Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa] ...   171   2e-42
KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON} Anc_...   170   3e-42
Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa] ...   167   2e-41
NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {...   166   4e-41
TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {O...   165   8e-41
TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4....   165   1e-40
NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {...   165   1e-40
YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}...   164   2e-40
Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON} (216...   164   3e-40
Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa] ...   161   2e-39
AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON} ...   160   2e-39
ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {...   160   3e-39
SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} simil...   159   1e-38
KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa...   157   3e-38
CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highl...   157   4e-38
Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389...   153   5e-37
Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar ...   151   3e-36
TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON} Anc_4...   132   2e-30
AGL138C Chr7 complement(453737..455149) [1413 bp, 470 aa] {ON} S...    49   5e-05
YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON} ...    47   2e-04
Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {...    46   5e-04
Kwal_23.3345 s23 (253614..254990) [1377 bp, 458 aa] {ON} YLR163C...    46   6e-04
NCAS0F01140 Chr6 complement(224043..227009) [2967 bp, 988 aa] {O...    39   0.089
SAKL0G05236g Chr7 complement(429654..432614) [2961 bp, 986 aa] {...    35   1.1  
TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa] ...    34   2.3  
KLLA0B00957g Chr2 complement(73661..76609) [2949 bp, 982 aa] {ON...    34   3.5  
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    33   6.3  
Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 ...    33   8.4  

>ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1189

 Score = 2324 bits (6022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1128/1189 (94%), Positives = 1128/1189 (94%)

Query: 1    MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDP 60
            MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTEN            HNDP
Sbjct: 1    MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENSSACSLSVASGSHNDP 60

Query: 61   SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120
            SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS
Sbjct: 61   SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120

Query: 121  LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180
            LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH
Sbjct: 121  LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180

Query: 181  PFSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240
            PFSRFSTGNISTLNSIPH          HEYFKENFCASKMTLCLRGPQSIHSLAKLALT
Sbjct: 181  PFSRFSTGNISTLNSIPHLKNLNLKNLLHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240

Query: 241  KFSLIKNNPQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQ 300
            KFSLIKNNPQRY               NEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQ
Sbjct: 241  KFSLIKNNPQRYRPSPPVSPSKSKRSSNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQ 300

Query: 301  EKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGW 360
            EKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGW
Sbjct: 301  EKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGW 360

Query: 361  VTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTLELAQFMS 420
            VTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTLELAQFMS
Sbjct: 361  VTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTLELAQFMS 420

Query: 421  KQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMMIDEQHHNIGNY 480
            KQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMMIDEQHHNIGNY
Sbjct: 421  KQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMMIDEQHHNIGNY 480

Query: 481  GENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNXXXXXXXXXXXXXFQVDLFYEFE 540
            GENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGN             FQVDLFYEFE
Sbjct: 481  GENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNSRESQLEELSSQEFQVDLFYEFE 540

Query: 541  YFKRDGIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQLKKILNDSSQKSQSAPLSFTI 600
            YFKRDGIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQLKKILNDSSQKSQSAPLSFTI
Sbjct: 541  YFKRDGIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQLKKILNDSSQKSQSAPLSFTI 600

Query: 601  HNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSFEIFGLDLEACPRNTMNLEILG 660
            HNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSFEIFGLDLEACPRNTMNLEILG
Sbjct: 601  HNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSFEIFGLDLEACPRNTMNLEILG 660

Query: 661  QIIFILLSPEIYPSLKLGFTCEITSNKGDIRLGFTISGFSKQLTSFVKSIIETIKRISQD 720
            QIIFILLSPEIYPSLKLGFTCEITSNKGDIRLGFTISGFSKQLTSFVKSIIETIKRISQD
Sbjct: 661  QIIFILLSPEIYPSLKLGFTCEITSNKGDIRLGFTISGFSKQLTSFVKSIIETIKRISQD 720

Query: 721  PDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKYMWTLEDRLEALEDIDMD 780
            PDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKYMWTLEDRLEALEDIDMD
Sbjct: 721  PDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKYMWTLEDRLEALEDIDMD 780

Query: 781  NFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLHRSFTHHLGGGIYETQGKTFTVETTK 840
            NFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLHRSFTHHLGGGIYETQGKTFTVETTK
Sbjct: 781  NFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLHRSFTHHLGGGIYETQGKTFTVETTK 840

Query: 841  MLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELRNKR 900
            MLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELRNKR
Sbjct: 841  MLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELRNKR 900

Query: 901  QVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQLQKLDEQTFHQEYV 960
            QVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQLQKLDEQTFHQEYV
Sbjct: 901  QVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQLQKLDEQTFHQEYV 960

Query: 961  RCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEILSSQTMKRHKKLQTQIIQEQY 1020
            RCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEILSSQTMKRHKKLQTQIIQEQY
Sbjct: 961  RCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEILSSQTMKRHKKLQTQIIQEQY 1020

Query: 1021 DFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLRXXXXXXXXXXXAEKDIINKKIFL 1080
            DFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLR           AEKDIINKKIFL
Sbjct: 1021 DFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLRSKISIMISSSIAEKDIINKKIFL 1080

Query: 1081 QLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSCFRTRNDALRLCSVILAELFKM 1140
            QLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSCFRTRNDALRLCSVILAELFKM
Sbjct: 1081 QLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSCFRTRNDALRLCSVILAELFKM 1140

Query: 1141 LAKSLRHRYGNLAHDDTSKRDLQEWSTDVKPALDLKVIEDINFFKRVQI 1189
            LAKSLRHRYGNLAHDDTSKRDLQEWSTDVKPALDLKVIEDINFFKRVQI
Sbjct: 1141 LAKSLRHRYGNLAHDDTSKRDLQEWSTDVKPALDLKVIEDINFFKRVQI 1189

>Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON}
            (199457..203098) [3642 nt, 1214 aa]
          Length = 1213

 Score = 1070 bits (2768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/1213 (45%), Positives = 777/1213 (64%), Gaps = 29/1213 (2%)

Query: 1    MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDP 60
            M   ++K YDIPF TP S+ GRT+KLC+LPNG+L LLISDP E+            HNDP
Sbjct: 1    MSWSEVKNYDIPFYTPISYRGRTNKLCRLPNGMLVLLISDPGESSFGCSLSVATGSHNDP 60

Query: 61   SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120
             EIPGLAHLCEHM+LAAGS+KYP+PG YHE+I KN G QNA+TTGEQT+FYFELPN+  +
Sbjct: 61   KEIPGLAHLCEHMILAAGSKKYPNPGLYHELIAKNKGLQNAYTTGEQTTFYFELPNVNQT 120

Query: 121  LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180
                F++ +DVFASFF +PLFN TL +KE YAIESEH  N S+  KIFY A RLLAN NH
Sbjct: 121  STPVFEDIIDVFASFFKDPLFNQTLTSKEIYAIESEHTGNTSNPTKIFYHAERLLANSNH 180

Query: 181  PFSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240
            PFS FSTGNI+TL+S P             YFK NF A  MTLC++GPQS++ L K+A+ 
Sbjct: 181  PFSHFSTGNINTLSSGPQLRKINLKSLLDSYFKVNFKAENMTLCIKGPQSVNILTKIAIR 240

Query: 241  KFSLIKN-----NPQRYXXXXXXXXXXXXXX-------------XNEWVEVNPKEMN--I 280
             FS IK       P+R+                            +   E N   ++  I
Sbjct: 241  YFSDIKGLNSIKKPKRFGTIRKSISTSEKSIPLSPSSPTSCKSISSVLSETNSSLLSTKI 300

Query: 281  SKNTWLPKYRGQLCFTSDEQEKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWP 340
             +N W PKY   +CF    +   I +KS+K P +R +FP +    +F+ +++    +LW 
Sbjct: 301  LENVWSPKYNNMVCFDPKPKYNTIIVKSNKKPVLRLVFPVVTNKGKFSKEELITFCNLWC 360

Query: 341  ELFGDESPGSFSHWLQSKGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLF 400
            E  GDES  S  + L ++ ++T   AF S+ A+ N  LILE  LT  G  N+SHI   + 
Sbjct: 361  ETLGDESENSICNILMNEEYITDILAFTSDFALNNIGLILEFSLTDKGLNNVSHIINSIM 420

Query: 401  EQAIPALSQKNTLELAQFMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPA 460
            E AIP LS++ T ELA+F+S+ + IDL+ FL++ +E+SPMEEC +LS LMQ DL+ L P 
Sbjct: 421  ESAIPKLSKEYTEELARFLSECDSIDLLNFLHKESELSPMEECSDLSGLMQTDLDILKPE 480

Query: 461  YIFKGSPMMIDEQHHNIGNYGENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNXXX 520
             +FK SPM++  ++  IGN+GE+ ES +WW+ +A  +Q FL+ +M +  +R+ +  +   
Sbjct: 481  CLFKQSPMIVGNKYPTIGNFGESSESRQWWLNKATMYQEFLEMYMNKDLLRIALLCDFSE 540

Query: 521  XXX--XXXXXXXFQVDLFYEFEYFKRDGIPFKDILEWNNDY--NFKIPQLDCPMPDIAKS 576
                           D FYEF+Y K   +P K + E   D   N K P  +  +P++ +S
Sbjct: 541  KQYFGKNVSEQKLVTDTFYEFDYIKLSVLPEK-VPEDQVDIFSNLKFPAKNEYIPELGRS 599

Query: 577  YSQLKKILNDSSQKSQSAPLSFTIHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSI 636
               L+++L   S +S+S  LS T  +   +P+P L  +   +EMWVM D   PS   K+I
Sbjct: 600  LLYLREMLKKVSYESRSPILSLTTPSKATRPIPKLAEKGDMYEMWVMEDKFRPSTEKKTI 659

Query: 637  VSFEIFGLDLEACPRNTMNLEILGQIIFILLSPEIYPSLKLGFTCEI-TSNKGDIRLGFT 695
            V+F++  LD+   P+NTM+LEILGQI+++LLSP++YPSLKLG+T EI +S+KGD+RL FT
Sbjct: 660  VTFDLLSLDVPPTPKNTMHLEILGQILYVLLSPKLYPSLKLGYTYEIASSSKGDVRLSFT 719

Query: 696  ISGFSKQLTSFVKSIIETIKRISQDPDFLSKETLRRARILVRNKYENAANENCANIGSIG 755
            +SG+S  LT  VK++I+T   I+ D +  SK  LRRARIL R KYE+AA ENCA + S+G
Sbjct: 720  LSGYSDGLTEVVKTVIKTCFTIAIDDEIPSKRLLRRARILTRRKYESAAAENCAKLASVG 779

Query: 756  LYIVLEKYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLH 815
            L I+LEKY+W LEDRL ALE+ D+ +FK+FC +FL SKKYL+L VQG+L CA+E+N+YL+
Sbjct: 780  LIIMLEKYIWPLEDRLNALEESDIHSFKEFCIAFLRSKKYLNLIVQGNLKCANEINKYLN 839

Query: 816  RSFTHHLGGGIYETQGKTFTVETTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDR 875
             SFT+HLG    +        +TTK+LEPGTN   +H G  DDPNN I+YFIQTG+R+D+
Sbjct: 840  DSFTNHLGEKSGKNTKSVDCSKTTKLLEPGTNCIFEHFGHPDDPNNCIVYFIQTGKRDDK 899

Query: 876  MIFTLTNFTVFIMSLNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETK 935
                LT+FT +++SL L  +LRNK+Q+GY+V GG+R+LS++VG+HIT+MSG +PLDLE K
Sbjct: 900  KALALTSFTEYLLSLTLVPDLRNKKQIGYVVFGGMRVLSDTVGIHITVMSGSNPLDLEEK 959

Query: 936  IDEYLWYLESQ-LQKLDEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQI 994
            IDEYL++LES+ L+KL E+ F +++V+ YL  + G   GD   ++GP ++L  + ANVQ 
Sbjct: 960  IDEYLYFLESEVLKKLSEEQFGKKFVKDYLSTMGGDSTGDMMSTAGPPNVLDGIAANVQA 1019

Query: 995  GDSEILSSQTMKRHKKLQTQIIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHS 1054
            GD  +L+S  M  H++++ +I  ++Y+F  +    D + I  ++L++YL FF+  ISI S
Sbjct: 1020 GDFSVLNSLQMITHRRIKNEITSKRYNFSNDDIETDLNFIKHLTLKKYLKFFEENISISS 1079

Query: 1055 KLRXXXXXXXXXXXAEKDIINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKILAM 1114
              R           A ++I+N+K FLQLE FLK+ GF I  D LK +V  S G+P  L  
Sbjct: 1080 VNRSKLSVAITSPMATQEIMNRKFFLQLEGFLKLNGFTINNDTLKSMVSESQGRPGKLFK 1139

Query: 1115 ELYSCFRTRNDALRLCSVILAELFKMLAKSLRHRYGNL--AHDDTSKRDLQEWSTDVKPA 1172
             L++ F  R +  + C ++ +E+ K++A S++  +  +  +   +   ++Q WS+ VKPA
Sbjct: 1140 LLFNYFSNRGEGWKFCKIVTSEVLKIIAISVKPNFSGIFPSSKQSDSSNIQTWSSSVKPA 1199

Query: 1173 LDLKVIEDINFFK 1185
            + L  + D++ FK
Sbjct: 1200 ITLTKVNDVHIFK 1212

>TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3.455
            YPR122W
          Length = 1170

 Score = 1060 bits (2740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/1196 (46%), Positives = 772/1196 (64%), Gaps = 39/1196 (3%)

Query: 1    MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDP 60
            M   Q+K+ ++PF TP S+  RTHKLC+LPNG+L LLISDPTE+            +ND 
Sbjct: 1    MSWSQVKHINVPFFTPLSYSNRTHKLCQLPNGILLLLISDPTESVSACSLTVAAGSYNDS 60

Query: 61   SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120
             ++PG+AHLCEHM+LA GS+KYP PG YH+MI KN GS NAFTTGEQT+FYFELP+   +
Sbjct: 61   DDVPGVAHLCEHMLLAGGSKKYPSPGCYHDMITKNNGSYNAFTTGEQTTFYFELPDFNQA 120

Query: 121  LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180
             + GF++A+D+FASFFSEPLF+ TLINKE YAI++EHD N+S+  KI Y ATRLL + +H
Sbjct: 121  PEAGFEKAIDIFASFFSEPLFDHTLINKEIYAIQNEHDSNVSNVTKILYHATRLLGDKSH 180

Query: 181  PFSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240
            PFSRF+TGN+S+L +               +F+EN+  S+MT+CLRGP S++ LAKLA++
Sbjct: 181  PFSRFATGNMSSLKNTLRLKGPTLRNLLSNHFRENYAPSRMTICLRGPSSVNGLAKLAIS 240

Query: 241  KFSLIKNNPQRYXXXXXXXXXXXXXXXNEWVE--VNPKE-MNISKNTWLPKYRGQLCFTS 297
            KF  ++  P +                NE V+  + P +  NI +  W        CF S
Sbjct: 241  KFGELR--PHK---------------ANEKVQAALTPNDGFNILQTRWGHTKAANNCFPS 283

Query: 298  DEQEKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQS 357
              +   I + S K P +RF+FP  ++ TRFT KD  I    W ELFGDES GSF H+L  
Sbjct: 284  CLERNTICVDSGKLPIMRFLFPVWQKFTRFTKKDFLIFERFWFELFGDESAGSFCHFLVE 343

Query: 358  KGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTLELAQ 417
            KGW+T  YA++S  +  N+ LILEL LT +G+ N+  IA+ L    +P  S+++T++LA+
Sbjct: 344  KGWITNCYAYISRFSTDNTGLILELSLTNSGWHNIELIAQTLIFYLVPKFSREHTVQLAR 403

Query: 418  FMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMMIDEQHHNI 477
            F+S+Q  IDLIRFLY NAE SPM EC NL  ++Q+D+  LD + IF GSPM+++EQ    
Sbjct: 404  FLSEQFSIDLIRFLYSNAENSPMTECSNLCEVLQEDINGLDNSCIFMGSPMVLNEQSTQ- 462

Query: 478  GNYGENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSG--NXXXXXXXXXXXXXFQVDL 535
            G + EN+ES +WWIGQAIKFQSFLK+FM  SNMR+++ G                   D 
Sbjct: 463  GLFSENEESQKWWIGQAIKFQSFLKEFMNHSNMRLILLGCLEDCSLSTTATQGKIAGTDP 522

Query: 536  FYEFEYFKRD---GIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQLKKILNDSSQKSQ 592
            FY+F YF        P  +IL   NDY F IP  +   P  A+++  L + L  SS KSQ
Sbjct: 523  FYDFAYFTCKLSLRKPHANIL---NDYKFSIPPKNEFKPSWAENFPSLMRKLYYSSTKSQ 579

Query: 593  SAPLSFTIHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSFEIFGLDLEACPRN 652
             A L F I ++     P LVSQN  ++MWV+ D    S   K+IVSFEI   +++  P N
Sbjct: 580  QASLGFAIKSDEGTRTPQLVSQNENYDMWVLSDCPASSHQSKAIVSFEISCWEIQPSPEN 639

Query: 653  TMNLEILGQIIFILLSPEIYPSLKLGFTCEI-TSNKGDIRLGFTISGFSKQLTSFVKSII 711
            TMNLEIL Q+I + L+ ++YPSLKLGFT EI  S++GD+RLG  ISG+SK+L   ++S+ 
Sbjct: 640  TMNLEILAQVINLTLASDLYPSLKLGFTFEIYPSSRGDVRLGLVISGYSKRLGKVIESLS 699

Query: 712  ETIKRISQDPDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKYMWTLEDRL 771
              I+R+  +  F S+E  R+ARI VR+ Y+ A + +  N+ SIGL +V+EKYMW+L+DR+
Sbjct: 700  SIIRRLKSEKSFPSRELFRKARISVRSNYDKAEDNSSINVASIGLLVVMEKYMWSLQDRI 759

Query: 772  EALEDIDMDNFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLHRSFTHHLGGGIYETQG 831
            +A+E ID+  FK F  SF   +K+L LF+QGDLS AD++N  L R+ T+HL G   + Q 
Sbjct: 760  DAIECIDLQTFKAFAASFADYRKFLRLFIQGDLSHADDINACLDRNLTNHLHGTQTDFQR 819

Query: 832  KTFTVETTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLN 891
            +     +TK+L+P TN  V++ G+KDDP NS +Y+IQTG R+D   +TLT  + ++MS  
Sbjct: 820  EP-EYCSTKLLDPATNFYVEYPGRKDDPTNSTVYYIQTGPRDDCTAYTLTALSAYMMSFT 878

Query: 892  LALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQ-LQKL 950
            L  ELRNKRQ+GY+V+GGLRLL N+VGLHI+IMS   PL LE KI+EYL YLE + L  +
Sbjct: 879  LKPELRNKRQIGYVVMGGLRLLRNAVGLHISIMSTLEPLALEEKINEYLLYLEREVLTPM 938

Query: 951  DEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEILSSQTMKRHKK 1010
             E TF  +Y++ +L L   G      + SGPADL+ ++VANVQ GDS+IL+S  MK+HK+
Sbjct: 939  TEDTFRNKYLKDFLNLQSKGNLDKLRKDSGPADLMDQIVANVQSGDSDILNSSFMKKHKR 998

Query: 1011 LQTQIIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLRXXXXXXXXXXXAE 1070
            L+ QI   +Y F     A++  L+ +++++ YL FF+  ISIHSK R            +
Sbjct: 999  LRNQIADGRYTFADRDSAINTTLLQELTIDHYLCFFRERISIHSKTRAKLSVMVKSPMTD 1058

Query: 1071 KDIINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSCFRTRNDALRLC 1130
            ++I+N++I+ Q++ FLK+ G  I   +L+++V+RS GKP +LA ELY  F +R++  +LC
Sbjct: 1059 EEIVNRQIYSQVDAFLKLHGLTIETAKLRELVQRSKGKPMLLAKELYQSFHSRHETWKLC 1118

Query: 1131 SVILAELFKMLAKSLRHRYGNLAHDDTSKRDLQEWSTDVKPALDLKVIEDINFFKR 1186
            +V+L EL KML  +L+ R     H   +     EW +   PA  L +I+DIN +++
Sbjct: 1119 TVMLRELLKMLTVNLKFR-----HQRQTNMAASEWGS--TPATGLTLIKDINIYRK 1167

>Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score = 1048 bits (2711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/1213 (44%), Positives = 781/1213 (64%), Gaps = 35/1213 (2%)

Query: 1    MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDP 60
            M  +++  Y++ F  P S+  R HK+CKLPNG+L LLISDPT+             HNDP
Sbjct: 1    MSLREVTNYEVSFHIPLSYSNRAHKICKLPNGILALLISDPTDTSSSCSLSVCTGSHNDP 60

Query: 61   SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120
             +IPGLAHLCEHM+L+AGS+KYPDPG +H +I KN GSQNA+TTGEQT+FYFELPN  ++
Sbjct: 61   MDIPGLAHLCEHMILSAGSKKYPDPGLFHALIAKNNGSQNAYTTGEQTTFYFELPNTQNN 120

Query: 121  LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180
             +  F+  LDVFASFF +PLFN  LI+KE YAI+SEH+ N+SS  KIFY A R+LAN +H
Sbjct: 121  GEFAFESILDVFASFFKDPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANSDH 180

Query: 181  PFSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240
            PFSRFSTGNI +L+SIP           + YF+ NF    +TLC+RG QS++ L KLA++
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKINLKSSLNTYFRSNFFGENITLCIRGSQSVNILTKLAIS 240

Query: 241  KFSLIK-------------NNPQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLP 287
            KF  +K               P R                N++   N ++  I    W  
Sbjct: 241  KFGDVKPKSIVKERHFSIGKGPFR---KSTSLRRSLNSPKNDYR--NLEDFKILDTVWEK 295

Query: 288  KYRGQLCFTSDEQEKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDES 347
            KY+  +CF    +   IFI S+K P +RF+FP  +RNTRFT  DIKI +HLW ELFGDES
Sbjct: 296  KYQNTMCFQHAPECNSIFINSNKMPVMRFLFPVSDRNTRFTKDDIKIYSHLWCELFGDES 355

Query: 348  PGSFSHWLQSKGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPAL 407
            PGS SH+L S+GW+T  +AF SE AIG+  LILEL+LT +G++++ +I   +F + +P+ 
Sbjct: 356  PGSLSHYLVSRGWITKCFAFTSEFAIGDIGLILELELTNSGWKSIKNITTTIFSELLPSF 415

Query: 408  SQKNTLELAQFMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSP 467
              KN   L  F+ +QN IDL RFLYQ++E  PMEEC NLSS +Q++LE L P+ +FKG  
Sbjct: 416  YVKNIDHLVTFLKEQNLIDLARFLYQSSENLPMEECSNLSSFLQENLECLTPSNVFKGFK 475

Query: 468  MMIDEQHHNIGNYGENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNXXXXXX--XX 525
             +I+    NI  Y E K + RWW GQAIKFQ+FLK  M   N R+++ G+          
Sbjct: 476  SLIEIDDPNIEKYEETKANVRWWTGQAIKFQNFLKSHMKHDNTRLLLLGDIKSHKIFHII 535

Query: 526  XXXXXFQVDLFYEFEYFKRD-GIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQLKKIL 584
                  + D FYEFEY+     +  ++     + Y F  P+ +  +PD      +L+++ 
Sbjct: 536  ENKSEIRTDFFYEFEYYTGSVHLAEENKYYPKSSYEFNFPKSNLFLPDYISDPLKLRQLF 595

Query: 585  NDSSQKSQSAPLSFTIHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSFEIFGL 644
             + S KS+ A L   I++   +  P LVS+N  +EMW++ +D + + + KS+VSFE+ GL
Sbjct: 596  LECSLKSKFATLRPQIYSEPTRREPQLVSENLNYEMWILKEDPNFASNNKSVVSFEVLGL 655

Query: 645  DLEACPRNTMNLEILGQIIFILLSPEIYPSLKLGFTCEI-TSNKGDIRLGFTISGFSKQL 703
             ++  P  T++LE+L Q++FI+ S  +YP+L++G+T EI +S+KG + L FTISGF + +
Sbjct: 656  GIKPSPEATIHLEVLAQVLFIITSSHLYPALRIGYTYEIASSSKGSVTLRFTISGFPEGV 715

Query: 704  TSFVKSIIETIKRISQDPDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKY 763
               VK+ ++T+K I+ DP FLSK+TLR+ARI VR+KYE+A+++NC  + SIGL IVLE++
Sbjct: 716  FKIVKTFVDTLKLIATDPTFLSKDTLRKARIFVRSKYESASSDNCVKLASIGLLIVLEEF 775

Query: 764  MWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLHRSFTHHLG 823
            +WTL+DR+ ALE  +M++FK+FC  F  + K L L VQG L  ADE+N YL+R+FT HL 
Sbjct: 776  IWTLQDRINALELTEMESFKEFCSLFWKNPKQLVLLVQGSLDYADEINHYLNRNFTQHLK 835

Query: 824  GGIYETQGKTFTVE-----TTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIF 878
                  +G   T+      +TK L+ GTNA + + G +DDPNNSI+YFIQT +R+D    
Sbjct: 836  VC---NEGSKSTIHLYPSPSTKNLDEGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIENL 892

Query: 879  TLTNFTVFIMSLNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDE 938
             LT  T ++ SL L  +LRN++Q+GY+V+GGLR+L+++VG+H+T+MSG S  +LETKI+E
Sbjct: 893  ALTFLTEYLFSLTLVPDLRNRKQIGYIVLGGLRVLTDTVGIHVTVMSGSSAHNLETKINE 952

Query: 939  YLWYLESQ-LQKLDEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDS 997
            YL YLE Q L  L E  F +  +  +L LL         ES+GP DLL+E+VANVQ GD+
Sbjct: 953  YLSYLELQVLDNLTEIDFRKMLLEPFLTLLKQNSITKFEESAGPVDLLNEIVANVQNGDN 1012

Query: 998  EILSSQTMKRHKKLQTQIIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLR 1057
              L+++ MK+H+K++ +I +++ +F  E E ++   + +++L++YL FF+  ISI+S  R
Sbjct: 1013 YTLNNRQMKQHRKVRNKITEKRLNFQEEYEMVNIPFLQKLTLKKYLRFFQAKISIYSTQR 1072

Query: 1058 XXXXXXXXXXXAEKDIINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMELY 1117
                       AE+ I +++IFLQLE FLKIKGFAI  ++LK IVE S G P +L   L+
Sbjct: 1073 SKISIMIASPMAEEKIASRRIFLQLEAFLKIKGFAIKNEDLKKIVEHSEGSPMLLVKNLF 1132

Query: 1118 SCFRTRNDALRLCSVILAELFKMLAKSLRHRYGNL----AHDDTSKRDLQEWSTDVKPAL 1173
            + FR RN+A +L +V+L E+ K++  + +  YG++    +H+   +     W  D++P +
Sbjct: 1133 THFRKRNEAFKLGTVVLQEILKIIGMNFKQGYGSVLGFSSHNSEGQDVKNFWKNDIEPVI 1192

Query: 1174 DLKVIEDINFFKR 1186
             L+ + D NFF++
Sbjct: 1193 PLQELPDPNFFRK 1205

>YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Haploid
            specific endoprotease that performs one of two N-terminal
            cleavages during maturation of a-factor mating pheromone;
            required for axial budding pattern of haploid cells
          Length = 1208

 Score = 1048 bits (2709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/1211 (44%), Positives = 779/1211 (64%), Gaps = 29/1211 (2%)

Query: 1    MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDP 60
            M  +++  Y++ F  P S+  RTHK+CKLPNG+L L+ISDPT+             HNDP
Sbjct: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60

Query: 61   SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120
             +I GLAHLCEHM+L+AGS+KYPDPG +H +I KN GSQNAFTTGEQT+FYFELPN  ++
Sbjct: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120

Query: 121  LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180
             +  F+  LDVFASFF EPLFN  LI+KE YAI+SEH+ N+SS  KIFY A R+LAN +H
Sbjct: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180

Query: 181  PFSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240
            PFSRFSTGNI +L+SIP           + YF+ NF    +TLC+RGPQS++ L KLAL+
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240

Query: 241  KFSLIKNNPQ----------RYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYR 290
            KF  IK              R                N++ ++  K   I   TW  KY+
Sbjct: 241  KFGDIKPKSAVKERSISIRTRSFRRSKSLKKRQDSSKNDYSDL--KTFKILNTTWEKKYK 298

Query: 291  GQLCFTSDEQEKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGS 350
              +CF    +   IFI S+K P +R +FP  ++NTRFT  DIKI +HLW ELFGDESPGS
Sbjct: 299  NTMCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPGS 358

Query: 351  FSHWLQSKGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQK 410
             S++L SKGW+T  +AF SE AIG+  LILEL+LT +G++N+  I  ++  + +P+    
Sbjct: 359  LSYYLASKGWLTGCFAFTSEFAIGDIGLILELELTNSGWENIKRITTIVLNRLLPSFYVM 418

Query: 411  NTLELAQFMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMMI 470
            N   L  F+ +QN IDL+ FLYQ++E  PMEEC  LS ++QDDLE L P  IFKG   +I
Sbjct: 419  NIDYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFKSLI 478

Query: 471  DEQHHNIGNYGENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNXXXXXXXXXXXXX 530
            +    NI  Y   K + +WW GQAIKFQ+FLK FM   NMR+++ GN             
Sbjct: 479  EIDDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDKMKNK 538

Query: 531  FQV--DLFYEFEYFKRD-GIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQLKKILNDS 587
              +  D FYEFEY+  +  +   +    N+ Y F  P  +  +PD      +L+++  + 
Sbjct: 539  SDICTDFFYEFEYYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQLFLEC 598

Query: 588  SQKSQSAPLSFTIHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSFEIFGLDLE 647
            S KS+ A L   I++   +  P LVS+N  +EMW++ +D + +   KS+VSFE+ GL ++
Sbjct: 599  SLKSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGLGIK 658

Query: 648  ACPRNTMNLEILGQIIFILLSPEIYPSLKLGFTCEI-TSNKGDIRLGFTISGFSKQLTSF 706
              P  T++LE+L Q +FI+ S  +YP+L++G+T EI +S+KG++ L FTISGF + + + 
Sbjct: 659  PSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGVFTI 718

Query: 707  VKSIIETIKRISQDPDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKYMWT 766
            VK+ ++T+K I+ DP FLSK+TLR+ARILVRNKY+NA+++NC  + S+GL IVLEKY+WT
Sbjct: 719  VKTFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKYIWT 778

Query: 767  LEDRLEALEDIDMDNFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLHRSFTHHLGGGI 826
            LEDR+ ALE  ++++F++FC  F  + K+L LF+QG L  AD +N YL+ +FT HL    
Sbjct: 779  LEDRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHLK--- 835

Query: 827  YETQGKTFTVE-----TTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLT 881
               +G   T+      +TK L+ GTNA + + G +DDPNNSI+YFIQT +R+D    TLT
Sbjct: 836  ISNEGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLT 895

Query: 882  NFTVFIMSLNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLW 941
              T ++ SL L  +LRNK+Q+GY+V+GGLR+L+++VG+HIT+MSG S  +LET+I+EYL 
Sbjct: 896  FLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLS 955

Query: 942  YLESQ-LQKLDEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEIL 1000
            YL+ Q L +  E  F +  +  +L LL          S+GP DLL+E+VANVQ GD+  L
Sbjct: 956  YLQLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNGDNYTL 1015

Query: 1001 SSQTMKRHKKLQTQIIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLRXXX 1060
            +++ M++H+K++ +I + + +F  + E +D   + +++L++YL+FF+  ISI+S  R   
Sbjct: 1016 NNKQMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYSAQRSKL 1075

Query: 1061 XXXXXXXXAEKDIINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSCF 1120
                    AEK+I ++K+FLQLE FLKI GFAI  ++LK IVE S G P +L   L++ F
Sbjct: 1076 SIMITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVKNLFTYF 1135

Query: 1121 RTRNDALRLCSVILAELFKMLAKSLRHRYGNLAHDDTSKRDLQE----WSTDVKPALDLK 1176
            R RN+  +L +V+L E+ K++  +L+ RYG++    +   + QE    W+ D  P + L+
Sbjct: 1136 RRRNEVFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSPIVPLQ 1195

Query: 1177 VIEDINFFKRV 1187
             + + NFF++ 
Sbjct: 1196 ELPEPNFFRKA 1206

>NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score = 1045 bits (2702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/1191 (47%), Positives = 776/1191 (65%), Gaps = 19/1191 (1%)

Query: 1    MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDP 60
            M  +++K +D+P   P ++  R HKLC LPNGLLTLLISDP +             HNDP
Sbjct: 1    MSWQEIKDFDVPLYLPLAYSNRVHKLCLLPNGLLTLLISDPADTVTSCSLSVASGSHNDP 60

Query: 61   SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120
             +I GLAHLCEHM+LAAGS+ YPDPG YHE + KN G  NAFTTGEQT+FYFE+PN++H 
Sbjct: 61   KDIQGLAHLCEHMILAAGSKSYPDPGLYHETLSKNNGVHNAFTTGEQTTFYFEVPNVHHG 120

Query: 121  LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180
             +  FDE LD+FASFF EPLFN  L NKE YAI+SEHD N+SS  KI Y ATR+L++  H
Sbjct: 121  GELVFDEILDIFASFFKEPLFNPLLTNKEIYAIQSEHDGNMSSVTKILYHATRMLSDPGH 180

Query: 181  PFSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240
            PFS+FSTGN++TL SIP            +YFK+N+ ASKMTLCLRGPQS++ L K AL+
Sbjct: 181  PFSQFSTGNMNTLASIPKLQGVNLQRTLFQYFKKNYYASKMTLCLRGPQSVNILTKYALS 240

Query: 241  KFSLIKNNP----QRYXXX--XXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLC 294
            KF  IK N      R+                 N   + + +  NI + +W  KY    C
Sbjct: 241  KFGDIKENTALTRSRFGSMSSISTKRSSKSSTENHSTKNDLESFNILEESWRQKYCDIPC 300

Query: 295  FTSDEQEKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHW 354
            F    +E  IFIKSSK P +R +FP  +  TRFT  +IKI   LW ELFGDE+ GS  ++
Sbjct: 301  FPEISKENMIFIKSSKQPTLRILFPVTDNKTRFTKGEIKIFGDLWCELFGDETKGSLCYY 360

Query: 355  LQSKGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTLE 414
            L  K W+T  YA+ S  A+GN  LI+EL LT TG++N   I +++  + +   S++   E
Sbjct: 361  LVGKSWITSCYAYTSSFALGNIGLIIELTLTSTGWENSDTIIEIVLGKLVETFSEQYVHE 420

Query: 415  LAQFMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMMIDEQH 474
            LA FM  QN IDLIRFLYQ  + +PMEEC NLS L+Q+DL+A + AYIFKGSP + D   
Sbjct: 421  LANFMEDQNSIDLIRFLYQVPKKNPMEECSNLSELLQNDLKAPNMAYIFKGSPPITDMHE 480

Query: 475  HNIGNYGENKESDR-WWIGQAIKFQSFLKQFMVQSNMRVVVSGNXXXXXX--XXXXXXXF 531
             N+G  G N E ++ WWI QAIKFQSF+K+FM  SN RV++ G+                
Sbjct: 481  GNVG--GINSEHNQEWWIDQAIKFQSFMKKFMNSSNARVILLGSLERIPELFKKEIQNTL 538

Query: 532  QVDLFYEFEYFKRDGIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQLKKILNDSSQKS 591
              + FYEFEY K   I  K   +  N Y F IP  +  +P   K    L+++  +SS KS
Sbjct: 539  TTEPFYEFEY-KISTINLK-ASQSVNTYEFCIPHKNKFIPSACKGDGVLEQLFLESSLKS 596

Query: 592  QSAPLSFTIHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSFEIFGLDLEACPR 651
            Q + L   I++   +  P LV +N  +EMW + +D +  + LKSIVSFE+   D++  P 
Sbjct: 597  QYSNLHLQINSMSFENKPQLVGRNQRYEMWTLKEDLNSIMDLKSIVSFEVLSTDMKGSPE 656

Query: 652  NTMNLEILGQIIFILLSPEIYPSLKLGFTCEIT-SNKGDIRLGFTISGFSKQLTSFVKSI 710
            NT++LEIL QIIF L+SP++YP++KLG+  EI+ S+KGD++L FTI GFS+ +   ++ I
Sbjct: 657  NTIHLEILNQIIFTLISPQLYPAIKLGYFYEISASSKGDVQLRFTIGGFSEGILMLIEII 716

Query: 711  IETIKRISQDPDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKYMWTLEDR 770
            I+TI  I+  PDF SKE LRRAR+LVR+ YENAA +NC  + S+GL IVLE+ MW+LEDR
Sbjct: 717  IKTIIFITTTPDFPSKELLRRARVLVRSNYENAAADNCVKLASLGLLIVLEENMWSLEDR 776

Query: 771  LEALEDIDMDNFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLHRSFTHHLGGGIYETQ 830
            ++ALED+ M +FK+FCQSFL   KYL+LF+QG+LS AD++N++L+ +FT HL   I +  
Sbjct: 777  IDALEDVTMASFKEFCQSFLNGSKYLTLFIQGNLSYADKINQFLNLNFTKHL--DINKDT 834

Query: 831  GKTFTVET-TKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMS 889
                   T T +L+PGTN   ++ G  DDPNNSI+YFIQTG R+D  + TLT+FT +IMS
Sbjct: 835  SLPLNAHTSTHILKPGTNIFAEYPGPLDDPNNSIVYFIQTGLRSDTDLCTLTSFTEYIMS 894

Query: 890  LNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQ-LQ 948
            L L  ELRNK+Q+GYLV+GGLR+L++++G++IT+MSG  P+DLE+KIDEY+ ++E+  L 
Sbjct: 895  LTLVPELRNKKQIGYLVMGGLRVLTDTIGVYITVMSGSEPIDLESKIDEYIAFIENGVLN 954

Query: 949  KLDEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEILSSQTMKRH 1008
            +L E TF +EY + YL LL    +    + SGPA+LL+E+V NVQ+G S+ L+S +MK H
Sbjct: 955  RLTEATFEREYKQAYLTLLGDNNQNKGGKLSGPANLLNEIVPNVQVGSSDQLNSTSMKLH 1014

Query: 1009 KKLQTQIIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLRXXXXXXXXXXX 1068
            ++ + QI  +QY+F  E   +D  LI +++L  YL+FFK  ISI S  R           
Sbjct: 1015 RRFRNQISDKQYNFTDEELHIDIPLIEKLTLSSYLNFFKDKISIFSPTRSKLSIMITSSM 1074

Query: 1069 AEKDIINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSCFRTRNDALR 1128
            A KDIIN+K +LQLE FLKIKGF I  ++L++IV+ ++G   +L   L++ FR+RN+  +
Sbjct: 1075 AAKDIINRKTYLQLEAFLKIKGFTIKKEKLQEIVDSADGNSSLLIKNLFNYFRSRNEGWK 1134

Query: 1129 LCSVILAELFKMLAKSLRHRYG-NLAHDDTSKRDLQEWSTDVKPALDLKVI 1178
            LC+V+L E+ KM   SL+  Y  +L+     K    +W+  V   ++LK +
Sbjct: 1135 LCTVVLKEVVKMSITSLKQHYNWSLSTKKEDKDKSVDWNGPVSSTVELKKV 1185

>Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score = 1041 bits (2691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/1205 (44%), Positives = 771/1205 (63%), Gaps = 19/1205 (1%)

Query: 1    MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDP 60
            M  +++  Y++P   P S+  RTHK+CKLPNG+L LLISDPT+             HNDP
Sbjct: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLISDPTDTSSSCSLSVCTGSHNDP 60

Query: 61   SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120
             +  GLAHLCEHM+LAAGS++YPD G +H +I KN GSQNA+TTGEQT+FYFELPN   +
Sbjct: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120

Query: 121  LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180
             +  F+  LDVFASFF  PLFN  LI+KE YAI+SEH+ N+SS  KIFY A RLLAN +H
Sbjct: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180

Query: 181  PFSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240
            PFSRFSTGNI +L+SIP           + YFK N+    +T+C+RGPQS++ LAKLA++
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240

Query: 241  KFSLIK--------NNPQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQ 292
            KF  IK        N   R                ++      +   I +  W  KY+  
Sbjct: 241  KFGDIKPKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNS 300

Query: 293  LCFTSDEQEKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFS 352
             CF     +  IFI S+K+P +RF+FP  ++NTRFT +DIKI +HLW ELFGDESPGS  
Sbjct: 301  KCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLG 360

Query: 353  HWLQSKGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNT 412
             +L S+GW+T  +AF SE AIGN  L+LEL+LT +G++++  I   +F + +P+   KN 
Sbjct: 361  SYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKNI 420

Query: 413  LELAQFMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMMIDE 472
              L  F+ +QN ID+ RFLYQ++E  PMEEC NLS+++Q++LE L P+ +FKG   +I+ 
Sbjct: 421  DYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIEI 480

Query: 473  QHHNIGNYGENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNXXXXXXXXXXXXXFQ 532
               NI  Y  ++ + +WWIGQAIKFQ+FLK  M   N R+++ GN              +
Sbjct: 481  DDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEVFDKIEKRSE 540

Query: 533  V--DLFYEFEYFKRDGIPFKDILEWNND-YNFKIPQLDCPMPDIAKSYSQLKKILNDSSQ 589
            +  D FYEFEY+       +D   +    Y F  P  +  +PD      +L+++  + S 
Sbjct: 541  MYTDFFYEFEYYTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFLECSL 600

Query: 590  KSQSAPLSFTIHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSFEIFGLDLEAC 649
            KS+ A L   I +   K +P LVS+N  +EMWV+ +D +     KSIVSFEI GL ++  
Sbjct: 601  KSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEILGLGIKPS 660

Query: 650  PRNTMNLEILGQIIFILLSPEIYPSLKLGFTCEI-TSNKGDIRLGFTISGFSKQLTSFVK 708
            P  T++LE+L Q++FI+ S  +YP+L++G+T EI +S+KG++ L FTISGFS+ + +  K
Sbjct: 661  PEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFSEGVYTIAK 720

Query: 709  SIIETIKRISQDPDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKYMWTLE 768
            + ++T+K+I+ D  FLSK+T+R+ARILVR KYE A+++NC  + SIGL IVLE+YMWTL+
Sbjct: 721  TFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVLEEYMWTLQ 780

Query: 769  DRLEALEDIDMDNFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLHRSFTHHLGGGIYE 828
            DR++ALE  +  +FK+FC  F  + K L L +QG+L  ADE+N YL+ +FT HL     +
Sbjct: 781  DRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYLNNNFTQHLKVSNED 840

Query: 829  TQGKT--FTVETTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVF 886
             +     +   +TK L+ GTN  V + G +DDPNNSI+YFIQT +RND    TLT  T +
Sbjct: 841  NRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESMTLTFLTEY 900

Query: 887  IMSLNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQ 946
            + SL L  +LRNK+Q+GY+V+GGLR+L+ +VG+HIT+MSGG   +LE KI+EYL YL+ Q
Sbjct: 901  LFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSYLQLQ 960

Query: 947  -LQKLDEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEILSSQTM 1005
             L    E  F +  +  +L LL          SSGP +LL+E+VANVQ GD+  L+++ M
Sbjct: 961  VLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGDNYTLNNRQM 1020

Query: 1006 KRHKKLQTQIIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLRXXXXXXXX 1065
            K+H+K++ +II+ ++ F  E E  D   +  ++L++YL FF+  ISI+S+ R        
Sbjct: 1021 KQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSRQRSKLSIMIT 1080

Query: 1066 XXXAEKDIINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSCFRTRND 1125
               AE+DI+++K+FLQLE FLKIKGFAI +++LK IV+ S G P +L   L++ FR RN+
Sbjct: 1081 SPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLFTSFRRRNE 1140

Query: 1126 ALRLCSVILAELFKMLAKSLRHRYGNLAHDDTSKRDLQE----WSTDVKPALDLKVIEDI 1181
            A +L +V+L E+ K++  S + RY ++      K + Q+    W TD+KP + L+ + D 
Sbjct: 1141 AFKLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEHQDIEKFWKTDIKPIIPLQGLPDP 1200

Query: 1182 NFFKR 1186
            N F+R
Sbjct: 1201 NVFRR 1205

>NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1199

 Score = 1031 bits (2667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/1196 (45%), Positives = 763/1196 (63%), Gaps = 14/1196 (1%)

Query: 1    MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDP 60
            M  + ++ YD PF  P  +  R HKLC+LPNG+LTLLISDP +             HNDP
Sbjct: 1    MSWQDVENYDTPFYIPRCYSDRVHKLCRLPNGILTLLISDPKDTISACSLSVATGSHNDP 60

Query: 61   SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120
            +++PGLAHLCEHMVLAAGS+ YP+ G YH M+ KN G+QNAFTTGEQT+FYFE+P   +S
Sbjct: 61   ADLPGLAHLCEHMVLAAGSKDYPNAGLYHSMLTKNNGTQNAFTTGEQTTFYFEVPTTQNS 120

Query: 121  LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180
             +  FD+ +DVF+SFF EPLFN  L NKE YAI+SEH+ N+SS  KI Y ATRL+AN +H
Sbjct: 121  GELIFDKLVDVFSSFFKEPLFNPLLTNKEIYAIQSEHEGNISSLNKILYHATRLMANKDH 180

Query: 181  PFSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240
            PFS+FSTGNI+TL+SIP            +YF  NF  SKMTLC+RGPQS+++L KL ++
Sbjct: 181  PFSQFSTGNINTLSSIPQLKKINLKKALLDYFARNFYGSKMTLCVRGPQSVNTLTKLVVS 240

Query: 241  KFSLIKNNPQRYXXXXXXXXXXXXXXXNEWVEVNPKEM---NISKNTWLPKYRGQLCFTS 297
            KF  I+ N                    +  E  P ++   NI K+TW PKYR   CFT 
Sbjct: 241  KFGDIRANNGLKRSKFGSISSRLSISSFQSKERQPTDLEQYNILKSTWKPKYREAPCFTH 300

Query: 298  D-EQEKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQ 356
            D +    IFI+S+K   +RF+FP  ++ ++F+SK + +  + W ELFGDE+ GS  + L 
Sbjct: 301  DSDSANMIFIRSNKQSTLRFLFPVEDKFSKFSSKTVSLFKNFWCELFGDETKGSLCYLLV 360

Query: 357  SKGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTLELA 416
             K W+T  +A+ SE + G+  LIL+  LT TG+ N+  I  ++ +  I A   K T +L+
Sbjct: 361  GKSWITDCFAYTSEFSSGSYGLILQFALTNTGWDNVDKIINIVLDNTIAAFIDKPTDQLS 420

Query: 417  QFMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMMIDEQHHN 476
             F+ +QN IDLIRFLYQ  E SPMEEC N+S L+Q+DLE LD +Y+FKG+P + D   ++
Sbjct: 421  CFLKEQNTIDLIRFLYQPTEKSPMEECSNISCLLQEDLEDLDISYLFKGAPTISDCYSND 480

Query: 477  IGNYGENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNXXXXXXXXX--XXXXFQVD 534
                   +     W+ QA +FQ FLK FM +SN+ + + GN               F + 
Sbjct: 481  NNTVDMIEYEQECWLKQAREFQEFLKVFMNRSNVFLFLLGNEKIAHSLRSIIRIRYFLLM 540

Query: 535  LFYEFEYFKRDGIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQLKKILNDSSQKSQSA 594
                        + F  +L  +  Y F++P  +  +P   +  + L+++  +SS KS+ +
Sbjct: 541  QCMSLNILNVIYLRFPKLL--STQYTFQVPPPNAFIPPSCQDVTILQQLFLESSLKSRFS 598

Query: 595  PLSFTIHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSFEIFGLDLEACPRNTM 654
                 + N  L  VPHL+S+N  +EMW + +  D S+  KSI+SFEIF   +   P N++
Sbjct: 599  TFRLQLLNTNLGNVPHLISRNSSYEMWALDNPIDASIDKKSIMSFEIFNRSMIPSPENSI 658

Query: 655  NLEILGQIIFILLSPEIYPSLKLGFTCEITSN-KGDIRLGFTISGFSKQLTSFVKSIIET 713
            NLEIL QI+  L+SP++YPS++LG++ EI+S+ KGDI+L  TI GFS+ + S + +I++T
Sbjct: 659  NLEILSQILSTLISPQLYPSIRLGYSYEISSSPKGDIQLKVTIGGFSEGIISILDTIVKT 718

Query: 714  IKRISQDPDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKYMWTLEDRLEA 773
            +  I + P F SKE LRR+R+LVRN YE AA++NC  + S+GL I+LE+ MWTL+DRLEA
Sbjct: 719  LLFIMKTPQFPSKELLRRSRVLVRNLYEAAASDNCVTLASMGLLIILERNMWTLQDRLEA 778

Query: 774  LEDIDMDNFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLHRSFTHHLGGGIYETQGKT 833
            LE+IDM +FK+FC  FL    Y++L +QG+L   +E+N YL+ + THHL     + + ++
Sbjct: 779  LEEIDMVSFKEFCVQFLEEPMYMNLLIQGNLDYGEEINNYLNTNLTHHLECSNVKNEKQS 838

Query: 834  FTVETTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLA 893
             T+ T  +LEPG+N   ++ G  DDPNNSI+YFIQTG R +R   TLT FT +IMSL L 
Sbjct: 839  STLSTI-LLEPGSNFYAKYNGHMDDPNNSIVYFIQTGLRTNRRTVTLTYFTEYIMSLTLV 897

Query: 894  LELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLE-SQLQKLDE 952
             +LRNKRQ+GY V GGLR L++++G+HIT+MSG SP DLE KIDEY+ YLE + L  L E
Sbjct: 898  PDLRNKRQIGYAVFGGLRELTSTIGIHITVMSGISPSDLEIKIDEYIAYLEETLLNSLTE 957

Query: 953  QTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEILSSQTMKRHKKLQ 1012
              F  +Y + YL LL      +  +S GPADLL+E+VANVQ G+++ L+S  MK HK   
Sbjct: 958  NQFTLQYKQGYLDLLSNHKFMELEKSGGPADLLNEVVANVQSGNADELNSHFMKSHKHFF 1017

Query: 1013 TQIIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLRXXXXXXXXXXXAEKD 1072
             +I  ++Y F  +SE +D ++I  ++ +++L FF+  +SI SK+R           AE +
Sbjct: 1018 NEISNKRYQFKGDSELVDIEVIKNLTKKEFLKFFREKVSIKSKVRSKISVMIESPMAEME 1077

Query: 1073 IINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSCFRTRNDALRLCSV 1132
            I+N+K FLQL+ FLK++GF I ++ L+DIVER+NG+P  L  +L+  FR RN+ALRLC+V
Sbjct: 1078 IVNRKTFLQLQAFLKLEGFTINSEILRDIVERANGRPSALIKDLFKYFRERNEALRLCTV 1137

Query: 1133 ILAELFKMLAKSLRHRYGNLAHDDTSKRDLQE---WSTDVKPALDLKVIEDINFFK 1185
            IL E+ K+ A SL+HRY         K   Q    W  D +PA+ LK I+D+N FK
Sbjct: 1138 ILKEVVKVSASSLKHRYTPKVSSSKMKPKRQSSSNWDQDTEPAIPLKEIKDLNEFK 1193

>Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR122W
            (REAL)
          Length = 1218

 Score = 1030 bits (2664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/1218 (44%), Positives = 773/1218 (63%), Gaps = 35/1218 (2%)

Query: 1    MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDP 60
            M  +++  Y+IPF  P S+  RTHK+CKLPNG+L L+ISDPT++            HNDP
Sbjct: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILALIISDPTDSSSSCSLSVCTGSHNDP 60

Query: 61   SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120
             +IPGLAHLCEHM+LAAGS+KYPDPG +H +I KN GSQNAFTTGEQT+FYFELPN   +
Sbjct: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120

Query: 121  LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180
             +  F+  LDVFASFF EPLFN  LI KE YAI+SEH+ N+SS  KIFY A R+LAN +H
Sbjct: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180

Query: 181  PFSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240
            PFS FSTGNI +L+S+PH          + YFK NF    MTLC+RG QS++ L KLA++
Sbjct: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240

Query: 241  KFSLI--KNNPQ----------------RYXXXXXXXXXXXXXXXNEWVEVNPKEMNISK 282
            KF  I  KN+ +                                 +     N +   IS 
Sbjct: 241  KFGDISLKNDIKGSNFSIKAGSFRRSRSLRRSQDASKTGSPTSESSNTSSYNLENSKISD 300

Query: 283  NTWLPKYRGQLCFTSDEQEKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPEL 342
              W  KY    CF +  +   IFI SSK P VRF+FP  ++NTRFT +DIK+ +HLW EL
Sbjct: 301  TVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWREL 360

Query: 343  FGDESPGSFSHWLQSKGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQ 402
            FGDESPGS SH+L SKGW T S+AF+SE AIGN  L+LEL+LT+TG++++  IA  +F +
Sbjct: 361  FGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSK 420

Query: 403  AIPALSQKNTLELAQFMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYI 462
             +P+   KN   L  F+ +QN ID+ RFLYQN+E  PMEEC +LS ++Q++LE L P  I
Sbjct: 421  LLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNI 480

Query: 463  FKGSPMMIDEQHHNIGNYGENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNXXXXX 522
            FKG   +I+    NI  Y  NK + +WW GQAIKFQ+FLK FM   N R+++ G+     
Sbjct: 481  FKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKSHN 540

Query: 523  XXXXXXXXFQV--DLFYEFEYF-KRDGIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQ 579
                     ++  + FYEFEY+  R  +         + Y F  P  +  +PD      +
Sbjct: 541  LFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDFVNDPLK 600

Query: 580  LKKILNDSSQKSQSAPLSFTIHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSF 639
            L+++  + S KS+ A L   I +  ++ +P LVS+N  +EMWV+ +D + +    S+VSF
Sbjct: 601  LQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVVSF 660

Query: 640  EIFGLDLEACPRNTMNLEILGQIIFILLSPEIYPSLKLGFTCEI-TSNKGDIRLGFTISG 698
            E+ GL ++  P  T++LE+L QI+FI  S  +YP+L+ G+T EI +S+KG++ L FTISG
Sbjct: 661  EVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTISG 720

Query: 699  FSKQLTSFVKSIIETIKRISQDPDFLSKETLRRARILVRNKYENAANENCANIGSIGLYI 758
            FS+ +    K+ ++T+K I  DP F SK+ LR+ARILVR+KYE+A+++N   + SIGL I
Sbjct: 721  FSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGLLI 780

Query: 759  VLEKYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLHRSF 818
            VLE+YMWTL+DR++ALE  DM++ K FC  F  + K L+L +QG+L  ADE+N YL+ +F
Sbjct: 781  VLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLNNNF 840

Query: 819  THHLGGGIYETQGKTFTVE-----TTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRN 873
            T HL       +G   T+       TK ++PGTNA +   G +DDPNNS+ YFIQT +R+
Sbjct: 841  TQHLKVC---DEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRD 897

Query: 874  DRMIFTLTNFTVFIMSLNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLE 933
            +    TLT  T +I S  L  +LRNK+Q+GY+V+ GLR+L++++G+HIT+MSG S   LE
Sbjct: 898  NIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLE 957

Query: 934  TKIDEYLWYLESQ-LQKLDEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVANV 992
            TKI+EYL YLE Q L    E TF    +  +L LL           SGP++LL+E+VANV
Sbjct: 958  TKINEYLSYLEFQVLNNFTESTFRTMLLEPFLALLKKNNFNKLKTLSGPSNLLNEIVANV 1017

Query: 993  QIGDSEILSSQTMKRHKKLQTQIIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYISI 1052
            Q GD  IL+++ MK H++++  I +++  F  E+E +D   + +++L++YL FF   ISI
Sbjct: 1018 QNGDDYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFFGSRISI 1077

Query: 1053 HSKLRXXXXXXXXXXXAEKDIINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKIL 1112
            +S+ R           AE++I ++K+FLQLE FLKIKGFAI + +L+ IVE S G P +L
Sbjct: 1078 YSRQRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLL 1137

Query: 1113 AMELYSCFRTRNDALRLCSVILAELFKMLAKSLRHRYGNL---AHDDTSKRDLQE-WSTD 1168
               L++ FR R++A +L +V+L E+ K++A + +  YG++   +  D+ ++ + + W +D
Sbjct: 1138 LKNLFTFFRKRSEAFKLGTVVLKEISKIIAINFKQTYGSVLGFSSKDSEQQTIDKYWKSD 1197

Query: 1169 VKPALDLKVIEDINFFKR 1186
            V+P + L+ +   + F++
Sbjct: 1198 VEPIVPLRELPGPDVFRK 1215

>KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  994 bits (2569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/1208 (43%), Positives = 771/1208 (63%), Gaps = 33/1208 (2%)

Query: 1    MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDP 60
            M   +++++D+   TP S+  RTHKLC LPNG+ TLLISDP +             HNDP
Sbjct: 1    MSWTEVRHHDVQLCTPLSYSNRTHKLCTLPNGIPTLLISDPADTSSACSLTVATGSHNDP 60

Query: 61   SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120
              IPGLAHL EHM+LAAGS++YPDPG YHE+I KN GSQNAFTTGEQT+FYFELP+ +  
Sbjct: 61   PNIPGLAHLAEHMILAAGSKQYPDPGLYHELISKNNGSQNAFTTGEQTTFYFELPDTHKQ 120

Query: 121  LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180
             +  FD+ LDVFASFF  PLFNS++INKE YAIE+EH  N+S Q KI Y +TRLLAN  H
Sbjct: 121  GELEFDKVLDVFASFFKNPLFNSSIINKEIYAIENEHTNNMSRQTKILYHSTRLLANKFH 180

Query: 181  PFSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240
            PFS+F+TGNI +L++               YF E+F A+KMTLCLRGP S++ L KLA+ 
Sbjct: 181  PFSQFTTGNIFSLDNNSQLRSISIKSLLVNYFAEHFKANKMTLCLRGPHSVNVLTKLAIA 240

Query: 241  KFSLIK--NNPQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSD 298
            KFS IK  N+ QR                  + ++  +  NI +N W  +Y    CF ++
Sbjct: 241  KFSDIKSQNDLQRNKFGSISSKRDSRQPRQGYSKI--ESSNILENIWSKRYANLPCFVNE 298

Query: 299  EQE-KFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQS 357
             ++   IFIKS K P VRF+FP   ++T FT ++I + ++ W  LFGDES GS  H+L  
Sbjct: 299  SKKVNSIFIKSKKKPLVRFLFPLSSQSTIFTQREIILFSNFWCTLFGDESEGSLMHFLVE 358

Query: 358  KGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTLELAQ 417
            KGW T  +++VS  A+G+  L++EL LT +G   ++ I  VLFE+ +  L+ K+T  +A 
Sbjct: 359  KGWSTSGHSYVSTFAVGSIGLVIELALTNSGVGQITDIINVLFEKIVKILTTKHTTLMAD 418

Query: 418  FMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMMIDEQHHNI 477
            F+++QN I+ +RFLY+  E  PMEEC +LS L+Q++++ LD  Y+FKGSP  I + +   
Sbjct: 419  FLNEQNIIEQVRFLYRGVEKDPMEECSDLSGLLQENMQVLDIKYLFKGSP-SITQLYSGK 477

Query: 478  GNYGENKESDR-WWIGQAIKFQSFLKQFMVQSNMRVVVSGNXXXXX---XXXXXXXXFQV 533
              Y E+    +  W   AIKFQ+FL  FM   N+R++  G+                F+ 
Sbjct: 478  NQYSESMTDGKIQWTAYAIKFQNFLLTFMNYENLRLLFLGSNAKETRLITKEKKRIEFET 537

Query: 534  DLFYEFEYFKRDGIPFKDILEWNND-----YNFKIPQLDCPMPDIAKSYSQLKKILNDSS 588
            D FYEF++++     F D  + ++D     Y F +P  +  +P   +SY+ L++   +SS
Sbjct: 538  DFFYEFDFYR----TFTDFRKCSSDIETENYIFTLPSSNLFIPKSCRSYTYLQQAFQESS 593

Query: 589  QKSQSAPLSFTIHNNLLKPVPHLVSQNCYHEMWVMP--DDEDPSLHLKSIVSFEIFGLDL 646
             KS+ A L   +    +   P LVS +  +EMW +P   +  PSL  K+IV+FE+   ++
Sbjct: 594  LKSKLASLRPQVQIEKIHFAPTLVSDSPNYEMWTLPCAINSSPSLRSKTIVTFELISTNM 653

Query: 647  EACPRNTMNLEILGQIIFILLSPEIYPSLKLGFTCEI-TSNKGDIRLGFTISGFSKQLTS 705
                 +T++LEIL Q++F L+S ++YPSLKLG++ +I +S+KGD+RL FTISGFS+ L  
Sbjct: 654  IPSAESTIHLEILAQLLFYLVSSKLYPSLKLGYSYDIASSSKGDVRLKFTISGFSEGLLL 713

Query: 706  FVKSIIETIKRISQDPD--FLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKY 763
             ++ II+++  I++D +  +++ E LR+AR+LVR KY+ A  ENCA +GS+GL I+LE +
Sbjct: 714  VLEEIIQSVLHIAKDKENIYVTNELLRKARVLVRRKYDEACCENCAKLGSVGLLILLESF 773

Query: 764  MWTLEDRLEALEDIDMDNFKQFCQSFL-GSKKYLSLFVQGDLSCADELNEYLHRSFTHHL 822
            +WTLEDR++ALED DM +FK F   FL  S  Y +LF+QG+L  A E++ YL+ + THHL
Sbjct: 774  LWTLEDRIDALEDTDMTSFKNFVNEFLFESFNYFTLFIQGNLDRAHEIHHYLNDNLTHHL 833

Query: 823  GGGIYETQGKTFTVETTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTN 882
                   +        TK+L+ G+N  V + G ++DPNN+I+YFIQ+G R+D + +TLT 
Sbjct: 834  D---ILPEKVILNKPRTKILQEGSNFFVAYDGHEEDPNNAIVYFIQSGLRSDSIAYTLTA 890

Query: 883  FTVFIMSLNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWY 942
            FT ++MS+ L  +LR+K+Q+GY+V+GG+R+L +S+GLHIT++SG  P DLE KIDEY+ +
Sbjct: 891  FTEYLMSMTLLPDLRHKKQIGYIVVGGMRVLVDSIGLHITVVSGTPPQDLEDKIDEYMNF 950

Query: 943  LES-QLQKLDEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEILS 1001
            LE   L +L E+ F  +YV+ YL +L+G   G  N ++G  +LL+++V+NV  G+ EIL+
Sbjct: 951  LERIILGRLTEEEFRNQYVQNYLDMLNGKNNGTLNGTAGAHNLLNDIVSNVANGEYEILN 1010

Query: 1002 SQTMKRHKKLQTQIIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLRXXXX 1061
            S  M+ HK+L  QI  + + F+ + E ++ ++I  ++L+ Y+ FFK  ISIHS  R    
Sbjct: 1011 SSEMREHKRLWNQISDDDHSFLDDIELINREVIETLTLKGYMQFFKKKISIHSNKRSKLS 1070

Query: 1062 XXXXXXXAEKDIINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSCFR 1121
                    E +IIN+K+FLQLE FLKIKGFAI +++LK+IV++++GKP ++   L S FR
Sbjct: 1071 VMVTSPMPENEIINRKLFLQLEAFLKIKGFAIKSNQLKEIVDKADGKPSVVLKLLLSEFR 1130

Query: 1122 TRNDALRLCSVILAELFKMLAKSLRHRYGNL----AHDDTSKRDLQEWSTDVKPALDLKV 1177
             RN+A +L   +L E+ K   ++L+HRYG +       D S    +  +  VKP + LK 
Sbjct: 1131 ERNEAWKLLRAVLKEVLKTTGQTLKHRYGKVLPSPTKSDNSASLEKSSNYSVKPVIPLKR 1190

Query: 1178 IEDINFFK 1185
            IED+N FK
Sbjct: 1191 IEDLNIFK 1198

>SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1183

 Score =  966 bits (2498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/1157 (44%), Positives = 727/1157 (62%), Gaps = 14/1157 (1%)

Query: 1    MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDP 60
            M S  ++ +D+ F TP S   R+H++ +L NG+L LLIS+P E             HNDP
Sbjct: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60

Query: 61   SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120
             EI GLAH CEHM+L+AGS+ YPDP  YH++I KNGGSQNAFTTGEQT+F FELPN+ +S
Sbjct: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120

Query: 121  LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180
             +  FD+ LD+F+S F +PLFN  L+NKE YAI SEH  N SS+ KIFY ATRLLANG+H
Sbjct: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180

Query: 181  PFSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240
            PFS+FSTG+I+TL+ I             +YFK NF A  M LC++GPQS+++L KL  +
Sbjct: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240

Query: 241  KFSLIKNNPQRYXXXXXXX---XXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTS 297
            KF+ IK  P                     N+   +  +   I    WL KY     FT 
Sbjct: 241  KFNDIKGLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTG 300

Query: 298  DEQEKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQS 357
             +    + + S K PA+R IFP   R TR T K+I +L+  W ELFGDES GS  H+++ 
Sbjct: 301  CDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKK 360

Query: 358  KGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTLELAQ 417
              ++T   AF+S  A+ ++ LILEL LT TG++NL  I  V F + +P + +  T ELA+
Sbjct: 361  NDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAE 420

Query: 418  FMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMM-IDEQHHN 476
            F+S+ NCI+L++FLYQ+  +S MEEC NLSSL+  D+E+L P++I KG+PM   +E    
Sbjct: 421  FLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNPMNDCNEIDSE 480

Query: 477  IGNYGENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNXXXXXXXXXXXXXFQVDL- 535
            +G++ E++ES  WWIG AIKFQSF+K+F+   N+R+V+ G+              ++++ 
Sbjct: 481  LGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKTDLTSLKLNIE 540

Query: 536  -FYEFEYFK--RDGIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQLKKILNDSSQKSQ 592
             +YEFEY K   D   FK  +E    Y+F IP  +  +P +  + S +K  L  SS +SQ
Sbjct: 541  PYYEFEYHKCRSDQSNFKLTVE-EISYSFHIPYKNVFLPSVGFNLSLIKNALLASSNRSQ 599

Query: 593  SAPLSFTIHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSFEIFGLDLEACPRN 652
            +A LS    N     +P L+ +NC++EMWV  +D + +   KSIV+FEI    L   P  
Sbjct: 600  TAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSY 659

Query: 653  TMNLEILGQIIFILLSPEIYPSLKLGFTCEI-TSNKGDIRLGFTISGFSKQLTSFVKSII 711
            TM LEIL +++  +LS ++YPS K+G+T EI  S+KGD+R+GFT+SGFS+ +   ++ I+
Sbjct: 660  TMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIV 719

Query: 712  ETIKRISQDPDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKYMWTLEDRL 771
             T+ +I      ++++  R++RI VRNKYE AA+ N   + +IGL IVLEKYMW LE RL
Sbjct: 720  GTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESRL 779

Query: 772  EALEDIDMDNFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLHRSFTHHLGGGIYETQG 831
            EALE  DM++FKQF   F G+  Y++LF+QGD +  D++N +L R+ T HL         
Sbjct: 780  EALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKK--RDAV 837

Query: 832  KTFTVETTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLN 891
            K     T+ +L+PG+N  + H G KDDPNNSI+YFIQTG R D   +TLT FT F++SL 
Sbjct: 838  KILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFTAFLISLT 897

Query: 892  LALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQ-LQKL 950
            L  +LR ++QVGY+V+GGLR LS++VGLHITI S   P  LE KI EYL YLE   L  L
Sbjct: 898  LVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLEKDLLDNL 957

Query: 951  DEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEILSSQTMKRHKK 1010
              Q F ++YV+ YL ++  G          P +L+S + ANV+ G+ + +  +TMK H++
Sbjct: 958  KPQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSGNLDRV-GRTMKSHRR 1016

Query: 1011 LQTQIIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLRXXXXXXXXXXXAE 1070
            ++ QI  ++Y+F  E E +D  LI  +    Y+ FFK  ISI+S LR           + 
Sbjct: 1017 IRAQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLRSKISVMVSSPMSR 1076

Query: 1071 KDIINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSCFRTRNDALRLC 1130
             +I N+K+FLQLE+FLK+KGF I  ++L+ IV +S+GKP +L  EL+  F +R ++L++C
Sbjct: 1077 SEIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELFRYFASRGESLKIC 1136

Query: 1131 SVILAELFKMLAKSLRH 1147
            +V+L E+ + L+ SL++
Sbjct: 1137 TVMLKEITRQLSSSLKN 1153

>Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON}
            similar to Ashbya gossypii AGR251C
          Length = 1196

 Score =  919 bits (2374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/1200 (40%), Positives = 723/1200 (60%), Gaps = 23/1200 (1%)

Query: 2    VSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPS 61
            ++K+  ++D+   TP S   R+H++ +L N LL LLISDP+E             HNDP 
Sbjct: 3    LNKKPVFFDVTLYTPISSSKRSHRIIQLSNNLLALLISDPSETIASCAISVATGSHNDPP 62

Query: 62   EIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSL 121
            E+PGLAH CEHMVL++GS+KYP+P ++HE + +N GS+NA TTGEQTSFYFE+P+   + 
Sbjct: 63   ELPGLAHFCEHMVLSSGSKKYPEPNFFHESLTRNNGSKNAHTTGEQTSFYFEVPHTTSAE 122

Query: 122  QEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHP 181
               F++ +D+ A+ F EP+F+  L+NKE YAI SEH  N S+  K+ Y ATRLLAN NHP
Sbjct: 123  LHVFEQLIDILAASFKEPVFHDILVNKEIYAIHSEHMGNKSTLSKMLYHATRLLANENHP 182

Query: 182  FSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTK 241
            FS FSTGN+ TL ++P            +YFKE+F A KM +C+RG QS++ L+KLA  K
Sbjct: 183  FSHFSTGNVFTLTNMPRVNKLNLKTELIKYFKEHFRAEKMVVCIRGSQSLNQLSKLAQLK 242

Query: 242  FSLIKNNPQRYXXXXXXXXXXXXXXXNEWVE--------VNPKEMNISKNTWLPKYRGQL 293
            F  I  +                   N             +  E  I K+TWLP+Y  + 
Sbjct: 243  FGDIPGSAAAGSPTSSPLKLKSWRSSNSITSSVDTSSTLASLDESRILKDTWLPRYSKEP 302

Query: 294  CFTSDEQEKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSH 353
             FT   +   + I+S K P +RFIFP    +TRFT K+I   T  W ++ GDE  GSF H
Sbjct: 303  VFTPRPKYNSMMIQSKKPPVIRFIFPVNYLSTRFTDKEIATYTKAWCDIIGDEGYGSFCH 362

Query: 354  WLQSKGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTL 413
            +L+   +++   AF S  A+ +  LIL+L LT  G+ N+S I  + ++  +  +   +  
Sbjct: 363  FLRQNNYISDLLAFSSSFAVNDDGLILQLHLTNYGWANVSIIVPLFWKYTVNTILDTSLS 422

Query: 414  ELAQFMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMMI--- 470
            ++ Q++S+ N IDL++FLYQ+ E SPME C  L   +  DL  + P +I K S +M    
Sbjct: 423  KIGQYLSELNSIDLLKFLYQDVERSPMERCAELCDQLMQDLSVVPPPFILKTSGLMFDCN 482

Query: 471  DEQHHNIGNYGENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNXXXXXXXXXXXXX 530
            D +   IG+Y E++ S  WW GQAIKFQ+F+K+F    N+++++ G              
Sbjct: 483  DPRIQKIGSYSESQNSTDWWRGQAIKFQTFVKEFTTIENVKMIMLG-PLSKCPFYSNSMQ 541

Query: 531  FQVDLFYEFEYFKRDGIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQLKKILNDSSQK 590
               D  YE++Y K   I   ++   +N+Y F IP  +  +  +    S +KK L  +S +
Sbjct: 542  LTADTHYEYDYLKA-YIEITELEAIDNEYEFHIPSPNQFLVPVGHKLSYIKKALLAASAQ 600

Query: 591  SQSAPLSFTIHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSFEIFGLDLEACP 650
            S+++ L     ++LL+  P L  +N ++E+W   +D + S   KSIVS E+    L+  P
Sbjct: 601  SENSSLFIVTQSDLLQTTPSLAGKNAFYELWTKEEDINLSFKSKSIVSLEVISTTLKPAP 660

Query: 651  RNTMNLEILGQIIFILLSPEIYPSLKLGFTCEIT-SNKGDIRLGFTISGFSKQLTSFVKS 709
              TM LEILGQ++F ++SP +YP+ + G+T E++ S+KGD+RLG T+SGF++ +   +  
Sbjct: 661  EYTMQLEILGQLLFSIISPVLYPAERAGYTYELSLSSKGDVRLGITLSGFTEGIMGILNI 720

Query: 710  IIETIKRISQDPDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKYMWTLED 769
            I++++  + +D   +SK   RRAR++VR KYE AA+ENCA + S+GL IVLE  MWTLED
Sbjct: 721  ILDSLLELGEDSVEISKGMFRRARVMVRTKYEEAASENCATLASLGLLIVLEGCMWTLED 780

Query: 770  RLEALEDIDMDNFKQFCQSFLGSKKYLSLFVQG-DLSCADELNEYLHRSFTHHLGGGIYE 828
            RL ALEDIDM++F QF + F+  + YL+L VQG DLS AD++N+ +    THH+     E
Sbjct: 781  RLNALEDIDMESFVQFMKLFINGRNYLNLLVQGSDLSLADKVNDCVDAKLTHHMSS--LE 838

Query: 829  TQGKTFTVE-TTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFI 887
            T GK   VE TT  +  G+N CV+  G  DDPNNSI+YFIQTG R++   +TLT FT F+
Sbjct: 839  T-GKNILVEPTTHFIPRGSNLCVKKSGSHDDPNNSIVYFIQTGTRDNNYAYTLTVFTEFL 897

Query: 888  MSLNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQ- 946
            MS+ L  +LR K+Q+GY+V+GGLR+LS++VGLHIT MS   P  LE KIDEYL YLES  
Sbjct: 898  MSMTLVPDLRGKKQIGYVVLGGLRVLSDTVGLHITTMSSNPPEYLEKKIDEYLSYLESMV 957

Query: 947  LQKLDEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEILSSQTMK 1006
            L KL+ + F   Y+  +L+L++        ++SGPA+L+S++ ANV+ G      S  MK
Sbjct: 958  LMKLNNEQFKMNYLNKFLRLVESNSLSKIEKTSGPANLMSQIEANVRSGSQN--GSMAMK 1015

Query: 1007 RHKKLQTQIIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLRXXXXXXXXX 1066
             HK+++ QI   +Y+F  E E ++   I  ++L +Y++FF   IS++SK R         
Sbjct: 1016 SHKRIRNQISYRRYNFEEEDEPINAKTIRNLTLREYMAFFHEKISVYSKSRAKMSVMVTS 1075

Query: 1067 XXAEKDIINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSCFRTRNDA 1126
              ++ ++ +K +FLQ+E+FLK+KGF IP+++LK I+ +S GKP +L   L+S FR R ++
Sbjct: 1076 PMSKDEVQSKMMFLQIESFLKMKGFNIPSEDLKSIIVKSGGKPTVLLKHLFSYFRVRGES 1135

Query: 1127 LRLCSVILAELFKMLAKSLRHRYGNLAHDDT-SKRDLQEWSTDVKPALDLKVIEDINFFK 1185
            ++L + I+ E+ K  +          +   T +   LQ  S  V PA+ L  + D+N ++
Sbjct: 1136 IKLLTAIVKEIVKQASNKPPGSAAKTSATPTGTSGTLQAMSQTVAPAVPLIEVTDVNSYR 1195

>KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1197

 Score =  887 bits (2293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/1175 (40%), Positives = 708/1175 (60%), Gaps = 43/1175 (3%)

Query: 1    MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDP 60
            M    ++ YDI F  P +F  RTHKLCKLPNG+L LLISDP +N            HNDP
Sbjct: 1    MTWAAVQNYDIQFRIPLAFSHRTHKLCKLPNGVLALLISDPEDNASVCSVTVATGSHNDP 60

Query: 61   SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120
              +PGLAHLCEHM+ AAGS+KYPD   YH+ + K GG+ NA+TTGEQT+F+  +PN+   
Sbjct: 61   KGVPGLAHLCEHMLFAAGSKKYPDVDKYHQTLSKTGGTHNAYTTGEQTTFHISVPNMNRE 120

Query: 121  LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180
             +  FD  LD+F+SF  EPLFNST +NKE YAI+SEHD N+SS  KI YQA RL+ANGNH
Sbjct: 121  GELEFDCILDMFSSFLKEPLFNSTAMNKEIYAIQSEHDSNVSSLSKILYQAIRLMANGNH 180

Query: 181  PFSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240
            PFS+FSTGNI TL ++P             YF+ NF    +T+C++G QS++ L KLALT
Sbjct: 181  PFSQFSTGNIHTLKNMPLVTGMNLRTLLVNYFETNFQPRNITVCIKGSQSVNILTKLALT 240

Query: 241  KFSLIKNNPQRYXXXXXXXXXXXXXXXNEWVEVNPKEM------NISKNTWLPKYRGQLC 294
             F  I+++                    + +  N K++       I +  W  KY+   C
Sbjct: 241  NFGYIQSS-----RAAKGNVIRRSISKRDSIRSNGKKLKKIESFRILEKAWKAKYKDIKC 295

Query: 295  FTSDEQEKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHW 354
            F  D++  F+ IKS+K   +RF+FP  E    FT K++KI + +W ELFGDES GS   +
Sbjct: 296  F--DDRNNFMIIKSNKQSTMRFLFPVNESGANFTPKELKIFSGIWRELFGDESKGSLHSY 353

Query: 355  LQSKGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTLE 414
               K W+T +  ++S+   G   LIL+  LT +G++NL  I   +F+  +  +  +N   
Sbjct: 354  FIEKSWITETTTYISDFTYGVYGLILQFSLTASGWENLREIISKVFKGTLELVRWENLNS 413

Query: 415  LAQFMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMMIDEQH 474
            L++ + +   I+ I +LYQ  E+   + C  L+ L+Q  L   +  Y+FK SP +I+  +
Sbjct: 414  LSRILFEHTTIEYINYLYQEQEVLSSDFCSELTELLQHSLRTPELEYLFKESPNLIELNN 473

Query: 475  HNIGNYGENKES-DRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNXXXXXX---XXXXXXX 530
                ++ EN  +   WW  QA+KFQ+F+ +FM  +N+++ + G+                
Sbjct: 474  ----DHSENLMTVTPWWFDQAMKFQNFINEFMKVTNVKLFLLGSELKHNAFFELGSQNKD 529

Query: 531  FQVDLFYEFEYFKRDGIPFKDILE----WNNDYNFKIPQLDCPMPDIAKSYSQLKKILND 586
            +  D +Y F+Y K   + FK I++      NDY+  +P  +  +P   ++ + L++I  +
Sbjct: 530  WSTDAYYGFDYIK-SHLNFKQIIDEPCTTVNDYSLALPSKNLFIPQFFQNLANLQQIFME 588

Query: 587  SSQKSQSAPLSFTIHNNLL-KPVPHLVSQNCYHEMWVMPDDEDPS-------LHLKSIVS 638
             S +S+ A L   +  ++L    P LV+++ ++EMW++P D++P        +  +S V+
Sbjct: 589  YSLRSRFAVLQPQVPTSMLPNQKPRLVNRSSHYEMWILPIDKEPESVASPDRIPKQSTVT 648

Query: 639  FEIFGLDLEACPRNTMNLEILGQIIFILLSPEIYPSLKLGFTCEI-TSNKGDIRLGFTIS 697
            F I  L +     NTM+LEILG+++  LL+ ++YPSL+L +  EI TS KGD++L  TI 
Sbjct: 649  FSIESLTMTPSSMNTMHLEILGEVLNFLLTSDLYPSLQLSYAYEIATSLKGDVQLCCTIC 708

Query: 698  GFSKQLTSFVKSIIETIKRISQDP---DFLSKETLRRARILVRNKYENAANENCANIGSI 754
            GFS  +      I+ T++ I  DP   + ++   LR+ARI VR+KYE A++E C  + S+
Sbjct: 709  GFSDGVVKITDYILSTLRLIG-DPATANIVTNSLLRKARIQVRSKYEAASSEICVKLASM 767

Query: 755  GLYIVLEKYMWTLEDRLEALEDIDMDNFKQFCQSFL--GSKKYLSLFVQGDLSCADELNE 812
            GL IVLE+ MWTLEDRLEALED DM +F+QFC  F+   S  YL+LFVQGD+  ADE+N 
Sbjct: 768  GLLIVLERGMWTLEDRLEALEDSDMSSFQQFCHEFVMNDSGNYLNLFVQGDMRYADEVNC 827

Query: 813  YLHRSFTHHLGGGIYETQGKTFTVETTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRR 872
             +H   THHL      T    +   TT +L+PG N  V++ GQ DDPNNSI++F+Q G R
Sbjct: 828  LIHSKLTHHLNSSRCSTPTTDYRRSTT-VLKPGVNYYVEYPGQGDDPNNSIVHFVQVGLR 886

Query: 873  NDRMIFTLTNFTVFIMSLNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDL 932
            NDR  FTL +FT ++M L L  +LR K+Q+GY+V+GGLR+++++VGLHIT+MS G  LDL
Sbjct: 887  NDRAAFTLAHFTAYLMHLTLVPDLRYKKQIGYVVLGGLRIMTDTVGLHITVMSAGQCLDL 946

Query: 933  ETKIDEYLWYLE-SQLQKLDEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVAN 991
            E KIDEY+ YLE + L  L E  F + Y++ Y++L+     G+ + S GP +LLSE+  N
Sbjct: 947  EDKIDEYMMYLEDTVLNALTESQFEEIYLKPYIRLIGEHTVGEMDTSGGPTNLLSEIYPN 1006

Query: 992  VQIGDSEILSSQTMKRHKKLQTQIIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYIS 1051
            VQ G S +L    MKRHK+L   I  ++YDF+  ++ LD  ++  ++L +Y++FFK  +S
Sbjct: 1007 VQNGHSSVLEGIDMKRHKQLWNLIQAKEYDFLQGNDILDRTVVQGLTLHRYMTFFKEKLS 1066

Query: 1052 IHSKLRXXXXXXXXXXXAEKDIINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKI 1111
              S  R             ++I+N+++FLQ+ETFLK+KGFAI   EL+DIV +S G P  
Sbjct: 1067 ARSTTRSKISIMIDSPMKREEIMNRQMFLQMETFLKMKGFAIKDTELRDIVNKSQGSPTQ 1126

Query: 1112 LAMELYSCFRTRNDALRLCSVILAELFKMLAKSLR 1146
            L   L + F+TR +  +LC VI  E+ K+LA  +R
Sbjct: 1127 LLRHLLAHFKTRGENWKLCRVIAKEVGKLLALGVR 1161

>TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1202

 Score =  886 bits (2289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/1207 (40%), Positives = 729/1207 (60%), Gaps = 48/1207 (3%)

Query: 7    KYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPSEIPGL 66
            K +DI F  P S+  R  KLC+LPNG+L LLISD +              H+DP +IPG+
Sbjct: 7    KTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGI 66

Query: 67   AHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSLQEGFD 126
            AHLCEHM+LAAGS+KYP PG +HE++  N GSQNAFTTGEQT+FYFELP      Q  F 
Sbjct: 67   AHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNTFG 126

Query: 127  EALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFS 186
            E LD+F+SFF +PLFN  L NKE YAIESEHD N+S+  KI Y A RLL+N +HPF  FS
Sbjct: 127  EILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFS 186

Query: 187  TGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTKFSLIK 246
            TGNI TL+ + +           EYFK N+ +  MT+C++GPQS++SL KLAL  F  IK
Sbjct: 187  TGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDIK 246

Query: 247  NN------------PQR---YXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRG 291
            +             PQ+                   NE +++  +   +  N WL KY  
Sbjct: 247  DKDELTKFHINSIKPQKSLRISKSRSSISSCNSFKTNENLDL--ENFKLLDNAWLDKYGD 304

Query: 292  QLCFTSDEQEKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSF 351
             +CF +      IF+ SSK P +R +FP  E+ TRFT +DIKI +++W  +FGDE+ GSF
Sbjct: 305  NVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGDETKGSF 364

Query: 352  SHWLQSKGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKN 411
              +L    W+T  YAF S  AIGN++LILEL LT TG + L +I  +L +Q +  L    
Sbjct: 365  CDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVKLLVDNF 424

Query: 412  TLELAQFMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMMID 471
            T  LA F+++ N I ++RF+  + EI+PM+EC  LS L+Q++ +  +P Y+F GS  ++ 
Sbjct: 425  TENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYGSEFLLL 484

Query: 472  E-----QHHNI--GNYGENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNXXXXXXX 524
            E     Q +N+  GN      S  +WIGQAIKFQ+FLK+FM   N+++V  G+       
Sbjct: 485  ENESLPQKNNMFDGN------STTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEFKNV 538

Query: 525  XXXXXXF--QVDLFYEFEYFKRDGIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQLKK 582
                     + DL+YEFEY K        I     DY F  P  +  +P     Y+    
Sbjct: 539  LNIVKEMSKKTDLYYEFEYQKLKISKKSRICP--RDYPFTYPIKNEYLPKFG--YNLGLL 594

Query: 583  ILNDSSQKSQSAPLSFTI-HNNLLKPVPHLVSQNCYHEMWVMPDDEDPSL-HLKSIVSFE 640
                 +    S  +SF +   +  +    LVSQN  H++WV P +    L     IVSF+
Sbjct: 595  RNILLNNLESSRTVSFYMPQVSEEEDQNKLVSQNDMHKLWVNPKNSKDQLSESPCIVSFK 654

Query: 641  IFGLDLEACPRNTMNLEILGQIIFILLSPEIYPSLKLGFTCEIT-SNKGDIRLGFTISGF 699
            +    ++  P +TM+LE++GQ++  LL  ++YP+L +G+T EI+ S +GD+ L FT+SGF
Sbjct: 655  LVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFTLSGF 714

Query: 700  SKQLTSFVKSIIETIKRISQDPDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIV 759
            S+ +   +K  I     ++   D ++K+  RRARILVR+KYE+AA+++C  + S+GL I+
Sbjct: 715  SEGIFKIIKECINIFGELTSS-DLITKKEFRRARILVRDKYEDAASDSCVKLASVGLLIL 773

Query: 760  LEKYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLHRSFT 819
            LE+ MWTLE+R++ALE ID++ F +F Q F     +LSL+++G+L  AD +N Y      
Sbjct: 774  LERKMWTLEERIDALELIDLEMFLEFAQKFF-QNLFLSLYIEGNLEYADLINSYFSDKLV 832

Query: 820  HHLGGGI-YETQGKTFTVETTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIF 878
            HHL   + Y  +    ++ +TK++  GTN   +  G  DDPNNSI+YFIQTG  +++ I 
Sbjct: 833  HHLTKRLDYPKEDTLQSLPSTKLIS-GTNIYYELEGSVDDPNNSIVYFIQTGDLSNKKIL 891

Query: 879  TLTNFTVFIMSLNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDE 938
            +LT+ T FI+S +L  ELRNK+Q+GY+V GGLR LS++VGLHITIMS G PLD+E +I++
Sbjct: 892  SLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIEIEK 951

Query: 939  YLWYLE-SQLQKLDEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDS 997
            Y+ YLE   L  LD++TF   Y+  Y+ L++G  +    ++SGP ++++E++ANV  GDS
Sbjct: 952  YISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANVHGGDS 1011

Query: 998  EILSSQTMKRHKKLQTQIIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLR 1057
             IL+S+ +K HKK + ++  +      E + +D + +  ++L +YL FFK  IS +SK R
Sbjct: 1012 AILNSEKIKNHKKNKNELFGDA-QMTEELKYVDIEFLKNLNLIKYLQFFKGSISTNSKRR 1070

Query: 1058 XXXXXXXXXXXAEKDIINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMELY 1117
                        E+++ N+K+FLQL+TFLKIKGF I ++EL+ IVER+NG+P +L  EL+
Sbjct: 1071 SKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPTLLFKELF 1130

Query: 1118 SCFRTRNDALRLCSVILAELFKMLAKSLRHRYGNLAHDDTSKRDLQEWSTD--VKPALDL 1175
            +CF+ R+++ +  S++L E+ K+++ S++ +      +  S     E+  D  + P   L
Sbjct: 1131 ACFKARDESWKFISIVLKEILKVISMSIKQQCKTRGSETRSSIQHSEFHNDHIITPT-PL 1189

Query: 1176 KVIEDIN 1182
            + +EDIN
Sbjct: 1190 EKVEDIN 1196

>Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] {ON}
            YPR122W (AXL1) - putative homolog of human
            insulin-degrading endoprotease [contig 148] FULL
          Length = 1189

 Score =  883 bits (2282), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/1190 (41%), Positives = 698/1190 (58%), Gaps = 27/1190 (2%)

Query: 7    KYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPSEIPGL 66
            K +D+ F TP S   R  KLC+L NG+L  LISDP++             HNDP E  GL
Sbjct: 7    KNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGL 66

Query: 67   AHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSLQEGFD 126
            AHLCEH +L+ GS+KYP   YYHE++ +NGGS NA+TTGE T+FYFELP I  S +  FD
Sbjct: 67   AHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAYTTGETTTFYFELPAISDSGELHFD 126

Query: 127  EALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFS 186
            +ALDV AS    PLF+  LINKE YAIESEH++N +  GK  Y A+RLLAN +HPFSRF 
Sbjct: 127  KALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFC 186

Query: 187  TGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTKFSLIK 246
            TGN +TL ++P             + K  +  S M+LCLRG QS+++L KLA+  F  + 
Sbjct: 187  TGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLP 246

Query: 247  NNPQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQEKFIFI 306
             + Q                 N+    +     I K  W PKY+    F S      + I
Sbjct: 247  ASGQN-----IARPSSSSLFSNKGTAQSMPYFKILKYEWTPKYKDVRAF-SQGSSNVVAI 300

Query: 307  KSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGWVTYSYA 366
            +SSK P +R IFP   ++TR +S DI   +  W + FGDES GS +  L+  G ++   +
Sbjct: 301  QSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLADCLKGCGLISGIVS 360

Query: 367  FVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTLELAQFMSKQNCID 426
             VS  A     L LEL LT+ G++N+  I  +LF+  IP L    T ++A+ +S+ N I+
Sbjct: 361  SVSHFATEEDGLTLELTLTQHGWKNIPTIMCILFDDYIPKLIHDKTEDIARCLSELNAIE 420

Query: 427  LIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMM-IDEQHHNIGNYGENKE 485
            L++FLYQ+ E SPM+ C NLS+ +  DLE LDP  + KGSP++  +++H  IG+Y EN E
Sbjct: 421  LLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKGSPLIECNQEHSRIGDYSENTE 480

Query: 486  SDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNXXXXXXXXXXXXXFQVDLFYEFEYFKRD 545
            S  WWIG+AIKFQ+ + +F+ + N+R V+ G+              + D +YEF+Y    
Sbjct: 481  SQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLASVRSTTKTDAYYEFDY---- 536

Query: 546  GIPFKDILEWNND------YNFKIPQLDCPMPDIAKSYSQLKKILNDSSQKSQSAPLSFT 599
             I + D+L    D      Y+F  P  D  +P +A+  S +K+ L  SS ++QSA L   
Sbjct: 537  RIAYVDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLIKQALQVSSTRAQSASLHLI 596

Query: 600  IHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSFEIFGLDLEACPRNTMNLEIL 659
              ++ L+  P L  +N  +E+WV  ++ D S   KSIVSFEI    + A P+NTM LEIL
Sbjct: 597  PRSDFLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSVCASPKNTMYLEIL 656

Query: 660  GQIIFILLSPEIYPSLKLGFTCEIT-SNKGDIRLGFTISGFSKQLTSFVKSIIETIKRIS 718
            GQ++   LS  +YPS KLG+T EI+ S+KGD+RLG T+SGF + + + +K I+E IK  S
Sbjct: 657  GQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLIKIIVEEIKSFS 716

Query: 719  QDPDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKYMWTLEDRLEALEDID 778
               D +S +  R ARI VR+KYE AA  NC  + S+GL I+LE+ MW +EDRLEALE+I 
Sbjct: 717  SR-DIISSKVFREARIAVRSKYEEAAAANCTALASLGLLIILEECMWPIEDRLEALEEIS 775

Query: 779  MDNFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLHRSFTHHLGGGIYETQGKTFTVET 838
             + F  FC  FL S  Y++LF+QGD+SC +++N +L  S T HL     E QG       
Sbjct: 776  QETFTMFCSHFLTSPTYMNLFIQGDMSCMEKINSFLKWSLTSHL-EDTREYQGPV-REPG 833

Query: 839  TKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELRN 898
             K+L+ GTN  V+     DDPNNSI+YFIQTG R D   +T T    F +SL L  +LRN
Sbjct: 834  AKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVPDLRN 893

Query: 899  KRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLES-QLQKLDEQTFHQ 957
            K+Q+GY V GGLRLLS S+GLHIT MS   P  LE +I+EYL YLE   L  + E+ F +
Sbjct: 894  KKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQE 953

Query: 958  EYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEILSSQTMKRHKKLQTQIIQ 1017
             Y+R Y  +++        +++GPADL+ ++ ANV+ G+ E   S  M+ HK  + QI  
Sbjct: 954  HYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANVRSGNLEEQGS-AMRLHKNTKNQISN 1012

Query: 1018 EQYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLRXXXXXXXXXXXAEKDIINKK 1077
             +Y+F  E E ++ D++  ++L ++ SFF   ISI+S  R             ++I  K+
Sbjct: 1013 RRYNFGMEEEPVNRDILRTITLSEFRSFFSEKISIYSLKRSKLSVMIASPMTAEEISQKR 1072

Query: 1078 IFLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSCFRTRNDALRLCSVILAEL 1137
            +FLQ+E+FLK+KG  I + +L DI+E S G+   +   L+  F    + ++LC+VI+ E+
Sbjct: 1073 LFLQVESFLKLKGLKISSSDLHDIIETSLGRTSGILRGLFRYFSANGETMKLCNVIIKEI 1132

Query: 1138 FKMLAKSLRHRYGNLAHDDTSKRDLQEWSTDVKPALDLKVIEDINFFKRV 1187
             K L  SL++       DD     L+  S  V  AL L  I+D+N F+ +
Sbjct: 1133 SKALVLSLKNPSQRTRVDDA----LRGLSKIVTSALPLTEIKDVNQFRNL 1178

>KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] {ON}
            similar to uniprot|P40851 Saccharomyces cerevisiae
            YPR122W AXL1 Haploid specific endoprotease that performs
            one of two N-terminal cleavages during maturation of a-
            factor mating pheromone required for axial budding
            pattern of haploid cells
          Length = 1185

 Score =  877 bits (2267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/1195 (40%), Positives = 700/1195 (58%), Gaps = 22/1195 (1%)

Query: 2    VSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPS 61
            +S  ++++D+ F TP S   +  +LC+L NG+L LLISDP +             H DP 
Sbjct: 4    MSDAVQHFDVAFYTPISSSNKGVELCRLANGILVLLISDPADTSVSSSVSVASGSHADPD 63

Query: 62   EIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSL 121
            E+ GLAHLCEH +L+AGS+K+P   +YHE++ +NGGS NA+TTGE T+FYFELP    S 
Sbjct: 64   EVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSG 123

Query: 122  QEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHP 181
            +  FD+ LD  AS F  P+F+ + INKE YAIESEH+VN +S  K  Y ATRLLAN  HP
Sbjct: 124  ELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHP 183

Query: 182  FSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTK 241
            FSRF TGN +TL   P+           +YFK N+ A++M LCLRGPQS+++LAKLA   
Sbjct: 184  FSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKY 243

Query: 242  FSLIKNNPQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQE 301
            F  +  +  R                ++ + V P +   SK     + + Q  F  D   
Sbjct: 244  FGDLPASRDRDPTRPPLKKRPSSGVASQDLHVRPLDFKNSKQ----QTQVQDAFVPD-TS 298

Query: 302  KFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGWV 361
              + I+SSKNP +R +FP   ++TR TS DI  L+  W + FGDE  GS +H L++   +
Sbjct: 299  NLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLI 358

Query: 362  TYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTLELAQFMSK 421
                A V+  + GN  L LE  LT  G+ +   I  VLF+  IP L    T ++A+ +S+
Sbjct: 359  NGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKDIAKCLSE 418

Query: 422  QNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMM-IDEQHHNIGNY 480
             NC DL+ FLYQ AE S ME C  LSS +    E LDP  + KGSP++  ++    IG+Y
Sbjct: 419  LNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIECNQNPSAIGDY 478

Query: 481  GENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNXXXXXXXXXXXXXFQVDLFYEFE 540
             E+ ES  WWIG+AIKFQ+F+ +F+ + N+R+V+ GN              + D +YEF 
Sbjct: 479  SESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSVSKTDAYYEFT 538

Query: 541  Y--FKRDGIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQLKKILNDSSQKSQSAPLSF 598
            Y   K D +  ++ L     ++F++P  D  +P + +    +K+ L  SS +SQ++ L+ 
Sbjct: 539  YQISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASSNRSQTSLLTV 598

Query: 599  TIHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSFEIFGLDLEACPRNTMNLEI 658
               N  L+ +P L  +N  HE+WV  +D D S   KSI+S E+    +EACP  TM LE+
Sbjct: 599  VARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEV 658

Query: 659  LGQIIFILLSPEIYPSLKLGFTCEIT-SNKGDIRLGFTISGFSKQLTSFVKSIIETIKRI 717
            L Q++   LS  +YPS KLG+T EI+ S KG  RL FTISGF + + + V+ II+  K +
Sbjct: 659  LAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSL 718

Query: 718  SQDPDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKYMWTLEDRLEALEDI 777
              + D ++    R+AR+ VRNKYE AA+ N   + ++GL IVLE+ MW +EDRL+ALE+I
Sbjct: 719  -INSDTVTPAMFRKARVAVRNKYEEAASANSTTLATLGLLIVLEECMWPVEDRLDALEEI 777

Query: 778  DMDNFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLHRSFTHHLGGGIYETQGKTFTVE 837
            D+++F+ FC  F+    YL++F QGDLS  +E++ +L    T HL    +        V 
Sbjct: 778  DIESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLSRRTWHEPAVREPV- 836

Query: 838  TTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELR 897
             T  L+PGTN  ++     +DP++SI+YFIQTG R+D  + +LT  T F+MS+ L  +LR
Sbjct: 837  -THALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLR 895

Query: 898  NKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQ-LQKLDEQTFH 956
             K+Q+GY V  GLRLLS ++GLHIT MS   P  LE++ID+YL Y+E   L  + E+ F 
Sbjct: 896  TKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQ 955

Query: 957  QEYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEILSSQ--TMKRHKKLQTQ 1014
            + Y+R +  + +       ++++GPADLL+++ ANV  G+   L  Q   M++HK+++ Q
Sbjct: 956  ERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSGN---LPEQGAAMRQHKRIRNQ 1012

Query: 1015 IIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLRXXXXXXXXXXXAEKDII 1074
            I   +Y+F ++ E  D  L+  ++L Q+  FF+  ISI S  R           +  +I 
Sbjct: 1013 ISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVMVASPVSADEIA 1072

Query: 1075 NKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSCFRTRNDALRLCSVIL 1134
             K++FLQ+E++LK+KG  IP+ EL+ IVE S GKP  L   L+  F  R + LRLC+VIL
Sbjct: 1073 EKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLARGETLRLCNVIL 1132

Query: 1135 AELFKMLAKSLRHRYGNLAHDDTSKRDLQEWSTDVKPALDLKVIEDINFFKRVQI 1189
             EL K +  SL+ R  N    + S   LQ    +V  A+ L  ++  +F +R  +
Sbjct: 1133 KELSKAVVLSLKPRPTN----NNSAGVLQNVRKEVSTAVPLIEVQANHFRQRSPV 1183

>AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YPR122W
            (AXL1)
          Length = 1193

 Score =  854 bits (2207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/1187 (39%), Positives = 701/1187 (59%), Gaps = 20/1187 (1%)

Query: 9    YDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPSEIPGLAH 68
            +D+   TP S   R+H++ +L N LLT LISDP+E             HNDP EIPGLAH
Sbjct: 10   FDVKLYTPISSSNRSHRIIRLNNNLLTFLISDPSETVASCAVSIATGSHNDPVEIPGLAH 69

Query: 69   LCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSLQEGFDEA 128
             CEHMVL++GS+++P+P  +HE + KN GSQNA T+GEQTSFYFELP+   S    FD+ 
Sbjct: 70   FCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQV 129

Query: 129  LDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFSTG 188
            + + A    EP+F+  LINKE YAI SEH  N SS  K+ Y A RLLA+  HPF +F TG
Sbjct: 130  VGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTG 189

Query: 189  NISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTKFSLIKNN 248
            NI TL ++P            +YF+E+F A  M LCLRGPQS++ L+K+A  +FS I + 
Sbjct: 190  NIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQARFSDIPSI 249

Query: 249  PQRYXXXXXXXXXXXXXXXNEWVEVNPKE-MNISKNTWLPKYRGQLCFTSDEQEKFIFIK 307
            P                  N  + V P E   I K+ W  +Y  +  F        I ++
Sbjct: 250  PTLQVPRLLRWRSSSSFDKNRNLSVRPLESFQILKDAWSARYAKKPVFDKTPMHNSIMVQ 309

Query: 308  SSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGWVTYSYAF 367
            SSK+P +RF+FP    +TRFT +++   T +W EL GDE  GS  H+L+S  ++T   A+
Sbjct: 310  SSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGSLCHYLRSHSYITELIAY 369

Query: 368  VSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTLELAQFMSKQNCIDL 427
             S  A+ ++ LIL+L LT  G+ N+  I  ++++  IPA+       LAQ++S+ N +DL
Sbjct: 370  SSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAILDAPLSSLAQYISELNSLDL 429

Query: 428  IRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMMIDEQH---HNIGNYGENK 484
            ++FLYQ  E SPM+ C +L   +  DL A+D +++ K +    +  +    N+G Y EN+
Sbjct: 430  LKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYFECNNLSVANLGTYRENQ 489

Query: 485  ESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNXXXXXXXXXXXXXFQVDLFYEFEYFKR 544
             S  WW G+A+KFQ+F+ +FM Q  +R+++ GN                D ++E+EY K 
Sbjct: 490  TSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGN-LSKCYFNCNPDKITTDTYFEYEYVK- 547

Query: 545  DGIPFKDILEWNND---YNFKIPQLDCPMPDIAKSYSQLKKILNDSSQKSQSAPLSFTIH 601
                F D+     D   Y F IP  +  M  +    S +K  L  SS +S+++ LS    
Sbjct: 548  ---IFIDLEVLGCDDIHYRFTIPGPNPFMVPVGHKLSFIKHALLASSVQSENSALSVVAQ 604

Query: 602  NNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSFEIFGLDLEACPRNTMNLEILGQ 661
            ++L++  P L  +N Y+E+W+  +D D S   KSI S E+    LE  P  TM+LEILGQ
Sbjct: 605  SDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLEILGQ 664

Query: 662  IIFILLSPEIYPSLKLGFTCEIT-SNKGDIRLGFTISGFSKQLTSFVKSIIETIKRISQD 720
            +++ +L P +YP+ + G+T E++ S+KGD+RLG TISGF+  + + +K I++ I  +SQD
Sbjct: 665  LLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNLSQD 724

Query: 721  PDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKYMWTLEDRLEALEDIDMD 780
             + + K+  R+ARILVR KY+ A++E+C  + S+GL I+LE  MW LEDRLEALEDI ++
Sbjct: 725  LNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALEDIYVE 784

Query: 781  NFKQFCQSFLGSKKYLSLFVQG-DLSCADELNEYLHRSFTHHLGGGIYETQGKTFTVETT 839
            +F+ F + F+    YL++ +QG D++ AD +NEYL    THH+     +      +   T
Sbjct: 785  SFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERLTHHISRA--DDNVCRLSEPAT 842

Query: 840  KMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELRNK 899
             ++  G+N   +  G  DDPNNSI+YFIQTG R++  I+TLT  T FIMS  L  +LR K
Sbjct: 843  YVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQK 902

Query: 900  RQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQ-LQKLDEQTFHQE 958
            +Q+GY+V+GGLR+LS++VGLHIT M+G  P  LE KI+EYL YLE   L KL    F  +
Sbjct: 903  KQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLTAPQFKHD 962

Query: 959  YVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEILSSQTMKRHKKLQTQIIQE 1018
            YV   L LL     G   ++SGPA+L+S++ ANV  G     +S  MK HK+L+TQI   
Sbjct: 963  YVDELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQRN--TSLAMKSHKRLRTQISYR 1020

Query: 1019 QYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLRXXXXXXXXXXXAEKDIINKKI 1078
            +Y+F  + E +D   +  + L +Y+ FF+  ISI+S  R           +++++  K +
Sbjct: 1021 RYNFDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVYSAMSKEEVQGKML 1080

Query: 1079 FLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSCFRTRNDALRLCSVILAELF 1138
            +LQ+E+FLK+KGF IP+ +L  IV++S GKP  L   L S FR++ ++L+L S +L E+ 
Sbjct: 1081 YLQIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGESLKLLSTVLREVV 1140

Query: 1139 KMLAKSLRHRYGNLAHDDTSKRDLQEWSTDVKPALDLKVIEDINFFK 1185
            K L         +     T    LQ  S  V PA+ L+ + ++N ++
Sbjct: 1141 KQLFSKATPDSSSSTPSGTHG-SLQAMSQHVTPAITLEQVPEVNSYR 1186

>TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  821 bits (2121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/1160 (40%), Positives = 670/1160 (57%), Gaps = 44/1160 (3%)

Query: 1    MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDP 60
            M   Q+K YDIP   P S  G  +KLC+LPNG+LT++ISDP+              HNDP
Sbjct: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60

Query: 61   SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120
            S IPGLAHLCEHM+L+AGS+KYPDP  YH++I ++ GS NA+TTGEQT+FYFE+P ++ S
Sbjct: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120

Query: 121  LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180
             +  F+  LD+F+S F +PLF  T +NKE YAIESEHD N  +  KI Y ATRLLAN  H
Sbjct: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180

Query: 181  PFSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240
            PFSRFSTGNI+TL                 YFK N+ AS MTLC++GPQS++ L K ALT
Sbjct: 181  PFSRFSTGNITTLGKGAKLLKTTSKKLLESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240

Query: 241  KFSLIKNN-----------------PQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKN 283
             F+ I ++                  QR+                E  +   ++ +I  N
Sbjct: 241  YFNGIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEE--DCRLEDFHILSN 298

Query: 284  TWLPKYRGQLCFTSDEQEKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELF 343
             + PKY+   CF  +     IFIKS+K P +R +FP    +  F   D+     +W ELF
Sbjct: 299  AYNPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELF 358

Query: 344  GDESPGSFSHWLQSKGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQA 403
            GDE+  S  ++L+    +T  +AF S  A+ +  L++EL LT TG +N   I   +   A
Sbjct: 359  GDENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSA 418

Query: 404  IPALSQKNTLELAQFMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIF 463
            I  LS+ N  ELA+F+S+ N ID+IRF+ +  E + M+E   +SS +Q++L    P+++ 
Sbjct: 419  IEKLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLL 478

Query: 464  KGSPMMIDEQHHNIGNYGENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNXXX--X 521
            K  P + D     I N+ EN+ S  WW+ +A  FQ FLK+++ + N+R++  G+      
Sbjct: 479  KEFPFINDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPKF 538

Query: 522  XXXXXXXXXFQVDLFYEFEYFKRDGIPFK-----DILEWNNDY--NFKIPQLDCPMPDIA 574
                     +  D FY+FEY     I FK     + L   +D   N  IP+ +  MP+I 
Sbjct: 539  TTLTEDLKVYSTDPFYDFEY-----ITFKYKFKANQLRQEDDIFRNIGIPKRNTFMPEIG 593

Query: 575  KSYSQLKKILNDSSQKSQSAPLSFTIHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLK 634
            KS + L   L    ++++S      I+NN ++  P LV +N   E WV+      S    
Sbjct: 594  KSLAILSANLEAILKRNESIGYPI-IYNNSIESKPGLVLKNSNQETWVLNSPLQHSSTES 652

Query: 635  SIVSFEIFGLDLEACPRNTMNLEILGQIIFILLSPEIYPSLKLGFTCEI-TSNKGDIRLG 693
            SI SFEI    ++  P +TM+LE+LGQ++ IL++ E+YP+L+LG+T EI  S  GD++L 
Sbjct: 653  SIFSFEITNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLM 712

Query: 694  FTISGFSKQLTSFVKSIIETIKRISQDPDFLSKETLRRARILVRNKYENAANENCANIGS 753
             TISGF   + S +++II+    IS     ++   L RAR++ R KYE+AA+ N   + S
Sbjct: 713  ITISGFQSGIMSLLQNIIKICNSISIKNPTVTHSALHRARVMTRRKYEDAASGNSVKLAS 772

Query: 754  IGLYIVLEKYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSLFVQGDLSCADELNE- 812
            +GL I+LEK+MWTLEDR +ALE+ D+++F  FC  F  S KY+  F+ G    A +L+  
Sbjct: 773  VGLLIMLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTNELAMKLSHL 832

Query: 813  -YLHRSFTHHLGGGIYETQGKTFTVETTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGR 871
             Y H   +  +    +E       + +T  L+PG N   QH G + D NN I YFIQTG 
Sbjct: 833  IYDHWILSDTISLNYFEKNN----ILSTCFLKPGENVYFQHPGDEGDINNCINYFIQTGE 888

Query: 872  RNDRMIFTLTNFTVFIMSLNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLD 931
            RN+  I TLT+ T +IM  NL  ELRN++QVGY+V GG+R L+N++GLHITIMS   P D
Sbjct: 889  RNNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPED 948

Query: 932  LETKIDEYLWYLESQ-LQKLDEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVA 990
            LE  IDEY+W LE+  +  L+E TF   ++  ++  +        N  +   +L+ ++VA
Sbjct: 949  LERSIDEYMWRLENDTIGSLNESTFKLTFLLPFINTMQKDTNNPFNNVTN-VNLVDDVVA 1007

Query: 991  NVQIGDSEILSSQTMKRHKKLQTQIIQEQYDF-VTESEALDDDLISQMSLEQYLSFFKHY 1049
            NVQ GDS    +Q MK H  L+ +I   +    +  +EA+D ++I +++L++YL FF+  
Sbjct: 1008 NVQAGDSVNFETQQMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFFRAT 1067

Query: 1050 ISIHSKLRXXXXXXXXXXXAEKDIINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKP 1109
            ISI+SK R           A+++I N+K+FLQL TFLK+KG  I  DELK+IVE S GKP
Sbjct: 1068 ISINSKNRSKISIHIISLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGKP 1127

Query: 1110 KILAMELYSCFRTRNDALRL 1129
              L  E+   F+ +++A +L
Sbjct: 1128 SKLLKEIVKYFKKKDEAKKL 1147

>KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} similar
            to uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1170

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/1165 (34%), Positives = 654/1165 (56%), Gaps = 60/1165 (5%)

Query: 1    MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDP 60
            M +  ++  D+P  TP S   R H+  +L NG+  LLISDP E+            HNDP
Sbjct: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60

Query: 61   SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120
             E+PGLAHLCEHM++++ S+K+P   +YH+++++  G+QNAFTTGEQTSFYFE+PN  + 
Sbjct: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120

Query: 121  LQEG-FDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGN 179
              +  FDE + V A     P+F S  INKE  AI++EH+ N +   K  Y  T+ LA   
Sbjct: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180

Query: 180  HPFSRFSTGNISTLNSIP--HXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKL 237
              FSRFSTGNI TL   P              +++ +NF A  +++ +RG QS+H L KL
Sbjct: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240

Query: 238  ALTKFSLIKNNPQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNIS-----KNTWLPKYRGQ 292
              T F   +                          +  +  +I      +  W  +Y   
Sbjct: 241  VQTTFGDFRTKST----------------------IKSQSFSIESFKKLQKVWAARYTEP 278

Query: 293  LCFTSDEQE--KFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGS 350
            L F+  E E    I I+SSK P +R +FP   +   F+  ++KI + +W +LFGDES GS
Sbjct: 279  L-FSKQEPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESSGS 337

Query: 351  FSHWLQSKGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQN-LSHIAKVLFEQAIPALSQ 409
                  ++  +T     +S+  I +  L+L+ +LT +G++  +  +   LF+  +P    
Sbjct: 338  IHSKFSARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQGFLPFFQS 397

Query: 410  KNTLELAQFMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGS-PM 468
             +  E+AQ++++ N I+L++F+YQ+ + S M++C +L S +   L+  DP +I   S   
Sbjct: 398  IDPDEIAQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCSEL---LQCEDPQFILNNSIAF 454

Query: 469  MIDEQHHNIGNYGENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNXXXXXXXXXXX 528
              + +  +IG+Y E+ +S  WW  QA KF SF+K +M  +N +++  G+           
Sbjct: 455  SCNRKGSDIGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQSNDFLKSRQ 514

Query: 529  XXFQV--DLFYEFEYFKRDGIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQLKKILND 586
                V  D  Y F+Y +   I    +     D  F++P     +  + K+ S LK+ L  
Sbjct: 515  VPTNVKFDEHYRFQY-ELSLIKLNHVKMSPKD--FRLPSSTAFLFGLEKNLSALKQSLTA 571

Query: 587  SSQKSQSAPLSFTIHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHL--KSIVSFEIFGL 644
              +KSQ + LS    + LL+  P L+S+N  +E+WV    E+ SL    +S+++ E+  +
Sbjct: 572  VLRKSQGSALSIITQSKLLQTTPRLMSKNENYELWV---KEENSLEYSSRSVITIELINM 628

Query: 645  DLEACPRNTMNLEILGQIIFILLSPEIYPSLKLGFTCEITSN-KGDIRLGFTISGFSKQL 703
             +E   +NTMNLEIL Q+++  ++  +YPS ++G+  +I +N +GD+RL  TI+GF + +
Sbjct: 629  GMEPSAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTINGFPQGV 688

Query: 704  TSFVKSIIETIKRISQDPDF-LSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEK 762
               ++ I++ +  I + PDF ++    R +RILVR KYE AA  N   + S+G+ I+LEK
Sbjct: 689  AMILQIIMDKMVDIGK-PDFDITNSMFRHSRILVRTKYEEAARANSCTLASLGVLILLEK 747

Query: 763  YMWTLEDRLEALEDIDMDNFKQFCQS-FLGSKKYLSLFVQGDLSCADELNEYLHRSFTHH 821
             + TLE+RL+ALEDID+++FK FC+  ++    Y++L +QGDLS A+ +N+Y+     HH
Sbjct: 748  ELTTLEERLDALEDIDIESFKMFCKDLWIPKSNYMNLVIQGDLSIAETVNQYMD-GIIHH 806

Query: 822  LGG-GIYETQGKTFTVETTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTL 880
            L G  + +T         T  L  G+N  ++    K+DP NS++YFI+TG R + + +T+
Sbjct: 807  LSGPNVNQTSVFRLREPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDYTM 866

Query: 881  TNFTVFIMSLNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYL 940
            ++   + MS+ L  +LRNK+Q+GY+V+GGLRLL++++G+HI++MS   P  +E +I+EYL
Sbjct: 867  SSLFEYFMSMTLVPDLRNKKQIGYVVLGGLRLLTDTLGIHISVMSNLPPHTIEDRIEEYL 926

Query: 941  WYLESQ-LQKLDEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGD-SE 998
            +YLE+  L  + E  F    ++ Y+QL+         +++GPA+L++++ A+V  G+   
Sbjct: 927  YYLETNVLGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEASVHSGNYPS 986

Query: 999  ILSSQ--TMKRHKKLQTQIIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKL 1056
             L SQ  T+ +HKKL+ +I    Y F      +D  L+S+++L+++   F   ISI S  
Sbjct: 987  NLQSQGYTVGQHKKLKDEISFRTYAF--SETKVDVCLLSKLTLQEFKRLFMEKISILSLQ 1044

Query: 1057 RXXXXXXXXXXXAEKDIINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMEL 1116
            R            + DI    + +QL+ FLK KGF I  DEL++IV ++ GKP  L  EL
Sbjct: 1045 RRKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKPTSLFKEL 1104

Query: 1117 YSCFRTRNDALRLCSVILAELFKML 1141
            +  FRT+  +LRLC+++L E+ K +
Sbjct: 1105 FHHFRTQGQSLRLCTLVLKEIVKQI 1129

>CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122w AXL1
            protease
          Length = 1181

 Score =  539 bits (1389), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 362/1184 (30%), Positives = 592/1184 (50%), Gaps = 91/1184 (7%)

Query: 6    LKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPSEIPG 65
            +K + +PF  P     R +KL +LPNG+  ++ISD  EN            HNDP+ +PG
Sbjct: 5    VKKFWVPFYVPLLHMNRAYKLIQLPNGINVVIISDAEENYNSCSLTVAAGSHNDPATVPG 64

Query: 66   LAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSLQEG- 124
            LAHLCEHM+LAAGS  +P PG +H +I K  G  NA+TTGEQTSFYF++P + +S  EG 
Sbjct: 65   LAHLCEHMILAAGSSNHPTPGLFHSLIAKYNGDMNAYTTGEQTSFYFQVPQVANS--EGT 122

Query: 125  --FDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPF 182
              F+E L VF+S F  PLF S+++NKE YAI+SEH+ N ++ GK+ YQATRLLAN NHPF
Sbjct: 123  LAFEELLSVFSSAFKFPLFTSSVLNKEIYAIQSEHENNKTNPGKVLYQATRLLANKNHPF 182

Query: 183  SRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTKF 242
            SRF TG+++TL + P             YF +NF    +TLC+RGPQS++ L KL +  F
Sbjct: 183  SRFCTGDMNTLKTFPSTENINIRKELISYFNDNFYGENITLCVRGPQSLNHLVKLCMQNF 242

Query: 243  SLIKNNPQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQEK 302
            + IK  P                   E  E   K +NI  + W P+Y    CF    +  
Sbjct: 243  NDIKPLP-----VLPTAIGNNRDSDTELFEETLKRLNILYDVWAPRYTSLPCFHIGYKNN 297

Query: 303  FIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGWVT 362
             I + S    + R + P +  +TR  +   ++ T++  EL G+E  GSF H+L+   WV 
Sbjct: 298  VILVNSDMEQSFRIVIPLITNDTREDAIFTEVFTNICVELLGNEEVGSFCHFLKEISWVR 357

Query: 363  YSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTLELAQFMSKQ 422
              Y + SE A+G + ++LE     TGF  + +I  VLF+  IP      + +LA+F+ +Q
Sbjct: 358  ECYVYRSEFAVGAAGIVLEFKCFDTGFSQIENIVNVLFQTLIPMYLNMPSDDLARFIKEQ 417

Query: 423  NCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMMIDEQHHNIGNYGE 482
              I+ I F+Y    +SPMEE  +LS  +Q DL      Y+   SP  +        NY E
Sbjct: 418  TIIETIDFMYTWKHLSPMEESSDLSMQLQKDLHNRGIKYLLMKSPSFLH-------NYEE 470

Query: 483  NKESDR--WWIGQAIKFQSFLKQFMVQSNMRVVVSGNXXXXXXXXXXXXXFQ-------V 533
              ++++  +W     KF+ FL++ M+  N +V++  +              Q        
Sbjct: 471  MSKTEKLHYWPLIVEKFKVFLRRHMILPNAKVIIPTSEPFTKTVRNLFKNAQQMEVTSET 530

Query: 534  DLFYEFEY------FKRDGIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQLKKILNDS 587
            D +YEF Y      F    + F         Y F  P  +  +P   ++   L ++L   
Sbjct: 531  DPYYEFNYSVYSVSFPESRVIFP--------YQFSFPGPNEFIPPKYRNLDTLLEMLFGI 582

Query: 588  SQKSQSAPLS--FTIHNNLLKPVPHLVSQNCYHEMWV--MPD---DEDPSLHLKSIVSFE 640
            S+++  +PL     + N+  +  P LV Q    E+W   + D    +  +  +KS V+ +
Sbjct: 583  SERANFSPLRPIVRLKNSRARSAPKLVHQTEDVEIWTANIVDGIFSKVVNADIKSYVTIK 642

Query: 641  IFGLDLEACPRNTMNLEILGQIIFILLSPEIYPSLKLGFTCEITSN-KGDIRLGFTISGF 699
            I    +   P ++++L ++ +I+ + L P +Y   KLGF+  + +   G +     ++G 
Sbjct: 643  IVNQCIRPTPISSLHLGMMVEIMNMFLLPRLYSCTKLGFSFHLQAALDGSMSFDIVVTGI 702

Query: 700  SKQLTSFVKSIIETIKRISQDPDF-LSKETLRRARILVRNKYENAANENCANIGSIGLYI 758
               +   ++ + + I+ I   P + L+   +R+AR+ +R++YE A   +   IG+ GL +
Sbjct: 703  MAGIIKILEKVTDLIEIIVTKPGYILTNAFIRKARVAIRSRYEAATKGSSVKIGTTGLLV 762

Query: 759  VLEKYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSLFVQ-GDLSCADELNEYLHRS 817
             LE ++W+ E+R++ALE+ D++ F QF  +F  + K+  +F Q    S  D++  Y+ + 
Sbjct: 763  DLEPHVWSFEERVDALEESDIEVFFQFINTFFRTHKHTKVFAQSSSTSNIDKIARYVVQR 822

Query: 818  FTHHLGGGIYETQGKTFTVET------TKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGR 871
                +  GI E  G    VE       T+ML+PG    ++  G+ +DPNN +  +++   
Sbjct: 823  I---VTPGIPE--GNDALVECVRDDGHTRMLKPGEERHIKLIGRDNDPNNCVFSYLEMAP 877

Query: 872  RNDRMI--FTLTNFTVFIMSLNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSP 929
                 +  + +  FT ++  L L  ELRNKRQVGY V GGL +L+N VG+++ ++S  SP
Sbjct: 878  LEGISLKQYRMIEFTDYLFQLTLVPELRNKRQVGYAVDGGLVILNNVVGVNVVVVSSTSP 937

Query: 930  LDLETKIDEYLWYLESQLQKLDEQTFHQEYVRC------YLQLLDGGCRGD-ANESSGPA 982
              +E +I+ Y  ++   L    +Q + ++Y +        + LLD     +   E+S   
Sbjct: 938  EHIEQEIESYYAHVRQYLSDNVDQIW-RDYSKIINDRDPLMYLLDHDVWYNIERENSDIP 996

Query: 983  DLLSELVANVQIGDSEILSSQTMKRHKKLQTQIIQEQYDFVTESEALDDDLISQMSLEQY 1042
            +   + VAN           Q + ++K L   ++ +     T       D     S+++Y
Sbjct: 997  EYSRDHVANC----------QRVFKYKDLIELLVVD-----TPISGRHPDYTPPFSMQEY 1041

Query: 1043 LSFFKHYISIHSKLRXXXXXXXXXXXA-----EKDIINKKIFLQLETFLKIKGFAIPADE 1097
            L F    I  +   R                 ++D+  +++  QLE+FLK+KG  IP  +
Sbjct: 1042 LQFLDSSIGTYKHKRHHNGTRSVSVWVYSPMDKRDVFQRQVKYQLESFLKLKGLVIPERD 1101

Query: 1098 LKDIVERSNGKPKILAMELYSCFRTRNDALRLCSVILAELFKML 1141
            L DI+  + GK   +   LY  F+ +N+A +  + +  E FK +
Sbjct: 1102 LADIIREAGGKQTTMFKLLYRRFKRQNEAGKFVNSVATETFKSI 1145

>KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa]
           {ON} Anc_4.246 YLR389C
          Length = 996

 Score =  174 bits (441), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 118/391 (30%), Positives = 187/391 (47%), Gaps = 50/391 (12%)

Query: 13  FLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPSEIPGLAHLCEH 72
           FL P   + R+++  +LPN L  LLISDPT +              DP E+PGLAH CEH
Sbjct: 37  FLQP-DLDDRSYRYVQLPNNLKALLISDPTTDKAAAALDVNIGAFEDPEELPGLAHFCEH 95

Query: 73  MVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSLQEGFDEALDVF 132
           + L  GS K+P+   Y   + K+GGS NA+T  + T++YF++        E    ALD F
Sbjct: 96  L-LFMGSSKFPNENEYSSYLSKHGGSSNAYTGAQNTNYYFQVN------YEHLYGALDRF 148

Query: 133 ASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFSTGNIST 192
           + FF+ PLFN    +KE  A++SE+  NL +     YQ  + L NG HP+ +FSTGN+ T
Sbjct: 149 SGFFTGPLFNKESTDKEINAVDSENKKNLQNDLWRLYQLDKSLTNGGHPYHKFSTGNLET 208

Query: 193 LNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTKFSLIKNNPQRY 252
           L + P            +++ +++ A+ M LC+ G + + ++ K                
Sbjct: 209 LGTTPKELGLDIRDELLKFYNKSYSANLMKLCILGREDLDTMTK---------------- 252

Query: 253 XXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQE--KFIFIKSSK 310
                            WVE   +++  + +  LP+Y  ++      QE  K   +K  K
Sbjct: 253 -----------------WVEELFQDVK-TLDRALPEYNTRILDADHLQEIIKVHPVKELK 294

Query: 311 NPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGWVTYSYAFVSE 370
              V F+ P ++ +  + SK   IL+H    L G E  GS   +L++KGW     A    
Sbjct: 295 KVEVSFVVPDVDEH--WESKPPHILSH----LIGHEGTGSLLAYLKTKGWANELSAGGHT 348

Query: 371 VAIGNSNLILELDLTRTGFQNLSHIAKVLFE 401
           V+ GN+   +++DLT  G  +   +   +F+
Sbjct: 349 VSKGNAFFSVDIDLTDDGLAHYEEVVHNVFQ 379

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 58/287 (20%), Positives = 115/287 (40%), Gaps = 40/287 (13%)

Query: 683 ITSNKGDIRLGFTISGFSKQLTSFVKSIIETIKRIS-QDPDF--LSKETLRRARILVRNK 739
           + +N+G   L  T+ GF+ +L   +  ++E IK    + P F     ++++  + L+   
Sbjct: 609 VKTNQG---LDLTLYGFNDKLIILLTRLLEGIKSFKLEQPQFKIFKDKSVQHLKNLM--- 662

Query: 740 YENAANENCANIGSIGLYIVLEKYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSLF 799
           YE   ++    I ++  Y++ E+  W++E++L+ +E I  +    F  +    + Y    
Sbjct: 663 YEVPYSQ----ISTVYNYLINER-SWSVEEKLDVMEKITYEELINFIPTIF-EELYFEAL 716

Query: 800 VQGDLSCADELN-----EYLHRSFTHHLGG------GIYETQGKTFTVETTKMLEPGTNA 848
           + G+L   + +      + L  S    L             +G+T+  ET        N+
Sbjct: 717 IHGNLKYEEAMEIASLVKILQPSDVTRLQTKNSRMRSYLIPRGETYRYETKLKDAKNVNS 776

Query: 849 CVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELRNKRQVGYLVIG 908
           C+Q+  Q D      +Y        D  +   +     ++       LR K Q+GY+V  
Sbjct: 777 CIQYVTQLD------VY--------DEKLSAKSGLFAQMIHEPCFDTLRTKEQLGYVVFS 822

Query: 909 GLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQLQKLDEQTF 955
                  +  + I I S  +   LE +ID +       L  + E+ F
Sbjct: 823 SSLNNHGTANMRILIQSEHTTPYLEFRIDTFYQKFGELLNAMSEEDF 869

>TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.246
           YLR389C
          Length = 995

 Score =  174 bits (440), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 121/404 (29%), Positives = 192/404 (47%), Gaps = 52/404 (12%)

Query: 1   MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDP 60
           ++S   K  +  F+ P   + R+++  +LPN L  L+I DPT +             +DP
Sbjct: 28  VLSNGYKQLESDFIKP-DLDDRSYRFIQLPNDLKALIIQDPTTDKSAAALDVNIGAFSDP 86

Query: 61  SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120
            E+PGLAH CEH+ L  GSRK+PD   Y   + K+GGS NA+T  + T++YF++ +    
Sbjct: 87  EELPGLAHFCEHL-LFMGSRKFPDENEYSSFLSKHGGSSNAYTGAQNTNYYFQVNH---- 141

Query: 121 LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180
             E    ALD F+ FF+ PLF+    +KE  A++SE+  NL +     YQ  + L+N +H
Sbjct: 142 --EHLKGALDRFSGFFTGPLFSKDSTDKEINAVDSENKKNLQNDIWRLYQLDKSLSNPSH 199

Query: 181 PFSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240
           P+ +FSTGN+ TLN IP             ++ + + A+ M LC+ G + + +L+  A  
Sbjct: 200 PYHKFSTGNLKTLNEIPKSKGVDVRNELLNFYSKYYSANLMKLCVLGREDLDTLSDWAYE 259

Query: 241 KFSLIKNNPQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQ 300
            FS + N P+                          E +I    +L              
Sbjct: 260 LFSDVPNLPRPAPEF---------------------EASILDGAYL-------------- 284

Query: 301 EKFIFIKSSKNPA---VRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQS 357
           +KFI +K  K+     V F+ P +E +  + SK   IL+H    L G E  GS    L+S
Sbjct: 285 KKFIHVKPVKDLTKLEVTFVVPDVEDH--WESKPNHILSH----LIGHEGSGSLLAHLKS 338

Query: 358 KGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFE 401
            GW     A    V+  N+   +++DLT  G ++   +   +F+
Sbjct: 339 LGWANELSAGGHTVSKSNAFFCIDIDLTDEGLKHHEDVTHTIFQ 382

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 66/340 (19%), Positives = 127/340 (37%), Gaps = 50/340 (14%)

Query: 683  ITSNKGDIRLGFTISGFSKQLTSFVKSIIETIKRISQDPDFLSKETLRRARILVRNKYEN 742
            I +N+G   L  TI+GF+ +L   +   +E +K    D         +R  I      ++
Sbjct: 607  IKTNEG---LDITITGFNDKLIILLTRFLEGLKAFKPDR--------KRFEIFKEKSKQH 655

Query: 743  AANE----NCANIGSIGLYIVLEKYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSL 798
              N+      + + S+   +V E+  WT E++LE +E +  +  + F  +    + +   
Sbjct: 656  LNNQLYEIPYSQVSSLYNSLVNER-SWTAEEKLEVVEQLTFEQLEAFIPTIF-EEMFFET 713

Query: 799  FVQGDLSC--ADELNEYLHRSFTHHLGGGIYETQ---------GKTFTVETTKMLEPGTN 847
             V G++    AD+++  +    ++ +     +           GKT   E         N
Sbjct: 714  LVHGNIKYEEADQIDSLIQMLRSNSVSNSQIKNARIRSYVLPLGKTHRYEAKLADTQNVN 773

Query: 848  ACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELRNKRQVGYLVI 907
            +C+Q             Y IQ G   D  +  +      ++       LR K Q+GY+V 
Sbjct: 774  SCIQ-------------YVIQLGVY-DEALSAIGRLFAQMLHEPCFDTLRTKEQLGYVVF 819

Query: 908  GGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQLQKLDEQTFHQEYVRCYLQLL 967
                    +  + I I S  +   LE +I+ +L      L+++ ++ F            
Sbjct: 820  SSSLNNHGTANIRILIQSEHTTPYLEWRIESFLEQFGKTLKEMSDRDFENHK-------- 871

Query: 968  DGGCRGDANESSGPADLLSELVANVQIGDSEILSSQTMKR 1007
            D  C+    +     +  S   A++ +GD   L  Q   R
Sbjct: 872  DALCKTLLQKYKNMKEESSRYTASIYLGDYNFLHRQNKAR 911

>KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1004

 Score =  171 bits (433), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 123/393 (31%), Positives = 182/393 (46%), Gaps = 48/393 (12%)

Query: 10  DIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPSEIPGLAHL 69
           D  FL P   + R ++  +LPN L  LLISD   +              DP  +PGLAH 
Sbjct: 49  DSEFLKP-DLDDRKYRYIQLPNNLKALLISDAEADKAAAALDVNIGSFQDPEHLPGLAHF 107

Query: 70  CEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSLQEGFDEAL 129
           CEH+ L  G+ KYPD   Y   + K+GGS NA+T  + T++YF      H   E    AL
Sbjct: 108 CEHL-LFMGNEKYPDENDYSSFLSKHGGSSNAYTGSQNTNYYF------HLNHENLYPAL 160

Query: 130 DVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFSTGN 189
           D F+ FFS PLFN    +KE  A++SE+  NL +     YQ  + L N  HP+ +FSTGN
Sbjct: 161 DRFSGFFSCPLFNKASTDKEINAVDSENKKNLQNDIWRMYQLDKSLTNWEHPYHKFSTGN 220

Query: 190 ISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTKFSLIKNNP 249
           I TL  IP            ++ K N+ A+ M LC+ G + + +LA      + L K+ P
Sbjct: 221 IKTLGDIPKLKGIDIRNELLDFHKNNYSANLMKLCVLGREDLDTLADWV---YELFKDVP 277

Query: 250 QRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQEKFIFIKSS 309
                                        N++K   +P Y  +L +T  + +K ++ K  
Sbjct: 278 -----------------------------NLNKQ--VPYYPARL-YTESQLKKMVYCKPV 305

Query: 310 KN-PAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGWVTYSYAFV 368
           K+   + F FP  + +  + SK    L+H    L G E  GS   +L+ KGW     A  
Sbjct: 306 KDLKKIEFTFPTPDMDPYWESKPNHYLSH----LIGHEGNGSLLAFLKEKGWAVELSAGS 361

Query: 369 SEVAIGNSNLILELDLTRTGFQNLSHIAKVLFE 401
             ++  N+   +E+DLT  G  +++ I    F+
Sbjct: 362 HTISKDNAVFGIEIDLTDDGMNHVNEIIISTFQ 394

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 70/370 (18%), Positives = 146/370 (39%), Gaps = 46/370 (12%)

Query: 683  ITSNKGDIRLGFTISGFSKQLTSFVKSIIETIKRISQDPDFLSKETLRRARILVRNKYEN 742
            IT  K +  +    SG++++LT  +   +E IK         +    R  + L   +Y+ 
Sbjct: 616  ITLGKTNQGIDIQASGYNEKLTILLTRFLEGIKSFQPKESRFNVIKNRLLQKLSNQQYDV 675

Query: 743  AANENCANIGSIGLYIVLEKYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSLFVQG 802
              N+    I ++   +V E+  WT + +L+  +D+  ++ K F  +      + SL V G
Sbjct: 676  PYNQ----ISNVFNSLVNER-SWTTKAKLDVTKDLTFEHLKSFVPTIYEQLFHESL-VLG 729

Query: 803  DLSC--ADELNEYLHRSFTHHLGGGIYETQGKTFTVETTKMLEPGTNACVQHGGQKDDPN 860
            + S   A E+N+ +       +       + K   + +  + E            K + N
Sbjct: 730  NFSVEMAYEINQLVDILVVDRIPN----LEVKNNKLRSYILPEESAFRYEYMLEDKANVN 785

Query: 861  NSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELRNKRQVGYLVIGGLRLLSNSVGLH 920
            + I Y IQ G  ++ +    +  +  I        LR K Q+GY+V   +     +  L 
Sbjct: 786  SCIQYLIQLGAYSEELAAKASLVSQLIHEPCFD-TLRTKEQLGYIVFSAVANTHGTTNLR 844

Query: 921  ITIMSGGSPLDLETKIDEYLWYLESQLQKLDEQTFHQEYVRCYLQLLDGGCRGDANESSG 980
            + + S      +E++I ++L      L+++ E+ F +                     SG
Sbjct: 845  VLVQSERDSAYVESRIVKFLNSFGEALKEMPEEAFEK-------------------HKSG 885

Query: 981  PADLLSELVANVQIGDSEILSSQTMKRHKKLQTQIIQEQYDFVTESEALDDDLISQMSLE 1040
                L + + N++            + + +  T I    Y+F +       D+I+++S E
Sbjct: 886  LIKNLLQKLTNLR------------QEYDRFTTAIYLADYNFCSYQRRA--DIITKLSKE 931

Query: 1041 QYLSFFKHYI 1050
              + F+K+++
Sbjct: 932  DMVEFYKNFV 941

>Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa]
           {ON} YLR389C (REAL)
          Length = 1022

 Score =  171 bits (433), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 136/460 (29%), Positives = 207/460 (45%), Gaps = 56/460 (12%)

Query: 2   VSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPS 61
           ++   K +D+ FL P   + R+++  +LPN L  LLI DP  +              DP 
Sbjct: 53  MTSNFKTFDLDFLKP-DLDERSYRFIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPE 111

Query: 62  EIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSL 121
            +PGLAH CEH+ L  GS K+PD   Y   + K+GGS NA+T  + T+++FE   I H  
Sbjct: 112 SLPGLAHFCEHL-LFMGSEKFPDENEYSSYLSKHGGSSNAYTASQNTNYFFE---INHQH 167

Query: 122 QEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHP 181
             G   ALD FA FFS PLFN    +KE  A+ SE+  NL +     YQ  + L N NHP
Sbjct: 168 LFG---ALDRFAGFFSCPLFNKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNPNHP 224

Query: 182 FSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTK 241
           + +FSTGNI TL ++P            ++    + A+ M LC+ G + + +L+      
Sbjct: 225 YHKFSTGNIETLGTLPKENGQNVRDELLQFHNNFYSANLMKLCILGREDLDTLSDWTYNL 284

Query: 242 FSLIKNNPQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQE 301
           F  I NN +                                   +P Y  +    S+  +
Sbjct: 285 FKDISNNDRE----------------------------------VPHY-AEPIMQSEYLQ 309

Query: 302 KFIF---IKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSK 358
           K I    +K  K   + F  P M+   ++ SK  +IL+H    L G E  GS    L++ 
Sbjct: 310 KIIQVHPVKDLKKLEISFTVPDMDE--KWESKPPRILSH----LIGHEGSGSLLAHLKNV 363

Query: 359 GWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTLELAQF 418
           GW     A    V+ GN+   +++DLT  G  +   +  ++F Q I  L  KN+L     
Sbjct: 364 GWANELSAGGHTVSKGNAFFAVDIDLTDNGLTHYRDVIVLVF-QYIEML--KNSLPQKWI 420

Query: 419 MSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALD 458
            S+   I    F ++ A  SP     +L+  ++ +   +D
Sbjct: 421 FSELQDICNASFKFKQAG-SPSSTVSSLAKFLEKEYIPVD 459

>KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON}
           Anc_4.246 YLR389C
          Length = 1011

 Score =  170 bits (431), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 116/398 (29%), Positives = 187/398 (46%), Gaps = 52/398 (13%)

Query: 7   KYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPSEIPGL 66
           K + + F+ P   + R+++  KLPN L  L+I DPT +              DP  +PGL
Sbjct: 48  KDFKLNFIKP-DLDDRSYRFIKLPNNLKALVIQDPTADKAAAALDVNIGAFEDPEHLPGL 106

Query: 67  AHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSLQEGFD 126
           AH CEH+ L  GS K+PD   Y   + K+GGS NA+T+   T++YFE+        E   
Sbjct: 107 AHFCEHL-LFMGSEKFPDENEYSSFLSKHGGSSNAYTSSLNTNYYFEVN------HEHLY 159

Query: 127 EALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFS 186
            ALD F+ FF+ PLFN    +KE  A++SE+  NL +     YQ  + L+N  HP+ +FS
Sbjct: 160 NALDRFSGFFTCPLFNKGSTDKEISAVDSENKKNLQNDVWRIYQLDKSLSNLQHPYHKFS 219

Query: 187 TGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTKFSLIK 246
           TGN+ TL   P            +++  ++ A+ M LC+ G + + +L+  A   F  ++
Sbjct: 220 TGNLITLGENPKSLNLNIRDELLKFYYHSYSANLMKLCIIGREDLDTLSNWAYKLFKDVR 279

Query: 247 NNPQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQEKFIFI 306
           N                                   N  LP+Y  ++   +  Q K I +
Sbjct: 280 NT----------------------------------NRALPEYSSKILNETHLQ-KIIQV 304

Query: 307 KSSK---NPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGWVTY 363
           K  K      + F+ P M+R+  + SK   +L+H    L G E  GS   +L++KGW   
Sbjct: 305 KPVKELRKLEISFMVPDMDRH--WQSKPPHLLSH----LIGHEGSGSLLAYLKAKGWANE 358

Query: 364 SYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFE 401
             A    V+  N+   ++++LT+ G ++   +   +F+
Sbjct: 359 LSAGGHTVSKDNAFFSIDVELTKDGLESYKEVVHSIFQ 396

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 77/412 (18%), Positives = 148/412 (35%), Gaps = 85/412 (20%)

Query: 663  IFILLSPEIYPSLKLGFTCE------ITSNKGDIRLGFTISGFSKQLTSFVKSIIETIKR 716
            I++ L+ +    L+   +C       + +N+G   L  T+SGF+ +L + +   ++ +K 
Sbjct: 595  IYVQLANDFLKDLQYDASCANLNLSFVKTNQG---LDITLSGFNDKLVTLMTRFLQGVKD 651

Query: 717  ISQDPD----FLSKETLRRARILVRNKYENAANENCANIGSIGLY-IVLEKYMWTLEDRL 771
                 +    F  K T     +L    Y   +          G+Y  ++ +  W++E++L
Sbjct: 652  FKPTEERFKIFKDKTTQHLKNLLYEVPYSQIS----------GVYNSLINERSWSVEEKL 701

Query: 772  EALEDIDMDNFKQFCQSFLGSKKYLSLFVQGDLSCADEL------NEYLHRSFTHH---- 821
              +E I  +    F  +      Y +L V G+L   + +      N+ L  +  H+    
Sbjct: 702  NVVEHITFEQLLAFIPTVFEELYYETL-VHGNLKFEEAIEIESLINDILITNENHNNLQV 760

Query: 822  ---LGGGIYETQGKTFTVETTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIF 878
                    +  +GKT+  E         N+C+QH  Q D  N  +               
Sbjct: 761  KNNRLRSYFIPKGKTYRFEKELKDSKNVNSCIQHVTQLDVYNEELS-------------- 806

Query: 879  TLTNFTVFIMSLNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDE 938
             L+     ++       LR K Q+GY+V         +  + I + S  +   LE +I+E
Sbjct: 807  ALSGLFAQMIHEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILVQSEHTTPYLEWRIEE 866

Query: 939  YLWYLESQLQKLDEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSE 998
            +     + L+ + E+ F +          D  C+    +     +  S   A + +GD  
Sbjct: 867  FYSKFGAILKDMSEEDFDKHK--------DALCKSLLQKYKNMGEESSRYTAAIYLGDYN 918

Query: 999  ILSSQTMKRHKKLQTQIIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYI 1050
                Q   R                         L+  +S EQ + F+ +YI
Sbjct: 919  FTHRQKKAR-------------------------LVKALSKEQLIEFYDNYI 945

>Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa]
           {ON} YLR389C (REAL)
          Length = 1023

 Score =  167 bits (424), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 132/457 (28%), Positives = 203/457 (44%), Gaps = 50/457 (10%)

Query: 2   VSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPS 61
           ++   K +D+ FL P   + R+++  +LPN L  LLI DP  +              DP 
Sbjct: 54  MTANFKTFDLDFLKP-DLDERSYRFIELPNKLKALLIQDPKADKAAASLDVNVGAFEDPE 112

Query: 62  EIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSL 121
            +PGLAH CEH+ L  GS K+PD   Y   + K+GGS NA+T  + T+++FE+ N  H L
Sbjct: 113 NLPGLAHFCEHL-LFMGSEKFPDENEYSSYLSKHGGSSNAYTASQNTNYFFEV-NHQHLL 170

Query: 122 QEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHP 181
                 ALD F+ FFS PLF     +KE  A+ SE+  NL +     YQ  + L N  HP
Sbjct: 171 G-----ALDRFSGFFSCPLFQKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNSKHP 225

Query: 182 FSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTK 241
           + +FSTGNI TL   P            ++ K  + A+ M LC+ G + + +L++     
Sbjct: 226 YHKFSTGNIETLGESPKENGLNIRDELLKFHKHFYSANIMKLCILGREDLDTLSEWTYDL 285

Query: 242 FSLIKNNPQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQE 301
           F  + NN +                  + ++VNP                          
Sbjct: 286 FKDVSNNDRE--VPYYPESIMQPEHLQKIIQVNP-------------------------- 317

Query: 302 KFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGWV 361
               +K  K   + F  P ME +  + SK  +IL+H    L G E  GS    L+  GW 
Sbjct: 318 ----VKDLKKLEISFTVPDMEEH--WKSKPPRILSH----LIGHEGSGSLLAHLKELGWA 367

Query: 362 TYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTLELAQFMSK 421
               A    V+ GN+   +++DLT  G  +   +  ++F Q I  L  KN+L      ++
Sbjct: 368 NELSAGGHTVSKGNAFFAVDIDLTDNGLTHYRDVIVLIF-QYIGML--KNSLPQKWIFTE 424

Query: 422 QNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALD 458
              I    F ++ A  +P     +L+ L++ D   +D
Sbjct: 425 LQDISNATFKFKQAG-NPSSTVSSLAKLLERDYIPVD 460

>NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {ON}
           Anc_4.246
          Length = 999

 Score =  166 bits (421), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 118/386 (30%), Positives = 178/386 (46%), Gaps = 51/386 (13%)

Query: 19  FEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPSEIPGLAHLCEHMVLAAG 78
            + R+++  +LPN L  LLISDPT +              DP  +PGLAH CEH+ L  G
Sbjct: 47  LDDRSYRFIELPNKLKALLISDPTTDKAAASLDVNIGAFEDPESLPGLAHFCEHL-LFMG 105

Query: 79  SRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSLQEGFDEALDVFASFFSE 138
           S K+PD   Y   + K+GG  NA+T  + T+++FE+        E    ALD F+ FFS 
Sbjct: 106 SEKFPDENDYSSFLSKHGGHSNAYTGSQNTNYFFEIN------YEHLKGALDRFSGFFSC 159

Query: 139 PLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFSTGNISTLNSIPH 198
           PLFN    +KE  A++SE+  NL S     YQ  + L+  +HP+ +FSTGN+ TL  IP 
Sbjct: 160 PLFNIGSTDKEINAVDSENKKNLQSDMWRIYQLDKSLSLLDHPYHKFSTGNLETLKIIPE 219

Query: 199 XXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTKFSLIKNNPQRYXXXXXX 258
                      +++  N+ A+ M LC+ G + + +L+    + F  +K            
Sbjct: 220 SKNVNVRDELLKFYNANYSANLMKLCIIGREDLDTLSDYVQSFFKDVK------------ 267

Query: 259 XXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQEKFIF---IKSSKNPAVR 315
                               NI K   LP Y  ++    D+  K +    +K  +   V 
Sbjct: 268 --------------------NIDKE--LPFYDSKI-LNDDQLTKIVSVEPVKELRKLEVS 304

Query: 316 FIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGWVTYSYAFVSEVAIGN 375
           F+ P  E  T + SK   IL+H    L G E  GS    L++ GW     A    V+ GN
Sbjct: 305 FVVPDYE--THWESKIPHILSH----LIGHEGNGSLLSHLKTLGWANELSAGGHTVSRGN 358

Query: 376 SNLILELDLTRTGFQNLSHIAKVLFE 401
           +   +++DLT  G +N   +  + F+
Sbjct: 359 AFFSIDIDLTENGLKNYEQVILLAFQ 384

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 112/291 (38%), Gaps = 43/291 (14%)

Query: 683 ITSNKGDIRLGFTISGFSKQLTSFVKSIIETIKRISQDPDFLSKETLRRARILVRNKYEN 742
           ++ +K +  L  ++SGF+ +L   +   ++ IK      DF  K T  R +I      ++
Sbjct: 609 VSLSKTNQGLDISLSGFNDKLIILLTRFLQGIK------DF--KPTSERFQIFKDKTIQH 660

Query: 743 AANE----NCANIGSIGLYIVLEKYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSL 798
             N       + + S+   ++ EK  W  E++L  +  + +D    F   F+  + +   
Sbjct: 661 LKNSMYEVPYSQMSSLYNALINEK-TWLPEEKLNMMNKLTLDQLNSFI-PFIFDELFFEC 718

Query: 799 FVQGDLSCADELNEY-----LHRSFTHHLGGGIYETQ---------GKTFTVETTKMLEP 844
           FV G+L   DE  E      L  S   +L    YE +          KT+  ET      
Sbjct: 719 FVHGNLKY-DEAIEIESLIDLLMSSKENLTNSQYENEKLRSYLLPKNKTYRYETLLKDRK 777

Query: 845 GTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELRNKRQVGY 904
             N+C+QH  Q D      IY           +  +      ++       LR K Q+GY
Sbjct: 778 NVNSCIQHVIQVD------IY--------SEELSAICGLFAQMLHEPCFDTLRTKEQLGY 823

Query: 905 LVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQLQKLDEQTF 955
           +V         +  + I + S  S   LE +IDE+       L  + ++ F
Sbjct: 824 VVFSSTLNNHGTANIRILVQSEKSTPYLEWRIDEFYKKFGDLLNGMSDEDF 874

>TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {ON}
           Anc_4.246 YLR389C
          Length = 965

 Score =  165 bits (418), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 119/403 (29%), Positives = 183/403 (45%), Gaps = 52/403 (12%)

Query: 2   VSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPS 61
           +S   K Y++ F  P   + R ++  +LPN L  LLI D T +              DP 
Sbjct: 1   MSTPYKTYNLNFAKP-DLDDRNYRFIELPNSLKVLLIQDATTDKAAASLDVNIGAFEDPE 59

Query: 62  EIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSL 121
            +PGLAH CEH+ L  GS KYPD   Y   +  NGGS NA+T    T+++FE+       
Sbjct: 60  GLPGLAHFCEHL-LFMGSEKYPDENEYSSFLSTNGGSYNAYTGALNTNYFFEIN------ 112

Query: 122 QEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHP 181
            E  + ALD F+ FFS PLF+    +KE  A++SE+  NL S     YQ  + L+N  HP
Sbjct: 113 YEHLEGALDRFSGFFSRPLFSKDSTDKEINAVDSENKKNLQSDVWRMYQLDKSLSNRKHP 172

Query: 182 FSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTK 241
           + +FSTGNI TL +IP+           +++  ++ A+ M L + G + +  L   A + 
Sbjct: 173 YHKFSTGNIQTLGTIPNEQGLDIRDELLKFYNNSYSANLMKLTILGREDLDILGDWAYSM 232

Query: 242 FSLIKNNPQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQE 301
           F  +KN                                   N  LP Y  ++  T +   
Sbjct: 233 FKDVKN----------------------------------LNRELPVYEEKM-LTEEYLM 257

Query: 302 KFIFIKSSKNP---AVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSK 358
           + I IK  ++     + F  P +++   + SK  +IL+H    L G E  GS    L+  
Sbjct: 258 QIINIKPVQDMRKLELSFTVPDLDK--EWESKTPRILSH----LLGHEGSGSLLAHLKCL 311

Query: 359 GWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFE 401
           GW T   A    ++  N+   +++DLT  GF +   +   +F+
Sbjct: 312 GWATELAAGGHTISDDNAVFSVDIDLTEEGFNHYEDVTVAIFQ 354

 Score = 55.8 bits (133), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 63/296 (21%), Positives = 126/296 (42%), Gaps = 49/296 (16%)

Query: 680 TCEITSNKGDIRLGFTISGFSKQLTSFVKSIIETIKRISQDPDFLSKETLRRARILV-RN 738
           + +I+ +K    L  T+SGF+ ++   ++S ++ IK             L ++R L+ + 
Sbjct: 573 SLDISFSKTGQGLDITVSGFNHKILILLESFLKGIKNFK----------LEKSRFLIFQE 622

Query: 739 KYENAANENCANI--GSIGLYI--VLEKYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKK 794
           KY          +  G +  Y   V++   W+++++L  ++ +  ++ + F  +      
Sbjct: 623 KYIQQLKNMLFQVPYGQVSHYYNYVIDDRAWSIKEKLSTMQKLTFEDLENFLPTIFNEVY 682

Query: 795 YLSLFVQGDLSCAD--ELNEYLHRSFTHHLGGGIYETQ-------------GKTFTVETT 839
           + SL V G+   +D  E+N+ + +    ++ G I+  Q             G+T+  ET 
Sbjct: 683 FESL-VHGNFEKSDAAEVNQLVEK----YISGSIHNPQIRNDRLRSYVLQKGETYRYETL 737

Query: 840 KMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELRNK 899
                  N+C+QH               Q G  NDR+    + F   I      + LR K
Sbjct: 738 LEDPENVNSCIQH-------------VTQIGLYNDRLAALSSLFAQIINEPCFNI-LRTK 783

Query: 900 RQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQLQKLDEQTF 955
            Q+GY+V         +  + I + S  +   LE +IDE+   +++ L ++  +TF
Sbjct: 784 EQLGYVVFSSSLNNYGTTNIRILVQSEHTTEYLEWRIDEFYKSVKTILTQMAPETF 839

>TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4.246
           YLR389C
          Length = 1041

 Score =  165 bits (417), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 118/406 (29%), Positives = 180/406 (44%), Gaps = 58/406 (14%)

Query: 2   VSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPS 61
           +S   K  +  FL P   + R+++  +LPN L  LLISDP  +              DP 
Sbjct: 72  MSNSYKTLNSDFLKP-DLDDRSYRYIQLPNSLKALLISDPQTDKAAASIDVNVGAFEDPE 130

Query: 62  EIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSL 121
            +PGLAH CEH+ L  GS K+PD   Y   + K+GG  NA+T    T+++FE+       
Sbjct: 131 NLPGLAHFCEHL-LFMGSEKFPDQNEYSSYLSKHGGHSNAYTAALNTNYFFEVN------ 183

Query: 122 QEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHP 181
            E    ALD F+ FF+ PL N+    KE  A++SE+  NL +     YQ  + ++N NHP
Sbjct: 184 HEHLHGALDRFSGFFTGPLMNADSTEKEINAVDSENKKNLQNDDWRRYQMDKTISNYNHP 243

Query: 182 FSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTK 241
           + +FSTGNI TL   P            +++  ++ A+ M LC+ G Q + +L+  A   
Sbjct: 244 YHKFSTGNIKTLMEEPTKLGLNTRNELLKFYNSSYSANIMKLCILGRQDLDTLSNWATEF 303

Query: 242 FSLIKNNPQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQE 301
           F  +KN                                   N  LP+Y   +     E+E
Sbjct: 304 FKDVKN----------------------------------LNKALPQYNENIL----EEE 325

Query: 302 KFIF------IKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWL 355
                     +K  K   + F+ P M+    + S+   +L+H    L G E  GS   +L
Sbjct: 326 HLKKIIKIIPVKDLKKLEINFVVPDMD--LHWESRPHHVLSH----LIGHEGSGSILSYL 379

Query: 356 QSKGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFE 401
           +  GW     A    V+  N+   + +DLT  G +N   IA ++F+
Sbjct: 380 KKLGWANDLSAGAHTVSKDNAFFGINVDLTDKGLENYQEIALLIFQ 425

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 77/381 (20%), Positives = 147/381 (38%), Gaps = 59/381 (15%)

Query: 609 PHLVSQNCYHEMWVMPDDE--DPSLHLKSIVSFEIFGLDLEACPRNTMNLEILGQIIFIL 666
           PHL+  N   ++W   DD    P  ++          + L +C    +N  + G  +++ 
Sbjct: 578 PHLILDNDISKVWYKKDDRFWQPRGYI-------YVSMKLPSCQSGIVNSLLNG--LYVD 628

Query: 667 LSPEIYPSLKLGFTCE------ITSNKGDIRLGFTISGFSKQLTSFVKSIIETIKRISQD 720
              +    L+   +C        ++N+G   L  TISGF+ +L   +   IE +K     
Sbjct: 629 QINDYMKDLQYDASCANLNLSFSSTNQG---LDITISGFNDKLLVLLSRFIEGVK----- 680

Query: 721 PDFLSKETLRRARILVRNKYENAANE----NCANIGSIGLYIVLEKYMWTLEDRLEALED 776
              L + +  R  I      +N  N       + +G++    ++ +  W ++++L+ LE 
Sbjct: 681 ---LYQPSEERFNIFKNKAIQNLKNSLFEVPYSQMGTL-YNTIMNESTWPIKEKLDVLEA 736

Query: 777 IDMDNFKQFCQSFLGSKKYLSLFVQGDLSC--ADELNEYLH-----RSFTHHLGGGIYET 829
           +  D F  F  S + ++ Y    V G++    A E N+ L      +    H+      +
Sbjct: 737 LTFDQFVSFVPS-IYNEFYFDALVHGNIRYEEAMEANDLLKSLASFKILNLHVRNSRLRS 795

Query: 830 ----QGKTFTVETTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTV 885
               +G+++  E     +   N+C+QH              +Q G   + +   L+    
Sbjct: 796 YILPEGESYRYEIDMEDKDNLNSCIQH-------------VVQLGLYTEELS-ALSGLFA 841

Query: 886 FIMSLNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLES 945
            ++       LR K Q+GY+V         +  + I + S  S   LE +IDE+      
Sbjct: 842 QMIREPCFDTLRTKEQLGYVVFSSNLNNHGTANMRILVQSEHSTSYLEWRIDEFYKKFGE 901

Query: 946 QLQKLDEQTFHQEYVRCYLQL 966
            L  + E+ F +     Y  L
Sbjct: 902 SLNNMSEEDFEKHKDALYKSL 922

>NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {ON}
           Anc_4.246
          Length = 995

 Score =  165 bits (417), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 113/404 (27%), Positives = 186/404 (46%), Gaps = 51/404 (12%)

Query: 1   MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDP 60
           M +   K +++ F  P   + R+++  +LPN L  LLI+DP  +             NDP
Sbjct: 25  MTAASYKNHNLSFQKP-DLDERSYRFIELPNKLKALLITDPKTDKAAASLDVNIGSFNDP 83

Query: 61  SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120
             +PGLAH CEH+ L  GSRK+PD   Y   + K+GG  NA+T    T+++FE+      
Sbjct: 84  EPLPGLAHFCEHL-LFMGSRKFPDENDYSSFLSKHGGHSNAYTGSSNTNYFFEIN----- 137

Query: 121 LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180
             E    ALD F+ FF+ PLFN    +KE  A++SE+  NL +     YQ  + L+N  H
Sbjct: 138 -AEHLFGALDRFSGFFTGPLFNKNATDKEINAVDSENKKNLQNDLWRIYQLDKSLSNLKH 196

Query: 181 PFSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240
           P+ +FSTGNI TL  +P            +++ +++ A+ M LC+ G + + +LA+    
Sbjct: 197 PYHKFSTGNIQTLKQLPESQGLNIRDELLKFYDDSYSANLMKLCIIGREDLDTLAQWTAD 256

Query: 241 KFSLIKNNPQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQ 300
            F+ +KN                                  K+  LP ++  +       
Sbjct: 257 LFNDVKN----------------------------------KDKPLPVFQDPILLKEQHL 282

Query: 301 EKFIF---IKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQS 357
           ++ I    +K  +   + F  P  E++  + SK   IL+H    L G E  GS    L++
Sbjct: 283 QRIIQVEPVKELRKLDIEFCVPDYEKH--WQSKIPHILSH----LIGHEGNGSLLSHLKT 336

Query: 358 KGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFE 401
            GW     A    V+  N+   + ++LT+ G  +   +  ++F+
Sbjct: 337 LGWANELSAGGHTVSENNAFFSIAIELTQKGLAHYKDVTHLIFQ 380

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 80/362 (22%), Positives = 136/362 (37%), Gaps = 42/362 (11%)

Query: 609 PHLVSQNCYHEMWVMPDDE--DPSLHLKSIVSFEIFGLDLEACPRNTMNLEILGQIIFIL 666
           PHL+ +    ++W   DD    P  H+   +SF++    L     N+M   +  Q+I   
Sbjct: 532 PHLLKETELGKLWYKKDDRFWQPRGHI--YISFKLPHTHLSLL--NSMLTTLYVQLINDS 587

Query: 667 LSPEIYPSLKLGFTCEIT-SNKGDIRLGFTISGFSKQLTSFVKSIIETIKRISQDPDFLS 725
           L    Y +        +T +N+G   L  T+SGF+ +L   +   ++ IK    + D   
Sbjct: 588 LKDLQYDASCANLHASLTKTNQG---LDITVSGFNDKLIILLTRFLQGIKSFKPNSDRFQ 644

Query: 726 KETLRRARILVRNKYENAANENCANIGSIGLYIVLEKYMWTLEDRLEALEDIDMDNFKQF 785
               +  + L  + YE   ++      S+     + +  WT  ++L AL+ I  D    F
Sbjct: 645 IFKDKTIQHLQNSLYEVPYSQMSTLYNSL-----INERTWTTTEKLSALDKISYDQLLTF 699

Query: 786 CQSFLGSKKYLSLFVQGDLSCADEL------------NEYLHRSFTHHLGGGIYETQGKT 833
             +    + Y    + G+L   + +            N  L+    +         +GKT
Sbjct: 700 IPTIF-EELYFESLIHGNLKYDEAMEIDSLVKLLLTENNILNLQIQNDKLRSYILPKGKT 758

Query: 834 FTVETTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLA 893
           F  ET        N+C+QH  Q D      IY       ++ +      F   I      
Sbjct: 759 FRYETDLKDPKNVNSCIQHVTQID------IY-------SEELSAKCALFAQMIHEPCFD 805

Query: 894 LELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQLQKLDEQ 953
             LR K Q+GY+V         +  + I + S  S   LE +ID +       L+ + E 
Sbjct: 806 -TLRTKEQLGYVVFSSTLNNHGTANIRILVQSEKSTPYLEWRIDNFYKIFGKSLKTMSED 864

Query: 954 TF 955
           TF
Sbjct: 865 TF 866

>YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}
           STE23Metalloprotease involved, with homolog Axl1p, in
           N-terminal processing of pro-a-factor to the mature
           form; expressed in both haploids and diploids; member of
           the insulin-degrading enzyme family
          Length = 1027

 Score =  164 bits (415), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 130/455 (28%), Positives = 204/455 (44%), Gaps = 56/455 (12%)

Query: 2   VSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPS 61
           ++   K +++ FL P   + R+++  +LPN L  LLI DP  +              DP 
Sbjct: 53  MTSNFKTFNLDFLKP-DLDERSYRFIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPK 111

Query: 62  EIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSL 121
            +PGLAH CEH+ L  GS K+PD   Y   + K+GGS NA+T  + T+++FE   + H  
Sbjct: 112 NLPGLAHFCEHL-LFMGSEKFPDENEYSSYLSKHGGSSNAYTASQNTNYFFE---VNHQH 167

Query: 122 QEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHP 181
             G   ALD F+ FFS PLFN    +KE  A+ SE+  NL +     YQ  + L N  HP
Sbjct: 168 LFG---ALDRFSGFFSCPLFNKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNTKHP 224

Query: 182 FSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTK 241
           + +FSTGNI TL ++P            ++ K  + A+ M LC+ G + + +L+      
Sbjct: 225 YHKFSTGNIETLGTLPKENGLNVRDELLKFHKNFYSANLMKLCILGREDLDTLSDWTYDL 284

Query: 242 FSLIKNNPQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQE 301
           F  + NN +                                   +P Y  +     +  +
Sbjct: 285 FKDVANNGRE----------------------------------VPLY-AEPIMQPEHLQ 309

Query: 302 KFIFIKSSKNPA---VRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSK 358
           K I ++  K+     + F  P ME +  + SK  +IL+H    L G E  GS    L+  
Sbjct: 310 KIIQVRPVKDLKKLEISFTVPDMEEH--WESKPPRILSH----LIGHEGSGSLLAHLKKL 363

Query: 359 GWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTLELAQF 418
           GW     A    V+ GN+   +++DLT  G  +   +  ++F Q I  L  KN+L     
Sbjct: 364 GWANELSAGGHTVSKGNAFFAVDIDLTDNGLTHYRDVIVLIF-QYIEML--KNSLPQKWI 420

Query: 419 MSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDD 453
            ++   I    F ++ A  SP     +L+  ++ D
Sbjct: 421 FNELQDISNATFKFKQAG-SPSSTVSSLAKCLEKD 454

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 70/354 (19%), Positives = 130/354 (36%), Gaps = 54/354 (15%)

Query: 683  ITSNKGDIRLGFTISGFSKQLTSFVKSIIETIKRISQDPD---FLSKETLRRAR-ILVRN 738
            I+ NK +  L  T SGF+++L   +   ++ +       D    L  +T+R  + +L   
Sbjct: 628  ISFNKTNQGLAITASGFNEKLIILLTRFLQGVNSFEPKKDRFEILKDKTIRHLKNLLYEV 687

Query: 739  KYENAANENCANIGSIGLYIVLEKYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSL 798
             Y   +N   A         ++ +  W+  ++L+  E +  +    F  + +    Y   
Sbjct: 688  PYSQMSNYYNA---------IINERSWSTAEKLQVFEKLTFEQLINFIPT-IYEGVYFET 737

Query: 799  FVQGDLSC-----ADELNEYLHRSFTHHLG------GGIYETQGKTFTVETTKMLEPGTN 847
             + G++        D L + L  +  H+L             +GKTF  ET        N
Sbjct: 738  LIHGNIKHEEALEVDSLIKSLIPNNIHNLQVSNNRLRSYLLPKGKTFRYETALKDSQNVN 797

Query: 848  ACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELRNKRQVGYLVI 907
            +C+QH  Q D      +Y           +  L+     ++       LR K Q+GY+V 
Sbjct: 798  SCIQHVTQLD------VY--------SEDLSALSGLFAQLIHEPCFDTLRTKEQLGYVVF 843

Query: 908  GGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQLQKLDEQTF--HQEYVRCYLQ 965
                    +  + I I S  +   LE +I+ +       L+ + E+ F  H+E +     
Sbjct: 844  SSSLNNHGTANIRILIQSEHTTPYLEWRINNFYETFGQVLRDMPEEDFEKHKEAL----- 898

Query: 966  LLDGGCRGDANESSGPADLLSELVANVQIGDSEILSSQTMKRHKKLQTQIIQEQ 1019
                 C     +    A+  +   A + +GD      Q   +  KL   I ++Q
Sbjct: 899  -----CNSLLQKFKNMAEESARYTAAIYLGDYNFTHRQ---KKAKLVANITKQQ 944

>Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON}
           (216511..219573) [3063 nt, 1021 aa]
          Length = 1020

 Score =  164 bits (414), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 111/402 (27%), Positives = 185/402 (46%), Gaps = 48/402 (11%)

Query: 1   MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDP 60
           +  K  K +D+ F+ P   + R+++  +LPN    LLI D + +              DP
Sbjct: 53  VTKKPYKIHDLNFIKP-DLDDRSYRFIELPNKFKALLIHDASTDKSAASLDVNIGAFQDP 111

Query: 61  SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120
             + GLAH CEH+ L  GS+K+P+   Y   + K+GGS NA+T  + T+++FE+      
Sbjct: 112 KNLQGLAHFCEHL-LFMGSKKFPNENEYSSYLNKHGGSSNAYTGAQNTNYFFEIN----- 165

Query: 121 LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180
             E    ALD F+ FF+ PLFN    +KE  A++SE+  NL +     YQ  + L+N  H
Sbjct: 166 -HEHLHGALDRFSGFFTCPLFNPNSTSKEINAVDSENKKNLQNDVWRMYQLDKSLSNEKH 224

Query: 181 PFSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240
           P+ +FSTGN+ TL+ +P            +++ +++ A+ M LC+ G + + +++     
Sbjct: 225 PYHKFSTGNLKTLDEMPKKEGLDIRNELLKFYSDSYSANLMKLCVLGREDLDTMSDWVYN 284

Query: 241 KFSLIKNNPQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQ 300
            F  + NN                                  N  LP+Y   +    +  
Sbjct: 285 LFEAVPNN----------------------------------NRPLPEYNEPILL-EENL 309

Query: 301 EKFIFIKSSKN-PAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKG 359
           +K I +K  K+   +   F A + +  + SK   IL+H    L G E  GS    L++  
Sbjct: 310 KKIIHVKPVKDLKKLEITFLAQDMDLFWESKPQHILSH----LIGHEGSGSILSHLKTLS 365

Query: 360 WVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFE 401
           W     A    V+  N+   +++DLT  GFQ+   I  ++F+
Sbjct: 366 WANELSAGGHTVSKDNAFFSIDIDLTENGFQHYKEIVHIVFQ 407

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 80/401 (19%), Positives = 154/401 (38%), Gaps = 87/401 (21%)

Query: 674  SLKLGFTCEITSNKGDIRLGFTISGFSKQLTSFVKSIIETIKRISQDPDFLSKETLRRAR 733
            +L L F+    +N+G   L  TISGF+ +L   ++  I  +         + + +  R +
Sbjct: 626  NLHLSFS---KTNQG---LDITISGFNDKLIVLLQRFIYGVS--------VYQPSKLRFK 671

Query: 734  ILVRNKYENAANENC------ANIGSIGLYIVLEKYMWTLEDRLEALEDIDMDNFKQFCQ 787
            I      +N   +NC      + I ++   ++ E+  W+++ +L  +E I  + F  F  
Sbjct: 672  IFKEKTIQNL--KNCLYEVPYSQISTLYSSLINER-TWSVKQKLSIIEKITYEQFLAFLP 728

Query: 788  SFLGSKKYLSLFVQGDLSC--ADELNEYLHRSFTH-----HLGGGIYET----QGKTFTV 836
            + +  + Y    V G+     A E++  +    T      H+      +     G+T+  
Sbjct: 729  T-IYEECYFDGLVHGNFRNEEAVEIDSLVQSLITTDIVNLHVKNTRLRSYVIPNGETYRF 787

Query: 837  ETTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALEL 896
            E         N+CVQH              +Q G  ++ +   ++     I++      L
Sbjct: 788  EIDLEDAENVNSCVQH-------------VVQLGGYSEELS-AMSGLFAQILNEPCFDTL 833

Query: 897  RNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQLQKL--DEQT 954
            R K Q+GY+V         +  + I + S  S   LE +IDE+       L+ +  DE  
Sbjct: 834  RTKEQLGYVVFSSSLNNHGTANIRILVQSEHSTPYLEWRIDEFYKSFGETLRNMSDDELE 893

Query: 955  FHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEILSSQTMKRHKKLQTQ 1014
             H+          D  C+    +     +  S   A + +GD                  
Sbjct: 894  KHK----------DALCKSLMQKYKNMKEENSRYTAAIYLGD------------------ 925

Query: 1015 IIQEQYDFVTESEALDDDLISQMSLEQYLSFFK-HYISIHS 1054
                 Y+F    +    +L++Q+S +Q + FF+ H+IS ++
Sbjct: 926  -----YNFTHRQKKA--NLVAQISKDQLIKFFEDHFISANA 959

>Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa]
           {ON} YLR389C (REAL)
          Length = 1025

 Score =  161 bits (407), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 116/392 (29%), Positives = 178/392 (45%), Gaps = 52/392 (13%)

Query: 13  FLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPSEIPGLAHLCEH 72
           FL P   + R+++  +LPN L  LLI DP  +              DP ++PGLAH CEH
Sbjct: 64  FLKP-DLDERSYRYIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPEKLPGLAHFCEH 122

Query: 73  MVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSLQEGFDEALDVF 132
           + L  GS K+PD   Y   + K+GGS NA+T  + T+++FE+ +     Q  FD ALD F
Sbjct: 123 L-LFMGSEKFPDENEYSSFLSKHGGSSNAYTASQNTNYFFEVNH-----QHLFD-ALDRF 175

Query: 133 ASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFSTGNIST 192
           + FFS PLFN    +KE  A+ SE+  NL +     YQ  + L N  HP+ +FSTGNI T
Sbjct: 176 SGFFSCPLFNKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNTKHPYHKFSTGNIET 235

Query: 193 LNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTKFSLIKNNPQRY 252
           L + P            ++ K+ + A+ M LC+ G + + +L+      F          
Sbjct: 236 LGTSPKENGLNIRDELLKFHKDFYSANLMKLCILGREDLDTLSDWVYDLFK--------- 286

Query: 253 XXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQEKFIFIKSSKNP 312
                                     N+S N     Y  +     +  +K I ++  K+ 
Sbjct: 287 --------------------------NVSNNGREVPYYAEPIMQPEHLQKIIQVRPVKDL 320

Query: 313 A---VRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGWVTYSYAFVS 369
               + F  P ME +  + S+  +IL+H    L G E  GS    L+  GW     A   
Sbjct: 321 KKLEISFAVPDMEEH--WESRPPRILSH----LIGHEGSGSLLAHLKKLGWANELSAGGH 374

Query: 370 EVAIGNSNLILELDLTRTGFQNLSHIAKVLFE 401
            V+ GN+   +++DLT  G  +   +  ++F+
Sbjct: 375 TVSKGNAFFAVDIDLTDNGLIHYRDVIILIFQ 406

>AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR389C
           (STE23)
          Length = 1013

 Score =  160 bits (406), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 136/509 (26%), Positives = 227/509 (44%), Gaps = 80/509 (15%)

Query: 19  FEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPSEIPGLAHLCEHMVLAAG 78
            + R ++  +LPN L  LL+ D   +              DP ++PGLAH CEH+ L  G
Sbjct: 64  LDDRKYRYIELPNHLRVLLVHDKNTDKSAASLDVNVGAFEDPEDLPGLAHFCEHL-LFMG 122

Query: 79  SRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSLQEGFDEALDVFASFFSE 138
           S+K+P+   Y   + K+GG+ NA+T  + T++YF      H   E   +ALD F+ FFS 
Sbjct: 123 SKKFPNENEYASFLSKHGGASNAYTASQNTNYYF------HVNHENLYDALDRFSGFFSC 176

Query: 139 PLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFSTGNISTLNSIPH 198
           PLFN +   KE  A++SE+  NL +     YQ  + L N  HP+ +FSTGN  TL SIP 
Sbjct: 177 PLFNESSTEKEIKAVDSENKKNLQNDMWRLYQLGKSLTNPIHPYHKFSTGNFETLWSIPR 236

Query: 199 XXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTKFSLIKNNPQRYXXXXXX 258
                      +++  ++ A+ M L + G + + +LA+ A   + L K+ P         
Sbjct: 237 SKGVNVRDELLKFYNRSYSANLMKLVILGREDLDTLAQWA---YELFKDVPNH------- 286

Query: 259 XXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQEKFIFIKSSKN---PAVR 315
                                    T +P+Y  Q  FT +   K I +K  KN     + 
Sbjct: 287 ------------------------GTKVPEYHAQ-AFTPEHLMKVIKVKPVKNLKSVEIS 321

Query: 316 FIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGWVTYSYAFVSEVAIGN 375
           F+ P M+++  +  K  + L+H    L G E   S   +L++  W     A  + V+ GN
Sbjct: 322 FVVPDMDKH--WQVKPARYLSH----LIGHEGTDSLLAYLKNNSWAIDLSAGATTVSEGN 375

Query: 376 SNLILELDLTRTG-----------FQNLSHIAKVLFEQAIPALSQKNTLELAQFMSKQ-- 422
           +   + +DLT  G           FQ ++ + +VL ++ +   ++   +  A F  KQ  
Sbjct: 376 AYFSVNVDLTDEGVVQYEAVICAVFQYINMLKEVLPQEWV--FTELKDIGEAHFKFKQKG 433

Query: 423 NCIDLIRFLYQNAEIS--PMEECVNLSSLMQDD----LEALDPAYIFKGSPMMIDEQHHN 476
           N    +  L +N + +  P++  +N S + Q +    +E L+   +     M+I ++   
Sbjct: 434 NPAATVSSLSKNLQKAYLPVQVILNTSLMRQYEPGLIMEYLNSLTLENSRVMLISQK--- 490

Query: 477 IGNYGENKESDRWWIGQAIKFQSFLKQFM 505
                E   S+RW+ G       + K F+
Sbjct: 491 ----VETNLSERWY-GTEYSVADYTKDFV 514

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 68/350 (19%), Positives = 145/350 (41%), Gaps = 30/350 (8%)

Query: 682  EITSNKGDIRLGFTISGFSKQLTSFVKSIIETIKRISQDPDFLSKET-LRRARILVRNKY 740
            EI+  K +  L  ++SG++ +L   +    E I+++     FL +E  +   + L++  +
Sbjct: 623  EISLRKTNQGLDLSLSGYNDKLLVLLARFFEGIQKL-----FLREERFMVLKQRLIQKLH 677

Query: 741  ENAANENCANIGSIGLYIVLEKYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSLFV 800
             +  +     IG +   ++ E+  WT +++L+  E +  D+   F  + +  + Y  L V
Sbjct: 678  NHLYDTPYTQIGRLYSSLINER-SWTTQEKLDITEQLTFDHLANFVPT-IYEQMYFELLV 735

Query: 801  QGDLSCADELNEYLHRSFTHHLGGGIYETQGKTFTVETTKMLEPGTNACVQHGGQKDDPN 860
             G+ S  + L  Y     +  +   I  ++G+   + +  +   G          K++ N
Sbjct: 736  HGNFSHEEALEVY--DLVSSLVPNEIRNSEGRNSKLRSYFIPAGGAYHYETALADKENVN 793

Query: 861  NSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELRNKRQVGYLVIGGLRLLSNSVGLH 920
            + I   IQ G  ++ ++    +    +++      LR + Q+GY+V         +V L 
Sbjct: 794  SCIQKVIQLGAYSE-LLSAKGSLLAQMVNEPCFNTLRTEEQLGYVVFSSKLNTHGTVNLR 852

Query: 921  ITIMSGGSPLDLETKIDEYLWYLESQLQKLDEQTFHQEYVRCYLQLLDGGCRGDANESSG 980
            I + S  S   LE++ID       S L+ +    F +          D  C+    +   
Sbjct: 853  ILVQSERSSSYLESRIDTSCQKFGSTLEMMSNAEFEKHK--------DAICKTLQQKYRN 904

Query: 981  PADLLSELVANVQIGDSEILSSQTMKRHKKLQTQIIQEQYDFVTESEALD 1030
              +     V  + +GD   L       +K+ + Q++++    +T+ E LD
Sbjct: 905  LGEENDRYVTCIYLGDYNFL-------YKERKAQLVRQ----LTKKEMLD 943

>ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {ON}
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 994

 Score =  160 bits (406), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 120/392 (30%), Positives = 187/392 (47%), Gaps = 52/392 (13%)

Query: 13  FLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPSEIPGLAHLCEH 72
           F+ P   + R+++  +LPN L  LLI D   +              DP  +PGLAH CEH
Sbjct: 39  FVKP-DLDDRSYRYIQLPNDLKALLIHDSKADKAAAALDVNVGAFEDPEGLPGLAHFCEH 97

Query: 73  MVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSLQEGFDEALDVF 132
           + L  GS KYPD   Y   + K+GG+ NA+T  + T++YFE+ +      E    ALD F
Sbjct: 98  L-LFMGSEKYPDENEYSSYLSKHGGASNAYTGSQNTNYYFEVNH------EHLFGALDRF 150

Query: 133 ASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFSTGNIST 192
           A FF+ PLFN    +KE  A++SE+  NL S     YQ  + L N  HP+ +FSTGN  T
Sbjct: 151 AGFFTCPLFNRDSTDKEIKAVDSENKKNLQSDLWRLYQLDKSLTNEEHPYHKFSTGNFIT 210

Query: 193 LNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTKFSLIKNNPQRY 252
           L+ IP            +++K+++ A+ M LC+ G + + +L+  A    SL ++ P   
Sbjct: 211 LHEIPTSNGIDVREELLKFYKKSYSANLMKLCVLGREDLDTLSNWAC---SLFQDVP--- 264

Query: 253 XXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQ--EKFIFIKSSK 310
                                     NI++   +P+Y  ++    DE+  +K I  KS K
Sbjct: 265 --------------------------NIARP--VPEYGSKML---DERSLQKVIHAKSVK 293

Query: 311 N-PAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGWVTYSYAFVS 369
           +   +   F A + +  + SK   IL+H    L G E  GS    L+ KGW     A   
Sbjct: 294 DLKKLEVTFSAPDMDLEWESKPQHILSH----LVGHEGSGSLLAHLKDKGWANELSAGGH 349

Query: 370 EVAIGNSNLILELDLTRTGFQNLSHIAKVLFE 401
            V+  N+   +++DLT  G ++   +  ++F+
Sbjct: 350 SVSKENAFFSIDIDLTDLGLKHYEDVTHIIFQ 381

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 69/346 (19%), Positives = 132/346 (38%), Gaps = 45/346 (13%)

Query: 685  SNKGDIRLGFTISGFSKQLTSFVKSIIETIKRISQDPDFLSKETLRRARILVRNKYENAA 744
            +N+G   L  T+ GF+ +LT  +   +E +K    + +       +  R L    YE   
Sbjct: 608  TNQG---LDITVVGFNDKLTILLTRFLEGLKSFKPEKNRFQIFKDKCTRQLTNQLYEVPY 664

Query: 745  NENCANIGSIGLYIVLEKYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSLFVQGDL 804
             +      S+     + +  W+++++LE L+ +  +    +  + +  + +   FV G++
Sbjct: 665  LQVFPVYSSL-----INERTWSVKEKLEVLKRLTFEQLVTYLPT-IYEEMFFEAFVHGNM 718

Query: 805  SC-----ADELNEYLH----RSFTHHLGG--GIYETQGKTFTVETTKMLEPGTNACVQHG 853
                    D L + L     R+F    G     +  QG+T+  ET        N+C+QH 
Sbjct: 719  KYEEAIEVDSLVQMLVPNDIRNFQTKNGKLRSYFLPQGETYRYETKLQDSQNLNSCIQH- 777

Query: 854  GQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELRNKRQVGYLVIGGLRLL 913
                          Q G  ++ +    + F   I        LR K Q+GY+V       
Sbjct: 778  ------------VTQLGVYSEEISAKASLFAQMIHEPCFDT-LRTKEQLGYVVFSSSLNN 824

Query: 914  SNSVGLHITIMSGGSPLDLETKIDEYLWYLESQLQKLDEQTFHQEYVRCYLQLLDGGCRG 973
              +  + I + S  +   LE +I+ +L      LQ + ++ F            D  C+ 
Sbjct: 825  HGTANIRILVQSEHTTPFLEWRIESFLQGFGKILQDMSDKDFEGHK--------DALCKS 876

Query: 974  DANESSGPADLLSELVANVQIGDSEILSSQTMKRHKKLQTQIIQEQ 1019
             A +     +  S   A + +GD      Q   R  +L +Q+ +E+
Sbjct: 877  LAQKYKNMKEESSRYAAAIYLGDYNFTHKQ---RKSQLVSQLTKEE 919

>SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1006

 Score =  159 bits (401), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 107/394 (27%), Positives = 176/394 (44%), Gaps = 48/394 (12%)

Query: 9   YDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPSEIPGLAH 68
           + I F  P   + R ++  +LPN L  LLI DP  +              DP  IPGLAH
Sbjct: 48  HKISFKKP-DLDDRNYRFIQLPNNLKALLIQDPATDKAAAALDINVGAFEDPENIPGLAH 106

Query: 69  LCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSLQEGFDEA 128
            CEH+ L  GS K+PD   Y   + K+GG+ NA+T  + T++YF++ +      E    A
Sbjct: 107 FCEHL-LFMGSSKFPDENEYSSFLSKHGGASNAYTGSQNTNYYFQVNH------EDLRGA 159

Query: 129 LDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFSTG 188
           LD F+ FF+ PLFN    +KE  A++SE+  NL +     YQ  +   +  HP+ +FSTG
Sbjct: 160 LDRFSGFFTSPLFNKNSTDKEINAVDSENKKNLQNDLWRMYQLDKSFTSPMHPYHKFSTG 219

Query: 189 NISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTKFSLIKNN 248
           N+ TL   P            +++ + + A+ M LC+ G + + ++++     F  ++NN
Sbjct: 220 NLKTLGETPKNQGLDIRDELLKFYNKFYSANIMKLCVLGREDLDTMSEWVYELFKDVRNN 279

Query: 249 PQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQEKFIFIKS 308
                                             N  +P+Y   L   ++ + K I  K 
Sbjct: 280 ----------------------------------NCSVPEYSIPL-LPAEYKTKIIRAKP 304

Query: 309 SKN-PAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGWVTYSYAF 367
            K+   V   F   + +  + SK    L+H    L G E  GS   +L+ +GW     A 
Sbjct: 305 VKDLKKVEITFAVPDVDVHWESKPHHYLSH----LIGHEGSGSLLAYLKGQGWANELSAG 360

Query: 368 VSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFE 401
              V++ N+   ++++LT  G  +   +   +F+
Sbjct: 361 AHTVSVNNAFFSVDIELTNNGLDHYQDVVSSVFQ 394

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 59/289 (20%), Positives = 120/289 (41%), Gaps = 31/289 (10%)

Query: 683 ITSNKGDIRLGFTISGFSKQLTSFVKSIIETIKRISQDPDFLSKETLRRARILVRNKYEN 742
           ++ +K +  L  ++ G++++LT  +   +E IK  +   D       +  R L  + YE 
Sbjct: 616 VSFSKTNQGLDISLCGYNEKLTILLTRFLEGIKEFTPKLDRFKIFQDKLVRKLNNHLYEV 675

Query: 743 AANENCANIGSIGLYIVLEKYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSLFVQG 802
             ++      S+     + +  W+ +++L+  + +  ++ K F  + +  + Y  + V G
Sbjct: 676 PYSQLSGIFNSL-----INERSWSTKEKLDLTKQLTFEHLKNFIPT-IYEQLYYEILVHG 729

Query: 803 DLS--CADELNEYLHRSFTHHL------GGGIYE---TQGKTFTVETTKMLEPGTNACVQ 851
           + S   A E+N+ +     + +       G +      Q KTF +E     E   N+C+Q
Sbjct: 730 NFSQEAATEINDLVKMMVPNDIKNLQVKNGKLRSYIIPQEKTFRMELPLADEKNVNSCIQ 789

Query: 852 HGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELRNKRQVGYLVIGGLR 911
           H  Q          + +       ++  L +   F         LR K Q+GY+V     
Sbjct: 790 HVTQ-------FGIYSEDLSAKTALLAQLIDEPCFDT-------LRTKEQLGYVVFSSAL 835

Query: 912 LLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQLQKLDEQTFHQEYV 960
               +V L + I S      LE++ID +L    + L+++ E+ F +  V
Sbjct: 836 STHGTVNLRLLIQSERDSSYLESRIDSFLKKFGNILREMPEEEFEKHKV 884

>KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa]
           {ON} similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 1001

 Score =  157 bits (397), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 112/393 (28%), Positives = 180/393 (45%), Gaps = 46/393 (11%)

Query: 9   YDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPSEIPGLAH 68
           + + F  P   + R ++  +LPN L  LLI DPT +              DP ++PGLAH
Sbjct: 44  HGVKFTKPL-LDDRNYRFIELPNKLKALLIQDPTTDKAAAALDVNVGSFEDPEDLPGLAH 102

Query: 69  LCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSLQEGFDEA 128
            CEH+ L  GS K+P+   Y   + K+GG  NA+T+   T+++F++       QE    A
Sbjct: 103 FCEHL-LFMGSSKFPNENEYSSYLSKHGGGSNAYTSARNTNYFFQVN------QESLHGA 155

Query: 129 LDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFSTG 188
           L  F+ FFS PLFN    +KE  A++SE+  NL S     YQ  +  +N  HPF +FSTG
Sbjct: 156 LLRFSGFFSCPLFNKESTDKEINAVDSENKKNLQSDLWRLYQLDKSQSNPEHPFHKFSTG 215

Query: 189 NISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTKFSLIKNN 248
           N+ TL  IP            +++  ++ A+ M LC+ G + + ++++     + L K+ 
Sbjct: 216 NLKTLGDIPKSKDVDIRDELLKFYDSSYSANLMKLCVLGREDLDTMSQWV---YDLFKDV 272

Query: 249 PQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQEKFIFIKS 308
           P                  N    V   E  +      P+Y  Q+            +K 
Sbjct: 273 P------------------NSDRPVPTYEAKM----LPPQYLTQIINAKP-------VKD 303

Query: 309 SKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGWVTYSYAFV 368
            K   + F+ P ++   ++ SK    L+H    L G E  GS   +L+ KGW     A  
Sbjct: 304 LKKVEITFVAPDVDE--QWDSKPGHYLSH----LIGHEGSGSLLAYLKLKGWANELSAGS 357

Query: 369 SEVAIGNSNLILELDLTRTGFQNLSHIAKVLFE 401
             V+  N+   +++DLT  G +N   + + +F+
Sbjct: 358 HTVSEDNAFFSVDIDLTDEGVKNYESVIQSVFQ 390

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 63/299 (21%), Positives = 117/299 (39%), Gaps = 31/299 (10%)

Query: 680 TCEITSNKGDIRLGFTISGFSKQLTSFVKSIIETIKRISQDPDFLSKETLRRARILVRNK 739
           +  I+  K +  L  ++SG+++++   +K  +E I       D       +  + L  + 
Sbjct: 609 SLHISFRKTNQGLDLSLSGYNEKMAILLKRYLEGIANFQPAEDRFKIYQDKLLQKLNNHL 668

Query: 740 YENAANENCANIGSIGLYIVLEKYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSLF 799
           YE   ++      S     V+ +  WT+ ++LE ++ +  ++ K F  +      +  + 
Sbjct: 669 YEVPYSQVSDVFNS-----VINERAWTIANKLEVVKQLKFEHLKLFIPAIFEQFSF-EIL 722

Query: 800 VQGDLSC-----ADELNEYLHRSFTHHLG------GGIYETQGKTFTVETTKMLEPGTNA 848
           V G+ SC     AD L   L      +          +   QGKTF  +     +   N+
Sbjct: 723 VHGNFSCEAALEADNLVRALAPRDVQNFQLKSSKPRSVLLPQGKTFCYQQMLADDKNINS 782

Query: 849 CVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELRNKRQVGYLVIG 908
           C+QH               Q G  ++ +    + F   I        LR K Q+GY+V  
Sbjct: 783 CIQH-------------VTQFGSYSEELSAKASLFAQLIDEPAFDT-LRTKEQLGYVVFS 828

Query: 909 GLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQLQKLDEQTFHQEYVRCYLQLL 967
                  +V L + I S      LE++ID +L  +   LQ++ ++ F +  V     LL
Sbjct: 829 SALNTHGTVNLRLLIQSERDTAYLESRIDAFLVKMGQVLQEMSDEEFERHKVALCKTLL 887

>CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highly
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389c STE23
          Length = 1008

 Score =  157 bits (396), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 118/403 (29%), Positives = 189/403 (46%), Gaps = 53/403 (13%)

Query: 1   MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDP 60
           M  K LK   + FL P   + R ++  +LPN L  L+I D T +              DP
Sbjct: 44  MPYKDLK---VQFLKP-DLDDRQYRYIQLPNNLKALIIQDATTDKAAAALDVNIGAFQDP 99

Query: 61  SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120
             +PGLAH CEH+ L  GS K+PD   Y   + K+GGS NA+T  + T+++FE+ N  H 
Sbjct: 100 ENLPGLAHFCEHL-LFMGSEKFPDENEYSSYLSKHGGSSNAYTGSQNTNYFFEV-NADH- 156

Query: 121 LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180
                  ALD F+ FFS PLFN    +KE  A++SE+  NL +     YQ  + L+N +H
Sbjct: 157 ----LHGALDRFSGFFSCPLFNQNSTDKEINAVDSENKKNLQNDIWRMYQLDKSLSNQDH 212

Query: 181 PFSRFSTGNISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240
           P+ +FSTGN+ TL   P            +++ EN+ A+ M LC+ G + + +L++ A  
Sbjct: 213 PYHKFSTGNLETLGDKPKAAGLDIREELLKFYNENYSANLMKLCILGKEDLDTLSEWAWE 272

Query: 241 KFSLIKNNPQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSD-- 298
            F  +KN+ +                                   LP Y   +   +D  
Sbjct: 273 LFKDVKNSDRA----------------------------------LPVYDAPILKENDLK 298

Query: 299 EQEKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSK 358
           +  K   +K  +   + F+ P  E+  ++ +K    ++H++  L G E  GS    L+S 
Sbjct: 299 KIIKVKPVKDLRKLDISFVVPDYEK--KWEAK----ISHIFSHLIGHEGSGSLLAHLKSL 352

Query: 359 GWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFE 401
           GW     A    V+ GN+   ++++LT  G ++   I  ++F+
Sbjct: 353 GWANELGAGGHTVSDGNAFFNVDIELTNEGLKHYKDIVVLIFQ 395

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/288 (21%), Positives = 120/288 (41%), Gaps = 37/288 (12%)

Query: 683 ITSNKGDIRLGFTISGFSKQLTSFVKSIIETIKRISQDPDFLSKETLRRARILVRNKYEN 742
           + +N+G   L  TISGF+++L   +K  +E ++    +P    KE     +    +  +N
Sbjct: 621 VKTNQG---LDITISGFNEKLLILLKRFVEGVQGF--EP---KKERFEVFKDKTVHHLKN 672

Query: 743 AANENCANIGSIGLY-IVLEKYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSLFVQ 801
              E   +  S GLY  V+ +  W  +++LE  E +  +    F ++      Y S FV 
Sbjct: 673 QMMEVPYSQIS-GLYNSVVNERTWPTKEKLEVAEKLKFEQLDNFVRAIYDGMYYES-FVH 730

Query: 802 GDLSCADE------LNEYLHRSFTHHLG------GGIYETQGKTFTVETTKMLEPGTNAC 849
           G+L   +       ++ +L +    ++             +GK++  ET    E   N+C
Sbjct: 731 GNLESKEAREVDSLVSTFLKKDDIKNIDVQSNRLRSYIIPKGKSYAYETDLYDENNVNSC 790

Query: 850 VQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELRNKRQVGYLVIGG 909
           +QH              +Q    N+++      F   +      + LR K Q+GY+V   
Sbjct: 791 IQH-------------VVQLDVYNEKLSALSGLFAQMLHEPCFDI-LRTKEQLGYVVFSS 836

Query: 910 LRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQLQKLDEQTFHQ 957
                 +  + I + S  +   LE +IDE+      +L+ +DE+ F++
Sbjct: 837 SLNNHGTANIRILVQSEHTTPYLEWRIDEFYKTFGEKLRNMDEEDFNK 884

>Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389C
           (STE23) - involved in a-factor processing [contig 1]
           FULL
          Length = 1001

 Score =  153 bits (386), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 111/395 (28%), Positives = 175/395 (44%), Gaps = 50/395 (12%)

Query: 9   YDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPSEIPGLAH 68
           ++I F  P   + R ++  +LPN L  LLI D   +              DP  +PGLAH
Sbjct: 44  HNIEFKKPL-LDDREYRFIELPNKLKVLLIQDVNTDKAAAALDVNVGSFEDPENLPGLAH 102

Query: 69  LCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSLQEGFDEA 128
            CEH+ L  GS KYP+   Y   + K+GG  NA+T+ + T+++F++       Q     A
Sbjct: 103 FCEHL-LFMGSSKYPNENEYSSYLSKHGGGSNAYTSSQNTNYFFQVN------QGNLHGA 155

Query: 129 LDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFSTG 188
           LD F+ FFS PLFN    +KE  A++SE+  NL S     YQ  +  ++  HP+ +FSTG
Sbjct: 156 LDRFSGFFSCPLFNKDSTDKEINAVDSENKKNLQSDLWRLYQLDKSQSSPEHPYHKFSTG 215

Query: 189 NISTLNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTKFSLIKNN 248
           N+ TL  +P            +++  ++ A+ M LC+ G + +  L++     + L K+ 
Sbjct: 216 NLKTLGELPKSQNLDVRDELLKFYNRSYSANLMKLCVLGREDLDVLSQWV---YDLFKDV 272

Query: 249 PQRYXXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQEKFIF--I 306
           P R                               +  +P Y  +L    + ++      +
Sbjct: 273 PNR-------------------------------DVPVPSYPTRLLLPQNLEQIISAKPV 301

Query: 307 KSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGWVTYSYA 366
           K  K   V F+ P M+    + SK    L+H    L G E  GS   +L+SKGW     A
Sbjct: 302 KDIKRVEVNFVAPDMD--PYWDSKPGHYLSH----LIGHEGSGSLLAYLKSKGWANELSA 355

Query: 367 FVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFE 401
               V+  N    + +DLT  G  N   +   +F+
Sbjct: 356 GSHTVSKDNGFFSISIDLTDEGIANYEDVVISVFQ 390

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 58/284 (20%), Positives = 114/284 (40%), Gaps = 34/284 (11%)

Query: 685 SNKGDIRLGFTISGFSKQLTSFVKSIIETIKRISQDPDFLSKETLRRARILVRNKYENAA 744
           +N+G   L   +SG+++++   + S +E I R   +     +E  +  +  +  K  N  
Sbjct: 617 TNQG---LDLALSGYNEKMPILLTSYLEGISRFKPN-----QERFKIFQAKLIQKLNNHL 668

Query: 745 NENCANIGSIGLYIVLEKYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSLFVQGDL 804
            E   +  S     ++ +  WT++D+LE +E +   + + F  +    + +    V G+ 
Sbjct: 669 YEIPYSQASDVYNSLINERSWTIKDKLEVVEQLTFQHLENFLPTIF-EQFFFEALVHGNF 727

Query: 805 S--CADELNEYLHRSFTHHLGGGIYETQ---------GKTFTVETTKMLEPGTNACVQHG 853
           S   A E+++ +     + +   + ++          G+ +  E     E   N+C+QH 
Sbjct: 728 SYETAVEIHKLVKALAPNDIKNCLLKSSKPRSLHIPPGRAYYYEQRLADEKNINSCIQHV 787

Query: 854 GQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELRNKRQVGYLVIGGLRLL 913
            Q              G  ++ +      F   I        LR K Q+GY+V       
Sbjct: 788 NQ-------------FGTYSEELAAKAALFAQLIDEPAFDT-LRTKEQLGYVVFSSALNT 833

Query: 914 SNSVGLHITIMSGGSPLDLETKIDEYLWYLESQLQKLDEQTFHQ 957
             +V L I I S      LE++ID +L  +   LQ + E+ F +
Sbjct: 834 HGTVNLRILIQSERDTAFLESRIDAFLAKMGQILQDMSEEEFER 877

>Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar to
           Ashbya gossypii AER053C
          Length = 1023

 Score =  151 bits (381), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 127/449 (28%), Positives = 199/449 (44%), Gaps = 55/449 (12%)

Query: 20  EGRTHKLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPSEIPGLAHLCEHMVLAAGS 79
           + R ++  +LPN L   LI D + +              DP ++PGLAH CEH+ L  GS
Sbjct: 76  DDRNYRYIQLPNRLKVFLIQDKSTDKAAAALDVNVGFFQDPEDLPGLAHFCEHL-LFMGS 134

Query: 80  RKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFEL--PNIYHSLQEGFDEALDVFASFFS 137
            K+P+   Y   +  +GG+ NA+T+ + T++YF +   N+Y        +ALD F+ FF+
Sbjct: 135 EKFPNENEYSSYLSHHGGASNAYTSTQNTNYYFMVNHGNLY--------DALDRFSGFFT 186

Query: 138 EPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFSTGNISTLNSIP 197
            PLF+ +  NKE  A++SE+  NL S      Q  R L N  HPF +FSTGN  TL   P
Sbjct: 187 SPLFSVSSTNKEVNAVDSENKKNLQSDLWRMQQLDRSLTNPGHPFHKFSTGNYQTLYKEP 246

Query: 198 HXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTKFSLIKNNPQRYXXXXX 257
                       +++ + + A+ M L + G + + +L+  A   + L K+ P +      
Sbjct: 247 KSRGIEIREELLKFYDKTYSANLMRLVILGMEDLDTLSAWA---YELFKDVPDK------ 297

Query: 258 XXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQEKFIFIKSSKNPAVRFI 317
                        ++V+     +   T+L K             K   IK  K   V F 
Sbjct: 298 ------------GIDVHEYNAKVFTPTYLTKII-----------KAKPIKDLKRVEVSFD 334

Query: 318 FPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGWVTYSYAFVSEVAIGNSN 377
            P  E  T + S+    ++H    L G ES  S   +L S+ W T  Y     V+ GN+ 
Sbjct: 335 VPDTE--TFWDSRPADYISH----LIGHESSNSLLSYLISQSWATELYCGAQTVSKGNAY 388

Query: 378 LILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTLELAQFMSKQNCIDLIRFLYQNAEI 437
             + ++LT  G Q+   +   +F Q I  L  K +L   +   + N I   +F ++    
Sbjct: 389 FCIHIELTDKGVQDYEEVVYTVF-QYIEML--KKSLPQERIFVELNKIGESKFRFKQKG- 444

Query: 438 SPMEECVNLSSLMQDDLEALDPAYIFKGS 466
           SP     +L+  +Q D   L P  IF  S
Sbjct: 445 SPSNTVSSLAKNLQKDF--LPPEIIFNAS 471

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/290 (22%), Positives = 126/290 (43%), Gaps = 42/290 (14%)

Query: 683 ITSNKGDIRLGFTISGFSKQLTSFVKSIIETIKRISQDPDFLSKETLRRARILVRNKYEN 742
           + +N+G   L  +++G++ ++T  + SI+E I+    DP     + L++  +L +  Y  
Sbjct: 637 VKTNQG---LDLSLTGYNDKMTLLLTSILEGIRNF--DPKKERFDVLQK--LLCQKLYNR 689

Query: 743 AANENCANIGSIGLYIVLEKYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSLFVQG 802
             N   + IG +   ++ ++  WT  ++L+  + +  ++FK F  S +  + Y    V G
Sbjct: 690 LYNVPYSQIGVLYNSLINDR-SWTPSEKLKVTKQLTFEHFKAFVPS-IYEQMYFETLVHG 747

Query: 803 DL--SCADELNEYL---------HRSFTHHLGGGIYETQGKTFTVETTKMLEPGTNAC-- 849
           +   + A ELN Y+         H    ++        +GKT+  ETT   E   N+C  
Sbjct: 748 NFPENQAIELNSYICSLIPNQIKHSGARNNRPRSYMLPEGKTYRYETTLFDEENVNSCFE 807

Query: 850 --VQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELRNKRQVGYLVI 907
             +Q G   +D N               ++  L N   F         LR + Q+GY+V 
Sbjct: 808 MVIQLGMYSEDMN-----------AKGSLLAQLINEPCFNT-------LRTEEQLGYVVW 849

Query: 908 GGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQLQKLDEQTFHQ 957
              +    S  L I + S    + +E+++D++L      L+ + EQ F +
Sbjct: 850 SSKQNTHASTNLRILVQSESDTVYIESRVDKFLNNFADTLRSMSEQAFEK 899

>TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON}
           Anc_4.246 YLR389C
          Length = 995

 Score =  132 bits (331), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 113/391 (28%), Positives = 176/391 (45%), Gaps = 50/391 (12%)

Query: 14  LTPFSFEGRTHKLCKL-PNGLLTLLISDPTENXXXXXXXXXXXXHNDPSEIPGLAHLCEH 72
           L P + E R ++  KL  N L  L+I D T +              DPS +PGLAH CEH
Sbjct: 32  LKPITDE-RNYQFIKLNKNNLHALIIQDKTTDKAAAALDVNAGAFMDPSNLPGLAHFCEH 90

Query: 73  MVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSLQEGFDEALDVF 132
           + L  GS+ +P+   Y   + +NGG  NA+T    T+++FE   I H+      EAL  F
Sbjct: 91  L-LFMGSKNFPNENDYSSYLNQNGGFSNAYTGSMNTNYHFE---INHA---NLFEALRRF 143

Query: 133 ASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFSTGNIST 192
           + FF  PLFN+    KE +AI+SE+  NL +     YQ  + L+N  HP+ +FSTG+  T
Sbjct: 144 SCFFKTPLFNNDSTIKEIHAIDSENKKNLQNDYWRLYQLGKSLSNHEHPYHKFSTGSKLT 203

Query: 193 LNSIPHXXXXXXXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTKFSLIKNNPQRY 252
           L                +++ + + ++ M LC+ G + + +L++ A   F  + N     
Sbjct: 204 LLENTETLNLNIREELIKFYNKWYSSNIMNLCIIGREDLGTLSRWAKILFENVPN----- 258

Query: 253 XXXXXXXXXXXXXXXNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQEKFIFIKSSKN- 311
                                        KN  LP +  Q  +T  +++K I +K  K+ 
Sbjct: 259 -----------------------------KNVILPTF-SQPVWTIADKKKVISVKPVKDL 288

Query: 312 PAVRFIFPAMERN-TRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGWVTYSYAFVSE 370
             +   F   E   T + SK   IL+H    LFG +  GS S  L+++  +T   +    
Sbjct: 289 KQLELTFHIKEDELTTWKSKPSYILSH----LFGHKGNGSISSLLKNQQLITGISSGSEN 344

Query: 371 VAIGNSNLILELDLTRTGFQNLSHIAKVLFE 401
           ++  NS   L  DLT  G      I K++F+
Sbjct: 345 ISKENSLFSLNFDLTEDGINQYEKIIKIVFQ 375

 Score = 39.7 bits (91), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 68/328 (20%), Positives = 129/328 (39%), Gaps = 45/328 (13%)

Query: 683 ITSNKGDIRLGFTISGFSKQLTSFVKSIIETIKRISQDPDFLSKETLRRARILVRNKYEN 742
           ++ NK +  L  T++G + +L   +K  +E IK       F+  E   R  ++ +   ++
Sbjct: 598 VSLNKTNQGLDLTLTGLNDKLLILLKRYLEGIK------SFVPNE--ERFEVIKKQTIQS 649

Query: 743 AANE----NCANIGSIGLYIVLEKYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSL 798
             N         +G I   ++ E+  W++E+ L+ ++DID    + F  +      + +L
Sbjct: 650 LTNRLYDVPYIQMGDIYSSLINER-SWSVEENLKVVQDIDFPQLQDFIPTIYQELFFETL 708

Query: 799 -FVQGDLSCADELNEYLHRSFTHHLGGGIYET---------QGKTFTVETTKMLEPGTNA 848
            F       A E++  +     + +     +           GKTF  E  +  +   N 
Sbjct: 709 AFGNIQYEQAQEVDSLVRTLIPNTIKNSQVKNDRLRSYIIPSGKTFKYEVFQKDKNNLNT 768

Query: 849 CVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELRNKRQVGYLVIG 908
           C+Q             Y  Q G  ++ +   + +    IM       LR K Q+GY+V  
Sbjct: 769 CIQ-------------YICQFGIYSEYLA-AVVSLLAQIMHEPCFNTLRTKEQLGYIVFS 814

Query: 909 GLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQLQKLDEQTFHQEYVRCYLQLLD 968
                  +  L I + S  S   L+ +I+ +L    S L+++  + F +     +  LL 
Sbjct: 815 SSLSNHGTCNLSIMVQSEYSTDYLQFRIENFLKDFLSYLKEMPREEFKRHRQSLHDSLLQ 874

Query: 969 GGCRGDANESSGPADLLSELVANVQIGD 996
                + NE S      S L+A + +GD
Sbjct: 875 K--YHNMNEES------SRLIAAIYLGD 894

>AGL138C Chr7 complement(453737..455149) [1413 bp, 470 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR163C
           (MAS1)
          Length = 470

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 77/204 (37%), Gaps = 17/204 (8%)

Query: 25  KLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPSEIPGLAHLCEHMVLAAGSRKYPD 84
           ++ +LPNGL     + P                 +     G AH  EH+    G++    
Sbjct: 30  RISQLPNGLTVASEAMPNTATASVGIFVDAGSRAENVRNNGTAHFLEHLAFK-GTKNRTQ 88

Query: 85  PGYYHEMIMKNGGSQ-NAFTTGEQTSFYFELPNIYHSLQEGFDEALDVFASFFSEPLFNS 143
            G   E+ ++N GS  NA+T+ E T +Y +      SLQE    ALDV +   +  + + 
Sbjct: 89  VGI--ELEIENLGSHLNAYTSRENTVYYAK------SLQEDIPRALDVLSDILTRSVLDP 140

Query: 144 TLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFSTGNISTLNSIPHXXXXX 203
             + +E   I  E +       ++ +     ++  N P  R   G I  + SI       
Sbjct: 141 KAVERERDVIIRESEEVDKMYDEVVFDHLHAISYENQPLGRTILGPIENIKSI------- 193

Query: 204 XXXXXHEYFKENFCASKMTLCLRG 227
                 EY   N+   +M L   G
Sbjct: 194 QQRDLKEYISTNYKGDRMALVGAG 217

>YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON}
           MAS1Smaller subunit of the mitochondrial processing
           protease (MPP), essential processing enzyme that cleaves
           the N-terminal targeting sequences from mitochondrially
           imported proteins
          Length = 462

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 85/219 (38%), Gaps = 17/219 (7%)

Query: 25  KLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPSEIPGLAHLCEHMVLAAGSRKYPD 84
           +  KLPNGL       P  +              +  +  G AH  EH+    G++    
Sbjct: 27  RTSKLPNGLTIATEYIPNTSSATVGIFVDAGSRAENVKNNGTAHFLEHLAFK-GTQNRSQ 85

Query: 85  PGYYHEMIMKNGGSQ-NAFTTGEQTSFYFELPNIYHSLQEGFDEALDVFASFFSEPLFNS 143
            G   E+ ++N GS  NA+T+ E T +Y +      SLQE   +A+D+ +   ++ + ++
Sbjct: 86  QGI--ELEIENIGSHLNAYTSRENTVYYAK------SLQEDIPKAVDILSDILTKSVLDN 137

Query: 144 TLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFSTGNISTLNSIPHXXXXX 203
           + I +E   I  E +       ++ +     +   + P  R   G I  + SI       
Sbjct: 138 SAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGRTILGPIKNIKSITR----- 192

Query: 204 XXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTKF 242
                 +Y  +N+   +M L   G      L + A   F
Sbjct: 193 --TDLKDYITKNYKGDRMVLAGAGAVDHEKLVQYAQKYF 229

>Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 84/219 (38%), Gaps = 17/219 (7%)

Query: 25  KLCKLPNGLLTLLISDPTENXXXXXXXXXXXXHNDPSEIPGLAHLCEHMVLAAGSRKYPD 84
           +  KLPNGL       P  +              +  +  G AH  EH+    G++    
Sbjct: 27  RTSKLPNGLTIATEYIPNTSSATVGIFVDAGSRAENLKNNGTAHFLEHLAFK-GTQNRSQ 85

Query: 85  PGYYHEMIMKNGGSQ-NAFTTGEQTSFYFELPNIYHSLQEGFDEALDVFASFFSEPLFNS 143
            G   E+ ++N GS  NA+T+ E T +Y +      SL+E   +A+D+ +   ++ + +S
Sbjct: 86  QGI--ELEIENIGSHLNAYTSRENTVYYAK------SLEEDIPKAVDILSDILTKSVLDS 137

Query: 144 TLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFSTGNISTLNSIPHXXXXX 203
             I +E   I  E +       ++ +     +   + P  R   G I  + SI       
Sbjct: 138 NAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGRTILGPIKNIKSITR----- 192

Query: 204 XXXXXHEYFKENFCASKMTLCLRGPQSIHSLAKLALTKF 242
                 +Y  +N+   +M L   G      L + A   F
Sbjct: 193 --SDLKDYITKNYKGDRMVLAGAGAVDHERLVQYAQKYF 229

>Kwal_23.3345 s23 (253614..254990) [1377 bp, 458 aa] {ON} YLR163C
           (MAS1) - mitochondrial processing protease subunit
           [contig 252] FULL
          Length = 458

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 77/200 (38%), Gaps = 17/200 (8%)

Query: 29  LPNGLLTLLISDPTENXXXXXXXXXXXXHNDPSEIPGLAHLCEHMVLAAGSRKYPDPGYY 88
           LPNGL     + P  +              + S+  G AH  EH+    G++     G  
Sbjct: 27  LPNGLTVATEAIPNTSSATVGIFVDAGSRAENSKNNGTAHFLEHLAF-KGTKNRTQVGI- 84

Query: 89  HEMIMKNGGSQ-NAFTTGEQTSFYFELPNIYHSLQEGFDEALDVFASFFSEPLFNSTLIN 147
            EM ++N GS  NA+T+ E T +Y +      +L +    A+D+ +   ++ + ++  I 
Sbjct: 85  -EMEIENIGSHLNAYTSRENTVYYAK------TLTQNIPNAVDILSDILTKSVLDTNAIE 137

Query: 148 KETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFSTGNISTLNSIPHXXXXXXXXX 207
           +E   I  E +       ++ +     +   + P  R   G I  + +I           
Sbjct: 138 RERDVIIRESEEVDKMYDEVVFDHLHAITYKDQPLGRTILGPIKNIKTIQQ-------RD 190

Query: 208 XHEYFKENFCASKMTLCLRG 227
             EY   N+   +M L   G
Sbjct: 191 LREYISTNYKGDRMVLAGAG 210

>NCAS0F01140 Chr6 complement(224043..227009) [2967 bp, 988 aa] {ON}
           Anc_5.541 YDR430C
          Length = 988

 Score = 38.9 bits (89), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 66/143 (46%), Gaps = 12/143 (8%)

Query: 59  DPSEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKN-GGSQNAFTTGEQTSFYFELPNI 117
           +P    G+ H+ EH  L  GS+KYP    + +M+ K+     NA T  + T F F   N 
Sbjct: 75  NPPNSTGVPHVLEHTTLC-GSKKYPVRDPFFKMLNKSLANFMNAMTGHDYTFFPFATTN- 132

Query: 118 YHSLQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSS----QGKIFYQATR 173
                + F+   DV+      PL       +E + +E +   ++++    +G ++ +   
Sbjct: 133 ----AKDFNNLRDVYLDATLNPLLKQEDFYQEGWRLEHDTVTDVTTPIVFKGVVYNEMKG 188

Query: 174 LLANGNHPF-SRFSTGNISTLNS 195
            ++N N+ F S++  G   +LN+
Sbjct: 189 QVSNANYYFWSKYQEGIYPSLNN 211

>SAKL0G05236g Chr7 complement(429654..432614) [2961 bp, 986 aa] {ON}
           highly similar to uniprot|P32898 Saccharomyces
           cerevisiae YDR430C CYM1 Cytosolic metalloprotease
          Length = 986

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 56/129 (43%), Gaps = 11/129 (8%)

Query: 59  DPSEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKN-GGSQNAFTTGEQTSFYFELPNI 117
           +P    G+ H+ EHM L  GS KYP    + +M+ ++     NA T  + T + F   N 
Sbjct: 75  NPPNATGVPHILEHMTLC-GSHKYPVRDPFFKMLNRSLANFMNAMTGHDYTFYPFATTN- 132

Query: 118 YHSLQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSS----QGKIFYQATR 173
               +  F+   DV+      PL       +E + +E E   +  S    +G ++ +   
Sbjct: 133 ----KADFENLRDVYLDATFNPLLKPEDFYQEGWRLEHEKTDDPKSPITFKGVVYNEMKG 188

Query: 174 LLANGNHPF 182
            ++N N+ F
Sbjct: 189 QVSNANYYF 197

>TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa]
           {ON} Anc_5.541 YDR430C
          Length = 991

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 58/129 (44%), Gaps = 11/129 (8%)

Query: 59  DPSEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKN-GGSQNAFTTGEQTSFYFELPNI 117
           +P +  G+AH+ EH  L  GS+KYP    + +M+ ++     NA T  + T + F   N 
Sbjct: 76  NPPDSTGVAHILEHTTL-CGSKKYPVRDPFFKMLNRSLSNFMNAMTGHDYTMYPFATTN- 133

Query: 118 YHSLQEGFDEALDVFASFFSEPLFNSTLINKETYAIE----SEHDVNLSSQGKIFYQATR 173
                + F    DV+      PL       +E + +E    ++ D +L  +G ++ +   
Sbjct: 134 ----SKDFKNLQDVYLDATFSPLLKQEDFFQEGWRLENKDATDKDSDLIFKGVVYNEMKG 189

Query: 174 LLANGNHPF 182
             +N ++ F
Sbjct: 190 QNSNADYYF 198

>KLLA0B00957g Chr2 complement(73661..76609) [2949 bp, 982 aa] {ON}
           similar to uniprot|P32898 YDR430C Saccharomyces
           cerevisiae CYM1 Cytosolic metalloprotease
          Length = 982

 Score = 33.9 bits (76), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 57/129 (44%), Gaps = 11/129 (8%)

Query: 59  DPSEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKN-GGSQNAFTTGEQTSFYFELPNI 117
           +P +  G+ H+ EH  L  GS KYP    + +M+ ++     NA T  + T + F   N 
Sbjct: 75  NPPDSTGVPHILEHTTLC-GSHKYPVRDPFFKMLNRSLANFMNAMTGHDYTFYPFATTN- 132

Query: 118 YHSLQEGFDEALDVFASFFSEPLFNSTLINKETYAIE----SEHDVNLSSQGKIFYQATR 173
               +  F    DV+      PL N     +E + +E     + + ++  +G ++ +   
Sbjct: 133 ----ETDFANLRDVYLDATLNPLLNQQDFLQEGWRLEHTKVDDPNSDIGFKGVVYNEMKG 188

Query: 174 LLANGNHPF 182
            ++N N+ F
Sbjct: 189 QVSNANYYF 197

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
           Anc_4.237 YLR383W
          Length = 1119

 Score = 33.1 bits (74), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 888 MSLNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYL 940
           +++NLAL LRN+   GY ++GG RL +      + I  G S  + ET + E++
Sbjct: 659 INVNLALSLRNETS-GYQLVGGFRLDTVDYQNKLQIKVGSSSKNEETYLKEFI 710

>Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 bp,
           4915 aa] {ON} complement(49973..58081,58083..64721)
           [14748 nt, 4916 aa]
          Length = 4915

 Score = 32.7 bits (73), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 39/83 (46%), Gaps = 10/83 (12%)

Query: 379 ILELDLTRTGFQNLSHIAKVLFEQ--AIPALSQKNTLELAQFMSKQNCIDL-IRFLYQNA 435
           I E DL++TG QNL  +AK   E+   +P L   NTL L         I L I   ++N 
Sbjct: 32  IFEFDLSKTGSQNLYELAKFALEERNTLPCLFVYNTLYLE-------VISLWITKFFKND 84

Query: 436 EISPMEECVNLSSLMQDDLEALD 458
            IS +  C  + +L    +  +D
Sbjct: 85  PISVLTACSRIITLYPTSITMID 107

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 123,691,922
Number of extensions: 5397372
Number of successful extensions: 14576
Number of sequences better than 10.0: 63
Number of HSP's gapped: 14694
Number of HSP's successfully gapped: 113
Length of query: 1189
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1068
Effective length of database: 39,606,813
Effective search space: 42300076284
Effective search space used: 42300076284
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)