Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C05236g7.127ON44744723900.0
TDEL0H028907.127ON44244620230.0
Kpol_1062.567.127ON45045019120.0
TBLA0A009507.127ON46946919090.0
KNAG0L009507.127ON46146118980.0
SAKL0F05346g7.127ON44744718900.0
YPL259C (APM1)7.127ON47547418740.0
Suva_16.457.127ON47847718710.0
TPHA0C043207.127ON45445318650.0
Smik_6.4667.127ON47647518660.0
Skud_16.197.127ON47647518540.0
NCAS0E021407.127ON48144918430.0
KLTH0F12584g7.127ON44144418120.0
ADL017C7.127ON44344518110.0
Kwal_55.208437.127ON44144418070.0
Ecym_83507.127ON44544517960.0
KAFR0L004707.127ON46546817960.0
KLLA0D14311g7.127ON44344617930.0
NDAI0E036807.127ON44444617920.0
CAGL0K00539g7.127ON45645617890.0
Ecym_52393.165ON4644695667e-67
KLTH0F06534g3.165ON4664715265e-61
SAKL0C07414g3.165ON4824885111e-58
NCAS0C035803.165ON4915045042e-57
Kwal_33.141823.165ON4674744986e-57
CAGL0C05203g3.165ON4754794892e-55
NDAI0G029203.165ON4864944892e-55
SAKL0D13090g2.555ON4995214866e-55
KLLA0C03894g3.165ON4754804848e-55
TDEL0D045803.165ON4824914663e-52
ABR047W2.555ON4984674673e-52
Kwal_26.81462.555ON5055324666e-52
Kpol_1045.443.165ON4694814568e-51
ZYRO0B04840g3.165ON4764874523e-50
YOL062C (APM4)3.165ON4915004524e-50
Skud_15.913.165ON4915044501e-49
Suva_15.1033.165ON4915004472e-49
KLTH0D07502g2.555ON5045354456e-49
Smik_15.963.165ON4915044412e-48
ADR315W3.165ON4924324324e-47
TBLA0F008403.165ON4814884281e-46
KLLA0F25432g2.555ON5075274169e-45
TDEL0B064302.555ON5255524054e-43
Ecym_45912.555ON5014924027e-43
TPHA0P006603.165ON4734233893e-41
KNAG0K011503.165ON4744833832e-40
Kpol_1056.132.555ON5415643731e-38
TPHA0I023902.555ON5593583381e-33
KAFR0C010203.165ON4284653261e-32
ZYRO0E05874g2.555ON5493383221e-31
KAFR0A020602.555ON5403393043e-29
NCAS0A126502.555ON5883593011e-28
KNAG0C055502.555ON5823482964e-28
CAGL0K03223g2.555ON5983682966e-28
Skud_8.262.555ON5963622922e-27
Smik_8.232.555ON6033622885e-27
Suva_8.332.555ON5963642771e-25
YHL019C (APM2)2.555ON6053662753e-25
TBLA0B067602.555ON6572292212e-18
NDAI0B016102.555ON6722632212e-18
TPHA0C041302.522ON5332691741e-12
SAKL0A09218g2.522ON4733421661e-11
AGL061W2.522ON4112301613e-11
ZYRO0B01738g2.522ON4923281615e-11
KAFR0D035602.522ON4553401517e-10
TDEL0A029702.522ON4961441348e-08
TBLA0I006202.522ON6091501321e-07
KLLA0E18789g2.522ON4972261267e-07
Kpol_1018.422.522ON5752401268e-07
KLTH0D06556g2.522ON4562871259e-07
KLLA0D11396g3.575ON5361451196e-06
Kwal_26.79572.522ON4561331171e-05
CAGL0A04741g3.575ON5362081171e-05
Ecym_72662.522ON5171331107e-05
ZYRO0E09746g3.575ON5381871081e-04
Suva_4.5482.522ON4842701081e-04
NCAS0F040103.575ON5471821072e-04
Ecym_60073.575ON5371561062e-04
KLTH0G00528g3.575ON6331821062e-04
Kwal_47.192923.575ON5381561036e-04
TBLA0E001403.575ON5431821019e-04
Skud_2.4192.522ON4841351000.001
AFR274C3.575ON5321871000.001
YBR288C (APM3)2.522ON4832621000.001
CAGL0L02145g2.522ON5432811000.001
TPHA0G037003.575ON5391971000.001
SAKL0F00594g3.575ON545156980.002
TDEL0D064303.575ON536190960.003
NDAI0B063203.575ON540125960.003
Smik_2.4302.522ON484134950.004
Kpol_380.133.575ON535171950.004
NDAI0K019302.522ON612154930.009
Kpol_507.73.575ON533187920.011
Skud_6.1423.575ON546183900.020
YFR051C (RET2)3.575ON546183890.022
Smik_7.3713.575ON598183880.029
NCAS0A048702.522ON489332880.033
Suva_12.63.575ON546183880.033
Kwal_26.94485.28ON55187850.069
NDAI0G052101.388ON156115770.24
KNAG0A069702.522ON505155760.84
KAFR0J001303.575ON543184760.89
ZYRO0E05236g1.388ON15662721.1
KLLA0B06545g1.505ON14854721.2
TBLA0A012601.388ON15659711.6
KLTH0H11770g1.388ON15687711.6
TDEL0A063908.694ON1486140741.7
YJR058C (APS2)1.505ON14783701.8
Smik_10.3481.505ON14783692.3
Kwal_27.100201.505ON14784692.7
CAGL0L08800g8.76ON184133693.2
TDEL0F005501.505ON14783683.6
Ecym_31621.505ON14686674.1
TDEL0B061901.388ON15679684.4
Suva_12.1471.505ON14783674.9
SAKL0D08074g1.388ON15687675.2
Skud_10.2821.505ON14783665.7
CAGL0B04983g1.388ON15679675.9
AFR124W1.388ON15658666.4
Smik_12.2321.388ON15659666.9
NDAI0K008908.762ON70259697.4
YJL036W (SNX4)5.237ON42366687.7
TBLA0B066005.165ON64529688.8
YLR170C (APS1)1.388ON15662659.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C05236g
         (447 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   925   0.0  
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   783   0.0  
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   741   0.0  
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   739   0.0  
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   735   0.0  
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   732   0.0  
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   726   0.0  
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   725   0.0  
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   723   0.0  
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   723   0.0  
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   718   0.0  
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   714   0.0  
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   702   0.0  
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   702   0.0  
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   700   0.0  
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   696   0.0  
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   696   0.0  
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   695   0.0  
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   694   0.0  
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   693   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   222   7e-67
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   207   5e-61
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   201   1e-58
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   198   2e-57
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   196   6e-57
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   192   2e-55
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   192   2e-55
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   191   6e-55
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   191   8e-55
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   184   3e-52
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...   184   3e-52
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...   184   6e-52
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   180   8e-51
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   178   3e-50
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   178   4e-50
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   177   1e-49
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   176   2e-49
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   176   6e-49
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   174   2e-48
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   171   4e-47
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   169   1e-46
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...   164   9e-45
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...   160   4e-43
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...   159   7e-43
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   154   3e-41
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   152   2e-40
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...   148   1e-38
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...   134   1e-33
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   130   1e-32
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...   128   1e-31
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...   121   3e-29
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...   120   1e-28
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...   118   4e-28
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...   118   6e-28
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...   117   2e-27
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...   115   5e-27
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...   111   1e-25
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...   110   3e-25
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    90   2e-18
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    90   2e-18
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    72   1e-12
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    69   1e-11
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    67   3e-11
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    67   5e-11
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    63   7e-10
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    56   8e-08
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    55   1e-07
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    53   7e-07
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    53   8e-07
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    53   9e-07
KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {...    50   6e-06
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    50   1e-05
CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {...    50   1e-05
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    47   7e-05
ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {...    46   1e-04
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    46   1e-04
NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {O...    46   2e-04
Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to ...    45   2e-04
KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar ...    45   2e-04
Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]...    44   6e-04
TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575...    44   9e-04
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    43   0.001
AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON} S...    43   0.001
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    43   0.001
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    43   0.001
TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {O...    43   0.001
SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar ...    42   0.002
TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa] ...    42   0.003
NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa] ...    42   0.003
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    41   0.004
Kpol_380.13 s380 complement(21263..22870) [1608 bp, 535 aa] {ON}...    41   0.004
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    40   0.009
Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON} (49309..50...    40   0.011
Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON...    39   0.020
YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}  ...    39   0.022
Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON...    39   0.029
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    39   0.033
Suva_12.6 Chr12 (7704..9344) [1641 bp, 546 aa] {ON} YFR051C (REAL)     39   0.033
Kwal_26.9448 s26 complement(1221754..1223409) [1656 bp, 551 aa] ...    37   0.069
NDAI0G05210 Chr7 (1268117..1268587) [471 bp, 156 aa] {ON} Anc_1....    34   0.24 
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    34   0.84 
KAFR0J00130 Chr10 (23191..24822) [1632 bp, 543 aa] {ON} Anc_3.57...    34   0.89 
ZYRO0E05236g Chr5 complement(399318..399788) [471 bp, 156 aa] {O...    32   1.1  
KLLA0B06545g Chr2 (583095..583541) [447 bp, 148 aa] {ON} highly ...    32   1.2  
TBLA0A01260 Chr1 (299419..299889) [471 bp, 156 aa] {ON} Anc_1.38...    32   1.6  
KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highl...    32   1.6  
TDEL0A06390 Chr1 (1117890..1122350) [4461 bp, 1486 aa] {ON} Anc_...    33   1.7  
YJR058C Chr10 complement(544732..545175) [444 bp, 147 aa] {ON}  ...    32   1.8  
Smik_10.348 Chr10 complement(533694..534137) [444 bp, 147 aa] {O...    31   2.3  
Kwal_27.10020 s27 (161799..162242) [444 bp, 147 aa] {ON} YJR058C...    31   2.7  
CAGL0L08800g Chr12 (960646..961200) [555 bp, 184 aa] {ON} highly...    31   3.2  
TDEL0F00550 Chr6 (94104..94547) [444 bp, 147 aa] {ON} Anc_1.505 ...    31   3.6  
Ecym_3162 Chr3 (311476..311916) [441 bp, 146 aa] {ON} similar to...    30   4.1  
TDEL0B06190 Chr2 complement(1094337..1094807) [471 bp, 156 aa] {...    31   4.4  
Suva_12.147 Chr12 complement(222523..222966) [444 bp, 147 aa] {O...    30   4.9  
SAKL0D08074g Chr4 complement(673663..674133) [471 bp, 156 aa] {O...    30   5.2  
Skud_10.282 Chr10 complement(502270..502713) [444 bp, 147 aa] {O...    30   5.7  
CAGL0B04983g Chr2 (484166..484636) [471 bp, 156 aa] {ON} highly ...    30   5.9  
AFR124W Chr6 (662389..662859) [471 bp, 156 aa] {ON} Syntenic hom...    30   6.4  
Smik_12.232 Chr12 complement(447707..448177) [471 bp, 156 aa] {O...    30   6.9  
NDAI0K00890 Chr11 complement(197412..199520) [2109 bp, 702 aa] {...    31   7.4  
YJL036W Chr10 (378825..380096) [1272 bp, 423 aa] {ON}  SNX4Sorti...    31   7.7  
TBLA0B06600 Chr2 (1551799..1553736) [1938 bp, 645 aa] {ON} Anc_5...    31   8.8  
YLR170C Chr12 complement(500579..501049) [471 bp, 156 aa] {ON}  ...    30   9.8  

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  925 bits (2390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/447 (100%), Positives = 447/447 (100%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120
           QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD
Sbjct: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180

Query: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTT 240
           DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTT
Sbjct: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTT 240

Query: 241 AVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVKPLIWCD 300
           AVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVKPLIWCD
Sbjct: 241 AVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVKPLIWCD 300

Query: 301 VNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNA 360
           VNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNA
Sbjct: 301 VNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNA 360

Query: 361 ILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQVRYLKITE 420
           ILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQVRYLKITE
Sbjct: 361 ILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQVRYLKITE 420

Query: 421 PKLLYKSYPWVRYITQSGDDYTIKLNN 447
           PKLLYKSYPWVRYITQSGDDYTIKLNN
Sbjct: 421 PKLLYKSYPWVRYITQSGDDYTIKLNN 447

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  783 bits (2023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/446 (82%), Positives = 410/446 (91%), Gaps = 4/446 (0%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           MVS +YFCD KGRPILSRRYRDDIP+SAID+FAPLL  LEEESSVIPPCL+H GIQYLFI
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRFAPLLADLEEESSVIPPCLNHRGIQYLFI 60

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120
           +H DLYVVAL+TSLATN AQVF FLHKL+E L +YLK+VEEESVRDNF+IIYELLDEMMD
Sbjct: 61  EHEDLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKL+KAVKK KA  RPPT +TNSVSWRA  I +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAVKKVKATARPPTGLTNSVSWRADGITYKKNEAFL 180

Query: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTT 240
           DIVESINM+MNQQGQVLRSEIIGQ+ V+S+LSGMPDLKLGINDKGIF++    D +   +
Sbjct: 181 DIVESINMVMNQQGQVLRSEIIGQVIVRSRLSGMPDLKLGINDKGIFTR----DPETGES 236

Query: 241 AVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVKPLIWCD 300
            VT GKKK++ ELEDLKFHQCVRLSKFENEKIITFIPPDG FELM+YRL+ PVKPLIWCD
Sbjct: 237 QVTAGKKKSSAELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMSYRLTTPVKPLIWCD 296

Query: 301 VNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNA 360
           VNVQVHS+SRIEIHCRA+AQIKK+S+AN+VEILIPVPDDADTPSF+Y+HGS+KWVP+KNA
Sbjct: 297 VNVQVHSKSRIEIHCRAKAQIKKKSVANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNA 356

Query: 361 ILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQVRYLKITE 420
           ILWKIRSF GGKEYSM+AQMGLPSIN ++KPK KRPVQ+KFQIPYFTTSGIQVRYLKI E
Sbjct: 357 ILWKIRSFYGGKEYSMAAQMGLPSINGVEKPKFKRPVQVKFQIPYFTTSGIQVRYLKINE 416

Query: 421 PKLLYKSYPWVRYITQSGDDYTIKLN 446
           PKL YKSYPWVRYITQ+GDDYTI+LN
Sbjct: 417 PKLQYKSYPWVRYITQNGDDYTIRLN 442

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/450 (78%), Positives = 404/450 (89%), Gaps = 6/450 (1%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           MVS VYFCD  G+PILSRRYRDDIP+SAIDKF+ +LL+ EEESSV+PPCL + GI YLFI
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120
           QH+D+YVVAL TS  TN+AQ+F FLH+L+ VL +YLKSVEEES+RDNF+IIYELLDEMMD
Sbjct: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKL+KA KK + A RPP  +TNSVSWR   I +KKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAAKKKRNAARPPVALTNSVSWRQEGIKYKKNEAYL 180

Query: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSD---P 237
           DI+ESINMLMNQQGQVLRSEIIG++KVKS+LSGMPDLKLGINDKGIFSKY+E + D   P
Sbjct: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240

Query: 238 V---TTAVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVK 294
           V       T   KK+NIELEDLKFHQCVRLSKFENEKIITFIPPDG FELMNYRL+ P+K
Sbjct: 241 VQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK 300

Query: 295 PLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKW 354
           PLIWCD+N+QVHS+SRIEIHCRA+AQIKK+SIAN+VEILIPVPDDADTP+FKY+HGS+KW
Sbjct: 301 PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKW 360

Query: 355 VPQKNAILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQVR 414
           +P+KNAILWK+RSF GGKEYSM+AQ+GLPS++ ++ PKVKRPVQIKFQIPYFTTSGIQVR
Sbjct: 361 LPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPYFTTSGIQVR 420

Query: 415 YLKITEPKLLYKSYPWVRYITQSGDDYTIK 444
           YLKI EPKL YKS+PWVRYITQSGDDYTI+
Sbjct: 421 YLKINEPKLQYKSFPWVRYITQSGDDYTIR 450

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/469 (75%), Positives = 408/469 (86%), Gaps = 22/469 (4%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           MVS++ FCD KG+ +LSR+YRDDIP++AID FA LL++LEEESSV+PPCL+H+GI YLFI
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120
           QHNDLY+VAL TSL+TN +QVF FLHKL+EV+ EYLK VEEES+RDNF+IIYELLDEMMD
Sbjct: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKL+KA KK + A RPP  +TNSVSWR   I +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPQALTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEG------- 233
           DIVESINMLM QQGQVLRSEIIG++KV+S+LSGMPDLKLGINDKGIFSKY+E        
Sbjct: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLESTSSNSNS 240

Query: 234 ------------DSDPV-TTAVTEG--KKKTNIELEDLKFHQCVRLSKFENEKIITFIPP 278
                        S P  +T   EG  +K +N+ELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 NDDNSNEVNSSKSSTPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 279 DGAFELMNYRLSMPVKPLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPD 338
           DG FELM+YRL+ P+KPLIWCDVN+ VHS+SR+EIHCRA+AQIKK+SIAN+VEILIPVPD
Sbjct: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360

Query: 339 DADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQ 398
           DADTPSF+Y+HGS+KWVP+KNAILWKIRSF GGKEYSM+AQ+GLPSI+  +KPK+KRPVQ
Sbjct: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ 420

Query: 399 IKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDYTIKLNN 447
           IKFQIPYFTTSGIQVRYLK+ EPKL YKSYPWVRYITQSGDDYTI+LN 
Sbjct: 421 IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRLNG 469

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/461 (74%), Positives = 411/461 (89%), Gaps = 15/461 (3%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M SAVYFCD KG+P+LSRRY+DD+P+SAIDKF+ LL  LE+ES+VIPPC++H+GI+YLFI
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120
           QHNDLYVVALATSL  N+A+VFAFLHKLM VL EYLK+VEEES+RDNF+IIYEL+DEMMD
Sbjct: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180
           YGIPQITE +MLK+YITQKSFKL KA KK + A RPP+E+ NSVSWRA  I +KKNEAFL
Sbjct: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180

Query: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDS----- 235
           DIVESINML+ Q+GQVLRSEIIG +K+KS+LSGMPDLKLGIND+GIF+KY+EG++     
Sbjct: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240

Query: 236 -DPV--------TTAVTEGKK-KTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELM 285
            DP         ++   +GKK KTNIELEDLKFHQCVRLSKFENEKIITFIPPDG F+LM
Sbjct: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300

Query: 286 NYRLSMPVKPLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSF 345
           NYRL+  +KPLIWCDV++QVHS+SRIEI CRA+AQIKK+S+A +V+ILIPVPDDADTPSF
Sbjct: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360

Query: 346 KYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPY 405
           KY+HGS+K+VP+++AILWKI+SF GGKEY+M A+MGLPS+++ ++PKVKRPVQ+KF+IPY
Sbjct: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPY 420

Query: 406 FTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDYTIKLN 446
           FTTSGIQVRYLKI EPKL YKSYPWVRYITQSGDDYTI++N
Sbjct: 421 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRVN 461

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/447 (75%), Positives = 397/447 (88%), Gaps = 1/447 (0%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M S +YFCD KG+ ILSRRY+DDIP +AIDKF  LL++ E+ESSVIPPCL+H+GIQYLF+
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120
           QHNDLYV+ +  SL+TNVAQ+FAFL+K++EVL EY+K VEEES+RDNF+IIYELLDEMMD
Sbjct: 61  QHNDLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKLMK+ KKSK   RPP  +TNSVSWR   I++KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180

Query: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGD-SDPVT 239
           D+VESINML+ QQGQVLRSEI+G++KVKS LSGMPDLKLG+NDKGIFS +V G   D   
Sbjct: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEAD 240

Query: 240 TAVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVKPLIWC 299
                GKKK NIELEDLKFHQCVRLSKFENEKIITFIPPDG FELM+YRL+ P+KPLIWC
Sbjct: 241 DLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWC 300

Query: 300 DVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKN 359
           D+ +QVHS+SRIE+HCRA+AQIKK+S AN+VEILIPVP+DAD+P F+Y+HGS+KW P+KN
Sbjct: 301 DIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKN 360

Query: 360 AILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQVRYLKIT 419
           AILWKI+SF GGKEYSM+AQ+GLPS++  ++P +KRPVQ+KFQIPYFTTSGIQVRYLKI 
Sbjct: 361 AILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYLKIN 420

Query: 420 EPKLLYKSYPWVRYITQSGDDYTIKLN 446
           EPK+ Y+SYPWVRYITQSGDDYTI++N
Sbjct: 421 EPKMQYQSYPWVRYITQSGDDYTIRMN 447

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  726 bits (1874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/474 (73%), Positives = 399/474 (84%), Gaps = 29/474 (6%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M SAVYFCD  G+P+LSRRYRDDIP+SAIDKF  LL  LEE+S++IPPCL+H+G++YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120
           QHNDLYVVA+ TSL+ N A +F FLHKL+EVL +YLK+VEEES+RDNF+IIYELLDE+MD
Sbjct: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKL+K+ KK + A RPP  +TNSVSWR   I HKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSD---- 236
           DIVESINMLM Q+GQVLRSEIIG +KV SKLSGMPDLKLGINDKGIFSKY++ D++    
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240

Query: 237 ---------------PVTTAVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGA 281
                           +T++    KKK NIELEDLKFHQCVRLSKFENEKIITFIPPDG 
Sbjct: 241 SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK 300

Query: 282 FELMNYRLSMPVKPLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDAD 341
           F+LMNYRLS  +KPLIWCDVNVQVHS SRIEIHC+A+AQIK++S A +VEILIPVPDDAD
Sbjct: 301 FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD 360

Query: 342 TPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMGLPSINALDK-----PK---- 392
           TP+FKY+HGS+K+VP+K+AILWKIRSF GGKEYSMSA++GLPSI+  +      PK    
Sbjct: 361 TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE 420

Query: 393 -VKRPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDYTIKL 445
            +K PVQIKFQIPYFTTSGIQVRYLKI EPKL YKSYPWVRYITQSGDDYTI+L
Sbjct: 421 ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 474

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  725 bits (1871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/477 (72%), Positives = 399/477 (83%), Gaps = 32/477 (6%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M SAVYFCD  G+P+LSRRYRDDIP+SAIDKF  LL  LEE+S++IPPCL+H+G++YLFI
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120
           QHNDLY+VA+ATSL+ N A +F FLHKL+EVL +YLK+VEEES+RDNF+IIYELLDE+MD
Sbjct: 61  QHNDLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKL+K+ KK + A RPP  +TNSVSWR   I HKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGISHKKNEAFL 180

Query: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSD---- 236
           DIVESINMLM Q+GQVLRSEIIG +KV SKLSGMPDLKLGINDKGIFSKY++  S+    
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240

Query: 237 ------------------PVTTAVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPP 278
                              +T++ T  K+K NIELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 279 DGAFELMNYRLSMPVKPLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPD 338
           DG F+LMNYRLS  +KPLIWCDVNVQVHS SRIEIHC+A+AQIK++S A +VEILIPVPD
Sbjct: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360

Query: 339 DADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMGLPSI-NALDKPK----- 392
           DADTP+FKY+HGS+K+VP+K+AILWK+RSF GGKEYSMSA++GLPSI N  D  K     
Sbjct: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420

Query: 393 ----VKRPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDYTIKL 445
               +K PVQIKFQIPYFTTSGIQVRYLKI EPKL YKSYPWVRYITQSGDDYTI+L
Sbjct: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 477

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  723 bits (1865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/453 (75%), Positives = 396/453 (87%), Gaps = 7/453 (1%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           MVS +YFCD  G+PIL+RRYRDDI I+AID F+ LLLQLEEE+ VIPPC+ H GI YLFI
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120
           +H+D+YVVAL TS  TNVAQ+F FLH+L+EVLEEY+K V EESVRDNF+IIYELLDEMMD
Sbjct: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKA--APRPPTEVTNSVSWRAPNIVHKKNEA 178
           +GIPQITETKMLK+YITQKSFKL+K     K   A RPP E+TNSVSWR   I +KKNEA
Sbjct: 121 FGIPQITETKMLKKYITQKSFKLIKTSTSKKKKNAARPPAELTNSVSWRPEGITYKKNEA 180

Query: 179 FLDIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEG---DS 235
           FLDI+ESINML+ QQGQVLRSEI+G ++V+S+LSGMPDLKLGIND+GIFS Y+E    D 
Sbjct: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240

Query: 236 DPVTTAVTEG--KKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPV 293
              +T + EG   KK  IELEDLKFHQCVRLSKFENEKIITFIPPDG F+LMNYRL+ P+
Sbjct: 241 SSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPI 300

Query: 294 KPLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVK 353
           KPLIWCDVN+QVHS+SRIEIHCRA+AQIKK+SIAN+VEILIPVPDDADTP F+Y+HGS+K
Sbjct: 301 KPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIK 360

Query: 354 WVPQKNAILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQV 413
           W+P+KNAILWK+RSF GGKEYSMSAQ+ LPS++ ++ PKV+RPVQ+KFQIPYFTTSGIQV
Sbjct: 361 WLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSGIQV 420

Query: 414 RYLKITEPKLLYKSYPWVRYITQSGDDYTIKLN 446
           RYLK+ EPKL YKSYPWVRYITQSG+DYTI+LN
Sbjct: 421 RYLKVNEPKLQYKSYPWVRYITQSGEDYTIRLN 453

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/475 (72%), Positives = 399/475 (84%), Gaps = 30/475 (6%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M SAVYFCD  G+P+LSRRYRDD+P+SAIDKF+ LL  LEE+S++IPPCL+H+G++YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFSTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120
           QHNDLY+VA+ TSL  N A +F FLHKL+EVL +YLK+VEEES+RDNF+IIYELLDE+MD
Sbjct: 61  QHNDLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKL+K+ KK + A RPP  +TNSVSWR   I HKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSD---P 237
           DIVESINMLM Q+GQVLRSEIIG +KV SKLSGMPDLKLGINDKGIFSKY++ DS+    
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDNDSNIPSA 240

Query: 238 VTTAVTEG-----------------KKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDG 280
           V+ A ++                  K+K NIELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 241 VSAATSDNNTDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 281 AFELMNYRLSMPVKPLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDA 340
            F+LMNYRLS  +KPLIWCDVNVQVHS SRIEIHC+A+AQIK++S A +VEILIPVPDDA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDA 360

Query: 341 DTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMGLPSINALDK-----PK--- 392
           DTP+FKY+HGS+K+VP+K+AILWK+RSF GGKEYSMSA++GLPSI+         PK   
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISTSKDGSRTIPKSNA 420

Query: 393 --VKRPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDYTIKL 445
             +K PVQIKFQIPYFTTSGIQVRYLKI EPKL YKSYPWVRYITQSGDDYTI+L
Sbjct: 421 KLLKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/475 (73%), Positives = 399/475 (84%), Gaps = 30/475 (6%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M SAVYFCD  G+P+LSRRYRDDIP+SAIDKF  LL  LEE+S++IPPCL+H+G++YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120
           QHNDLY+VA+ TSL  N A +F FLHKL+EVL +YLK+VEEES+RDNF+IIYELLDE+MD
Sbjct: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180
           YGIPQI ETKMLKQYITQKSFKL+K+ KK + A RPP  +TNSVSWR   I+HKKNEAFL
Sbjct: 121 YGIPQICETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180

Query: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSD--PV 238
           DIVESINMLM Q+GQVLRSEIIG +KV SKLSGMPDLKLGINDKGIFSKY++ DS+  P 
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240

Query: 239 TTAVTEG------------------KKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDG 280
           T+A T                    K+K NIELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 241 TSAATSDNITDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 281 AFELMNYRLSMPVKPLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDA 340
            F+LMNYRLS  +KPLIWCDVNVQVHS SRIEIHC+A+AQIK++S A +VEI+IPVPDDA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360

Query: 341 DTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMGLPSIN-------ALDKPK- 392
           DTP+FKY+HGS+K+VP+K+AILWK+RSF GGKEYSMSA++GLPSI+       A+ K   
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420

Query: 393 --VKRPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDYTIKL 445
             +K PVQIKFQIPYFTTSGIQVRYLKI EPKL YKSYPWVRYITQSGDDYTI+L
Sbjct: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/449 (75%), Positives = 397/449 (88%), Gaps = 4/449 (0%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M SAVYFCD KG P+L+RRYRDDIPISAI+KF  LL  LEEE++++PPCLS++G+QYLFI
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120
           QHND+Y+VA+A S++ N AQ+FAFL+KL++VL  YLK+VEEES+RDNF+IIYELLDE MD
Sbjct: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151

Query: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKL+KA KK + A RPP  +TNSVSWR+ +I +KKNEAFL
Sbjct: 152 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPEALTNSVSWRSADIKYKKNEAFL 211

Query: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDS----D 236
           DI+ESINMLM Q+GQ+LRSEIIG++KVKS+LSGMPDLKLGINDKGIFSK+++ DS     
Sbjct: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271

Query: 237 PVTTAVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVKPL 296
               + T  KKK NIELEDLKFHQCVRLSKFE EKIITFIPPDG FELMNYRLS  +KPL
Sbjct: 272 ASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPL 331

Query: 297 IWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVP 356
           IWCD+N+QVHSQSRIEIHCRA+AQIKK+S A +V+I+IPVP+DADTP FKY+HGS+K+VP
Sbjct: 332 IWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVP 391

Query: 357 QKNAILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQVRYL 416
           +KN I+WKIRSF GGKEYSMSAQM LPSI  +++ K KRPVQIKFQIPYFTTSGIQV+YL
Sbjct: 392 EKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQVKYL 451

Query: 417 KITEPKLLYKSYPWVRYITQSGDDYTIKL 445
           KI EPKL YKSYPWVRYITQSGDDYTI+L
Sbjct: 452 KINEPKLQYKSYPWVRYITQSGDDYTIRL 480

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/444 (72%), Positives = 390/444 (87%), Gaps = 5/444 (1%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M S +YFCD KG+ ILSRRYRDD+P SAI+KF  LLL+ E+ESS++PPCL+H+G+QYLFI
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120
           QHND+YV+ ++ SL+ NVAQVF+FL+KL+EVL EY+K+VEEES+RDNF+IIYELLDEM+D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180
           YGIPQITETKMLKQYITQKS+KL+K+ KKSK   RPP+++T SVSWR   I +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSAKKSKNVIRPPSQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTT 240
           D+ ESINML+   GQVLRSEI+G++ V+S+LSGMPDLKLG+NDKGIF+          ++
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVNVRSRLSGMPDLKLGLNDKGIFTSVESA----SSS 236

Query: 241 AVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVKPLIWCD 300
             TEG KK+NIELEDLKFHQCVRLSKFENEKIITFIPPDG FELMNYRLS P+KPLIWCD
Sbjct: 237 EATEG-KKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMNYRLSTPIKPLIWCD 295

Query: 301 VNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNA 360
             +QVHSQSRIEIHCRA+AQIKK+S AN+VEILIPVP+DAD+P F+Y+HGS+K+VP+K+A
Sbjct: 296 AKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSA 355

Query: 361 ILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQVRYLKITE 420
           ILWKI++F GGKEYS +AQ+GLPS+   + P+ KRP+Q+KFQIPYFTTSGIQVRYLKI E
Sbjct: 356 ILWKIKTFNGGKEYSFAAQLGLPSMTDAEVPRAKRPIQVKFQIPYFTTSGIQVRYLKINE 415

Query: 421 PKLLYKSYPWVRYITQSGDDYTIK 444
           PKL Y+SYPWVRYITQSGDDYTI+
Sbjct: 416 PKLQYQSYPWVRYITQSGDDYTIR 439

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/445 (72%), Positives = 393/445 (88%), Gaps = 2/445 (0%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M S +YFCD KG+ +LSRRY+DDIP +AI++F  LL++ E+ESSV+PPC S +G+QYLFI
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120
           QHNDLYV+ L  S++ NVAQVF++LHKL+EVLEEY+K VEEES++DNF+IIYELLDEMMD
Sbjct: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180
           +GIPQIT+TKML+QYITQKSFKL+++ KK K   RPP  +TNSVSWR   IV+KKNEAFL
Sbjct: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180

Query: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTT 240
           D+VESINML+ QQGQVLRSEI+G++KVKS+LSGMPDLKLG+NDKGIF++  + D +   +
Sbjct: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQGDDDDDEEGAS 240

Query: 241 AVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVKPLIWCD 300
             T  KKK+NIELEDLKFHQCVRL+KFENEKIITFIPPDG FELM+YRLS P+KPLIWCD
Sbjct: 241 GGT--KKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCD 298

Query: 301 VNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNA 360
           V +QVHS+SRIEIHCRA+AQIKK+S AN+VEILIPVP+DAD+P F+Y+HG++KWVP +NA
Sbjct: 299 VKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNA 358

Query: 361 ILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQVRYLKITE 420
           ILWKI+SF GGK+YSM+A+MGLPS++     K+KRPVQIKFQIPYFTTSGIQVRYLKI E
Sbjct: 359 ILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVRYLKINE 418

Query: 421 PKLLYKSYPWVRYITQSGDDYTIKL 445
           PK+ Y SYPWVRYITQSGDDYTI++
Sbjct: 419 PKMQYNSYPWVRYITQSGDDYTIRM 443

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/444 (71%), Positives = 390/444 (87%), Gaps = 5/444 (1%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M S +YFCD  G+ ILSRRYRDD+P SAI++F  LLL+ E+ESSV+PPCL+H+G+QY+FI
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120
           QHND+YV+ ++ SL+ NVAQVF+FL+KL+EVL EYLK+VEEES+RDNF+IIYELLDEM+D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180
           YGIPQITETKMLKQYITQKS+KL+K+VKKSK   RPP ++T SVSWR   I +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTT 240
           D+ ESINML+   GQVLRSEI+G++KV+S+LSGMPDLKLG+NDKGIF+    G++     
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTSEEGGNN----- 235

Query: 241 AVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVKPLIWCD 300
           A     KK+NIELEDL+FHQCVRLSKFENEKII+FIPPDG F+LMNYRLS P+KPLIWCD
Sbjct: 236 AEGGSGKKSNIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCD 295

Query: 301 VNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNA 360
             +QVHSQSRIEIHCRA+AQIKK+S AN+VEILIPVP+DAD+P F+Y+HGS+K+VP+K+A
Sbjct: 296 AKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSA 355

Query: 361 ILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQVRYLKITE 420
           ILW+I++F GGKEYS +AQ+GLPS+  ++ PK KRP+Q+KFQIPYFTTSGIQVRYLK+ E
Sbjct: 356 ILWRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPYFTTSGIQVRYLKVHE 415

Query: 421 PKLLYKSYPWVRYITQSGDDYTIK 444
           PKL Y+SYPWVRYITQSGDDYTI+
Sbjct: 416 PKLQYQSYPWVRYITQSGDDYTIR 439

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/445 (70%), Positives = 389/445 (87%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M S +YFCD KG+ +LSRRY+DDIPISAI++F  LL++ E+ES+VIPPC SH+G+QYLFI
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120
           QHNDLY++ L  S+  NVAQVF+FLH L++VL+EY+K VEEES++DNF+IIYELLDE+MD
Sbjct: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180
            GIPQIT+TKML+QYITQKSFKL+++ KK K   RPP+ +T +VSWR   I +KKNEAFL
Sbjct: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTT 240
           D++ESINM+M QQGQVLRSEI+G++KV+S+LSGMPDLKLG+NDKGIF++  E + D  ++
Sbjct: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTQSNEEEEDEPSS 240

Query: 241 AVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVKPLIWCD 300
             +  +KK+NIELEDLKFHQCVRLSKFENEKIITFIPPDG FELM+YRLS P+KPLIWCD
Sbjct: 241 QPSITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCD 300

Query: 301 VNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNA 360
             +QVHS+SR+E+HCRA+AQIK +S AN+VEILIPVP+DAD+P F+Y+HGS+KWVP+KNA
Sbjct: 301 AKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNA 360

Query: 361 ILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQVRYLKITE 420
           ILWKI+SF GGK+YSM+A+MGLPS+N +     KRPVQIKFQIPYFTTSGIQVRYLKI E
Sbjct: 361 ILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQVRYLKINE 420

Query: 421 PKLLYKSYPWVRYITQSGDDYTIKL 445
           PKL Y SYPWVRYITQSG+DY I++
Sbjct: 421 PKLQYNSYPWVRYITQSGEDYIIRM 445

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/468 (70%), Positives = 399/468 (85%), Gaps = 26/468 (5%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M SAVYFCD KG+P+LSR+YRDDIP+SAIDKF+ LL   EEES+++PPC+SH+GIQY+FI
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFSSLLSDKEEESNLLPPCISHNGIQYMFI 60

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120
           QHNDLY+ ALATS+  N++ +FAFLHK+++VL+ YLK+VEEES+RDNFIIIYELLDEMMD
Sbjct: 61  QHNDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180
           YG+PQITETKMLK+YIT KSFKL KA KK + A RPPTE+TNSVSWR   I +KKNEAFL
Sbjct: 121 YGLPQITETKMLKKYITTKSFKLEKAHKKKRNAARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEG------- 233
           DI+ESINML+ Q+GQVLRSEI+G ++VKS+LSGMPDLKLGIND+GIF+KY+EG       
Sbjct: 181 DIIESINMLITQKGQVLRSEIVGNVRVKSRLSGMPDLKLGINDRGIFTKYLEGNNIGIAK 240

Query: 234 --------DSDPVTTAVTEG--KKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFE 283
                   D++  ++ V+EG  K+KTNIELEDLKFHQCVRLSKFENEKII+FIPPDG F+
Sbjct: 241 NGDDEDADDTNNESSIVSEGSNKRKTNIELEDLKFHQCVRLSKFENEKIISFIPPDGEFD 300

Query: 284 LMNYRLSMPVKPLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTP 343
           LMNYRLS  +KPLIWCDV++Q +   RIEIHC+A+AQIKK+SIA +VEILIPVP+DAD+P
Sbjct: 301 LMNYRLSTSIKPLIWCDVSIQTY---RIEIHCKAKAQIKKKSIATNVEILIPVPEDADSP 357

Query: 344 SFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMGLPSINALD------KPKVKRPV 397
            FKY+HG +K++P+KN +LWKI SF GGKEYSM+AQMGLPSI+  D        + K+PV
Sbjct: 358 IFKYSHGKIKYLPEKNLLLWKISSFPGGKEYSMAAQMGLPSISGEDDLNTRVSNQSKKPV 417

Query: 398 QIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDYTIKL 445
           Q+KF+IPYFTTSGIQVRYLK+ EPKL YK+YPWVRYITQSGDDYTI++
Sbjct: 418 QVKFKIPYFTTSGIQVRYLKVNEPKLQYKTYPWVRYITQSGDDYTIRI 465

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/446 (71%), Positives = 386/446 (86%), Gaps = 4/446 (0%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M S V FCD KG+P+LSRRY+DD+  SA++ F  LLL+ E+ESSV+PPC  H+GI Y+++
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120
           Q+ND+YV+AL  S++ N   +FAF++KL+ V+EEY+K VEEES+RDN+IIIYELLDEMMD
Sbjct: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180
            G+PQ+TETKMLKQYITQKSFKL ++ KK K   RPPTE+TNSVSWR   I +KKNEAFL
Sbjct: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDS-DPVT 239
           D++ESINMLM QQGQVLRSEI+G +KV+S+LSGMPDLKLG+NDKGIF+   + DS +PV 
Sbjct: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPV- 239

Query: 240 TAVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVKPLIWC 299
             V+  KK +NIELEDLKFHQCVRLSKFENEKIITFIPPDG F+LM YRLS P+KPLIWC
Sbjct: 240 --VSSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWC 297

Query: 300 DVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKN 359
           DV VQVHS SRIEIHCRA+AQIKK+S+AN+VEILIP+P+DAD+P+FKY+ G++KWVP+KN
Sbjct: 298 DVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKN 357

Query: 360 AILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQVRYLKIT 419
           AILWK  SF GGKEYSM+AQ+GLPS++  + PK+KRPVQIKFQIPYFTTSGIQVRYLKI 
Sbjct: 358 AILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQVRYLKIE 417

Query: 420 EPKLLYKSYPWVRYITQSGDDYTIKL 445
           EPKL Y SYPWVRYITQSGDDYTI+L
Sbjct: 418 EPKLQYNSYPWVRYITQSGDDYTIRL 443

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/446 (74%), Positives = 393/446 (88%), Gaps = 4/446 (0%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M SA+YFCD KGRP+LSR+YRDDIP++AIDKFA LL  LEEESSVIPPCL+++  QYLFI
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120
           QH+D+Y+VA+   L TN+A+VFAFL+K+++VL +YLK+VEEES+RDN++IIYELLDE+MD
Sbjct: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKL+KA KK + A RPP+ +T+SVSWR+  I +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKQNAARPPSALTDSVSWRSEGIKYKKNEAFL 180

Query: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTT 240
           DIVESINMLM Q+GQ+LRSEI+G +K+KS+LSGMPDLKLGINDKGIFSK +  D    T 
Sbjct: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDD---TN 237

Query: 241 AVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVKPLIWCD 300
                KK+  IELEDLKFHQCVRLSKFE EKIITFIPPDG FELMNYRLS  +KPLIWCD
Sbjct: 238 NNATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCD 297

Query: 301 VNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNA 360
           +NVQVHS SRIEIHCRA+AQIKK+S A +VEILIPVP+DADTP+FKY+HGS+KWVP+K+A
Sbjct: 298 MNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSA 357

Query: 361 ILWKIRSFTGGKEYSMSAQMGLPSINA-LDKPKVKRPVQIKFQIPYFTTSGIQVRYLKIT 419
           ILWKIRSF GGKEYSM+A++ LPS ++  ++ + K+PVQ+KFQIPYFTTSGIQVRYLKI 
Sbjct: 358 ILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQVRYLKIN 417

Query: 420 EPKLLYKSYPWVRYITQSGDDYTIKL 445
           EPKL YKSYPWVRYITQSGDDYTI+L
Sbjct: 418 EPKLQYKSYPWVRYITQSGDDYTIRL 443

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/456 (74%), Positives = 396/456 (86%), Gaps = 10/456 (2%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M SA+YFCD KGRP+LSR+YRDDIP SAID+F  LL   EEE+++IPPC+ H+GIQ+LFI
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120
           QHNDLY+VA+ATS++ N A +F+FLHK++EVL EYLK+VEEES+RDNF+IIYELLDEMMD
Sbjct: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180
           YGIPQITE KMLKQYITQKSFKL KA KK + A RPPT +TNSVSWR   I HKKNEAFL
Sbjct: 121 YGIPQITEPKMLKQYITQKSFKLKKAAKKKRNAARPPTSLTNSVSWRPEGIKHKKNEAFL 180

Query: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSD---- 236
           DI+ESINMLM Q+GQVLRSEIIG++KVKSKLSGMPDLKLGINDKG+FSKY+EGD +    
Sbjct: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240

Query: 237 -PVTTAVTEGKKK----TNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSM 291
            P  ++V E K K     N+ELEDLKFHQCVRLSKFENEK ITFIPPDG FELM+YRLS 
Sbjct: 241 APDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLST 300

Query: 292 PVKPLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGS 351
            +KPLIWCDVN++ HS+SRIEI CRA+AQIKK+S A +VEILIPVP+DADTP FKY+HGS
Sbjct: 301 AIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGS 360

Query: 352 VKWVPQKNAILWKIRSFTGGKEYSMSAQMGLPSINALDKP-KVKRPVQIKFQIPYFTTSG 410
           +K+VP+KNAILWKIR+F G KEYSM+A+MGLPS NA ++  K+KRPVQ+KFQIPYFTTSG
Sbjct: 361 IKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTTSG 420

Query: 411 IQVRYLKITEPKLLYKSYPWVRYITQSGDDYTIKLN 446
           IQVRYLKI E  L YKSYPWVRYIT+SGDDYTI+L+
Sbjct: 421 IQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  222 bits (566), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 142/469 (30%), Positives = 239/469 (50%), Gaps = 42/469 (8%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M+SA++    +G  I+S+  +D+I +   + F    +Q+     V  P L+     +  I
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFR---IQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120
           + N    +   +   T+ A ++ FL+   ++LE Y  +  E+S++ +F++ YE+LD ++D
Sbjct: 58  RSNGGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDIN-SEDSLQGDFMLCYEILDIVLD 116

Query: 121 YGIPQITETKMLKQYITQKSFK---------------LMKAVKKSKAAPRPPTEVTNSVS 165
            GIP+ TE   +  YI++K                  L+KA  +  ++        +   
Sbjct: 117 NGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMCL 176

Query: 166 WRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKG 225
           WR+  I +KKNE +LD+ E I++L+N+ G +L+S + G ++  + LSGMP  + G ND  
Sbjct: 177 WRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDYL 236

Query: 226 IFSKYVEGDSDPVTTAVTEGKKK------TNIELEDLKFHQCVRLSKFENEKIITFIPPD 279
             S   +   +        G K        ++ LED KFHQCV+L KF+ E++I F+PPD
Sbjct: 237 SPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVPPD 296

Query: 280 GAFELMNYR----LSMPVK--PLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEIL 333
           G FELM Y     L++P K  P+      V       +E     ++    +  A  VE+ 
Sbjct: 297 GLFELMKYHVRDNLNLPFKVTPM------VTTLKGKSVEYRITLKSLFPSKLCAKDVELY 350

Query: 334 IPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMGLPSINALDKPKV 393
           IP P D        + G  K++P++NAI+WKI  + G  E   SA + +P  N  D   +
Sbjct: 351 IPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVI-VPMGNGNDSLNL 409

Query: 394 KR----PVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSG 438
           ++    P+ ++F+I  F+ SG+ VRYLK+ E  L Y +  WV+YI++SG
Sbjct: 410 EQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG 458

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  207 bits (526), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 139/471 (29%), Positives = 247/471 (52%), Gaps = 44/471 (9%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M+SA++    +G  ++S+  R  +P S  + F    +Q+     V  P L+     +  +
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFR---IQVINNLDVRSPVLTLGSTTFHHV 57

Query: 61  QH-NDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMM 119
           +   +L++VA++ S A + A ++ FL+KL  +LE +    E E ++++F+  YELLD ++
Sbjct: 58  KSPGNLWIVAVSRSNADSAA-IWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLDIVL 115

Query: 120 DYGIPQITETKMLKQYITQK---------SF---------------KLMKAVKKSKAAPR 155
           + G+P  TE   +   ++ K         +F               + ++A   S     
Sbjct: 116 EDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARSSSSNLHD 175

Query: 156 PPTEVTNSVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMP 215
             ++V +++ WR   I +KKNE FL++ E I++L+++ G +L+S + G ++  + LSGMP
Sbjct: 176 SHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235

Query: 216 DLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKT-NIELEDLKFHQCVRLSKFENEKIIT 274
             + G+ND    S     +  P T      K    ++ LED KFHQCV+L KF++E+ I 
Sbjct: 236 VCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTIN 295

Query: 275 FIPPDGAFELMNYR----LSMPVK--PLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIAN 328
           FIPPDG+FELM Y     L++P K  P+      V +   + I+     ++    +  A 
Sbjct: 296 FIPPDGSFELMKYHVRENLNLPFKITPV------VTLFKANSIDYRVTIKSLFPSKLTAK 349

Query: 329 SVEILIPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMGLPSINAL 388
            V++ IPVP +        ++G  K+VP+++AI+WK   + G  E S+SA       +AL
Sbjct: 350 DVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKDSAL 409

Query: 389 DKPK-VKRPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSG 438
           +  +  K P+ +KF+I  F+ SG+ VR+  ++E    YK   W++Y+++SG
Sbjct: 410 NIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG 460

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  201 bits (511), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 143/488 (29%), Positives = 250/488 (51%), Gaps = 62/488 (12%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M++A++    KG  ++S+  RD I  S  + F    +Q+     V  P L+     +  I
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFR---IQVINNLDVRSPVLTLGSTTFHHI 57

Query: 61  QHN-DLYVVALATSLATNVAQVFAFLHKLMEVLEEY-LKSVEEESVRDNFIIIYELLDEM 118
           + + +L++VA+  S A + A ++ FL+K   +LE Y L S  EES+++ F+  YELLD +
Sbjct: 58  RSSSNLWIVAVTRSNADSAA-IWEFLYKFNALLEAYGLNS--EESLKEEFMTCYELLDVV 114

Query: 119 MDYGIPQITETKMLKQYITQK------------------------SFKLMKAVKKSKAAP 154
           ++ G+P  TE   +   ++++                         F++ K + K   + 
Sbjct: 115 LENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSS 174

Query: 155 RPPTEVTN--------SVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQIK 206
              +   N        +  WR+  I +KKNE FLD+ E IN+L+++ G +L+S + G + 
Sbjct: 175 SSVSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVD 234

Query: 207 VKSKLSGMPDLKLGINDK-GIFSKYVEGDSDPVTTAVTEGKKKT------NIELEDLKFH 259
           + + LSG P  + G+ND   +    +  D D ++    + KK        +++LED KFH
Sbjct: 235 LTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFH 294

Query: 260 QCVRLSKFENEKIITFIPPDGAFELMNYR----LSMPVK--PLIWCDVNVQVHSQSRIEI 313
           QCV+L++F  ++II F+PPDG+FELM Y     L++P K  P+     N        +E 
Sbjct: 295 QCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSN-----NGAVEY 349

Query: 314 HCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKE 373
               ++    +  A  V + IPVP          ++G  ++VP++NA+LWK   + G  E
Sbjct: 350 RVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTE 409

Query: 374 YSMSAQMGLPSIN--ALDKPKVKR-PVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPW 430
            ++SA + +P  N  +L+  +  R P+ + F+I  F+ SG+ VR+ K++E    Y +  W
Sbjct: 410 NTLSA-LTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKW 468

Query: 431 VRYITQSG 438
           V+YI++SG
Sbjct: 469 VKYISRSG 476

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  198 bits (504), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 148/504 (29%), Positives = 253/504 (50%), Gaps = 85/504 (16%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M++A+     +G  ++S+ ++  +  S  D F    +Q+     V  P L+     +  I
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFR---IQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QH---NDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           +    ++L++VA++ +   + A ++ FL+KL  +L+ Y  +  EE +++ F+I++ELLD 
Sbjct: 58  KSTRGDNLWIVAVSRN-NVDSAAIWEFLYKLDSLLDSYGLN-HEEYLKEEFMIVHELLDV 115

Query: 118 MM--DYGIPQITETKMLKQYITQKSFK---------------------------LM---K 145
           MM    GIP +TE  ++   ++ K  K                           LM   K
Sbjct: 116 MMCGSGGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLLMSGPK 175

Query: 146 AVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQI 205
            ++++ A+      +     WR   IVHKKNE  L + E IN+L+++ G VL++ + G I
Sbjct: 176 LLRRNSASLSQDLSILTDFKWRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVDGSI 235

Query: 206 KVKSKLSGMPDLKLGINDKGIFSKYVEG-DSD------------PVTTAVTEGKKKT--- 249
            +++ LSG P  + G+ND    S  V G DSD             V    T+ K+ +   
Sbjct: 236 DLETHLSGTPICQFGLND----SLSVSGVDSDMYGSHNHNHHFGDVNFDKTDKKQLSMAS 291

Query: 250 --NIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYR----LSMP--VKPLIWCDV 301
             ++ LED KFHQCV L KF+ ++II F+PPDG+ ELM Y     L++P  V P++    
Sbjct: 292 VGSVILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIV---- 347

Query: 302 NVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNAI 361
                + + +E     ++    R  A +V + IPVP +        T+GS K++P+++A+
Sbjct: 348 -TNTRNGTALEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAM 406

Query: 362 LWKIRSFTGGKEYSMSAQMGLP-------SINALDKPKVKRPVQIKFQIPYFTTSGIQVR 414
           +W+   F G  E ++SA + +P       S+    KP    P+ + F+I  F+ SG+ VR
Sbjct: 407 IWRFNKFNGLTENTLSA-VTIPTKDNTQLSLQQWSKP----PMSLDFEILMFSNSGLVVR 461

Query: 415 YLKITEPKLLYKSYPWVRYITQSG 438
           Y  ITE    YK+  W++YI++SG
Sbjct: 462 YFTITERDQKYKAVKWIKYISRSG 485

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  196 bits (498), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 136/474 (28%), Positives = 249/474 (52%), Gaps = 49/474 (10%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M++A++    +G  ++S+  +  +  S  + F    +Q+     V  P L+     +  I
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFR---IQVINNLDVRSPVLTLGSTTFHHI 57

Query: 61  QH-NDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMM 119
           +   +L++VA++ S A + A ++ FL++L E+LE +    E E +++ F+I YELLD ++
Sbjct: 58  KSAKNLWIVAVSRSNADSAA-IWEFLYRLNELLEAFNLYSENE-LKERFMICYELLDIVL 115

Query: 120 DYGIPQITETKMLKQYITQK------------------SFKLMKAVKKSKAAPRP----- 156
           + G+P  TE   +   ++ K                  + +++   +  +  P       
Sbjct: 116 EDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQD 175

Query: 157 -PTEVTNSVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMP 215
             +E  +++ WR   I +KKNE FL++ E I++L+++ G +L+S + G ++  + LSGMP
Sbjct: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235

Query: 216 DLKLGINDK-GIFSKYVEGDSDPVTTAVTEGKKKT-NIELEDLKFHQCVRLSKFENEKII 273
             + G+ND   + + + + D   VT      K    ++ LED KFHQCV+L KF++E+ I
Sbjct: 236 VCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTI 295

Query: 274 TFIPPDGAFELMNYR----LSMPVK--PLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIA 327
            FI PDG+FELM Y     L++P K  P+      V V   + I+     ++    +  A
Sbjct: 296 NFIAPDGSFELMKYHVRENLNLPFKVTPI------VTVVRSNSIDYQITIKSLFPSKLTA 349

Query: 328 NSVEILIPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQ---MGLPS 384
             V++ IPVP +  +     ++G  K+VP+++AI+WK   + G  E S+SA    M   +
Sbjct: 350 KDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDST 409

Query: 385 INALDKPKVKRPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSG 438
           +N    P  + P+ +KF+I  F+ SG+ VR+  ++E    YK   W++Y+++SG
Sbjct: 410 LNIEQWP--RPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG 461

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  192 bits (489), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 143/479 (29%), Positives = 239/479 (49%), Gaps = 51/479 (10%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M+SAV     +G  I+S+ +++++  S  D F    +Q+     V  P L+     +  I
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFR---IQVINNLDVRSPILTLGSTTFQHI 57

Query: 61  QHN----DLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLD 116
           + N    DL++V++  S   N   V+ FL+K   +LE Y  +  EE +++ F++ YELLD
Sbjct: 58  RSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELYGLN-NEEFLKEEFMVCYELLD 115

Query: 117 EMM-DYGIPQITETKMLKQYITQKSFK------LMKAVKKSKAAPRPP-----------T 158
            M+ + G P  T+   + + ++ K  K       +    K+   P+ P            
Sbjct: 116 VMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175

Query: 159 EVTNSVS----------WRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQIKVK 208
           E +N+ S          WR   I HKKNE FL + E I++L++++G +L+S + G I + 
Sbjct: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235

Query: 209 SKLSGMPDLKLGINDKGIFSKYVEGDS-DPVTTAVTEGKKKT-NIELEDLKFHQCVRLSK 266
           + LSG P  + G+ND         GDS D +       K    ++ LED KFHQCV L K
Sbjct: 236 THLSGTPVCQFGLNDSLSVKNDDYGDSFDYIKNKKAIPKAAAGSVLLEDCKFHQCVSLEK 295

Query: 267 FENEKIITFIPPDGAFELMNYRLSMPVK-PLIWCDVNVQVHSQSRIEIHCRARAQIKKRS 325
           F+ ++II F+PPDG+ ELM Y +   +  P     +     S + +E     ++    + 
Sbjct: 296 FDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKL 355

Query: 326 IANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMGLPSI 385
            A +V + IPVP +        ++GS K+ P++ A+LW    + G  E ++SA     +I
Sbjct: 356 TAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAV----TI 411

Query: 386 NALDKPKV------KRPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSG 438
            + D P++      K P+ + F+I  F+ SG+ VRY  I E +  YK+  W+RY+++SG
Sbjct: 412 TSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVSKSG 469

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  192 bits (489), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 144/494 (29%), Positives = 247/494 (50%), Gaps = 70/494 (14%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M++ +     +G  I+S+ ++  +  S  D F    +Q+     V  P L+     +  I
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFR---IQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QH----NDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLD 116
           +     ++L++VA AT    N A ++ FL+KL  +L EY  + +EE +++ F+I++ELLD
Sbjct: 58  RSSKDSDNLWLVA-ATRNNANSAAIWEFLYKLDSMLIEYGLN-KEEYLKEEFMIVHELLD 115

Query: 117 EMM-DYGIPQITE--------------------TKMLKQYITQKS---FKLMKAVKKSKA 152
            M+   GIP  TE                    + +L  ++  K      + K +K++ +
Sbjct: 116 VMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRNDS 175

Query: 153 APRPPTEVT-NSVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQIKVKSKL 211
           +    +  + N  SWR  +I HKKNE  L + E IN+L+ + G +L++ + G I ++++L
Sbjct: 176 SQSHDSNFSFNDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRL 235

Query: 212 SGMPDLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKT------------------NIEL 253
           SG P  + G+ND          DS+  +     G  K+                  N+ L
Sbjct: 236 SGTPVCQFGLNDSLTLG---SNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVIL 292

Query: 254 EDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYR----LSMPVK--PLIWCDVNVQVHS 307
           ED KFHQCV L KF+ E+II F+PPDG+ ELM Y     L++P K  P++   V     +
Sbjct: 293 EDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSV-----T 347

Query: 308 QSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRS 367
              ++     ++    R  A  V + IPVP      +   ++G+ K+VP +NA++WK   
Sbjct: 348 GDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNK 407

Query: 368 FTGGKEYSMSAQMGLPS--INALDKPKVKR-PVQIKFQIPYFTTSGIQVRYLKITEPKLL 424
           + G  E ++SA + +PS  +N     +  R P+ + F+I  F+ SG+ VRY  I+E    
Sbjct: 408 YNGLTENTLSA-VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQN 466

Query: 425 YKSYPWVRYITQSG 438
           YK+  W++Y+++SG
Sbjct: 467 YKAVKWIKYVSKSG 480

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  191 bits (486), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 144/521 (27%), Positives = 249/521 (47%), Gaps = 98/521 (18%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M S +Y  D   +P++ + ++    IS  ++   L  Q   +  ++P    + GI +++I
Sbjct: 1   MSSCIYILDETLQPLIYKNFK---AISNGEESIELFQQAHSKHPMVP-VFHYKGIHFVYI 56

Query: 61  QHNDLYVVALATSLAT--------NVAQVFAFLHKLMEVLEEYLKS--VEEESVRDNFII 110
           + +  Y ++    +A         NV  +  +L     +L+ Y  S  +    + DNF +
Sbjct: 57  RRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRYFNSQKLNRWLIVDNFHL 116

Query: 111 IYELLDEMMDYGIPQITETKMLKQYITQK---SFKLMKAVKK-SKAAPRPPTE------- 159
           IYELLDE +D+G+PQ+T+  +++ YI  +     +L  + KK SK       E       
Sbjct: 117 IYELLDESLDFGVPQLTDYNIIQDYIKVQVNLHDELADSSKKISKKEDLHGFEDDESYMN 176

Query: 160 ------VTNSVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEII-GQIKVKSKLS 212
                  T+++SWR   I + KNE FLD++E I   M+     +R   + G+I+ +S LS
Sbjct: 177 SFIARTTTSAISWRPKGIHYTKNEFFLDVIEEIEYCMDFNKSKIRKNFVHGRIRCRSYLS 236

Query: 213 GMPDLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKFENEKI 272
           GMP LK+G++               +T+++ + +++    + + KFHQCV L   + + I
Sbjct: 237 GMPKLKIGLS--------------KITSSLPKEREQF---MNNAKFHQCVSLEDLQ-KNI 278

Query: 273 ITFIPPDGAFELMNYRLSM-----PVKPLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIA 327
           ++FIPPDG F+L  Y+L       PV  L+  DV  +   + +I I        K ++  
Sbjct: 279 VSFIPPDGEFQLCEYKLKRHVRDPPVIKLVKFDVKKEEKKRPKILISLTITTDFKSQNST 338

Query: 328 NSVEILIPVP--------DDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGK---EYSM 376
           + + I IP+         D A  P FK   G+V +    + +LW++ S  GG    E+SM
Sbjct: 339 SVLNIRIPLTKIFSEYQIDLAKPPRFKCDQGNVLFNLTDDLLLWEVGSIKGGHAQTEHSM 398

Query: 377 SAQMGLPS-----------INALDKPKVK---------------------RPVQIKFQIP 404
             +  L              N++D P ++                     R V ++F+IP
Sbjct: 399 YCEFRLYDEEEYKKQLEELKNSMDPPPLRQGPKLEELYKQVHENENTNRSRLVSMEFEIP 458

Query: 405 YFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDYTIKL 445
           Y+T SG++V+YLKI E +L Y S+PWVRY T + ++Y  ++
Sbjct: 459 YYTCSGLKVQYLKIEEDQLQYHSFPWVRYKTVNDEEYAYQI 499

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  191 bits (484), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 131/480 (27%), Positives = 241/480 (50%), Gaps = 53/480 (11%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLS--HDGIQYL 58
           M+SA++  + KG  ++S+  +D +  S  D F     Q+  +  V  P L+      Q++
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFR---TQVINDPHVRSPILTLGSTTFQHV 57

Query: 59  FIQHND---LYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELL 115
             + +D   +++VA++ S   + + ++ +LHKL +++E +  + +E+ ++D F+++YE+L
Sbjct: 58  IRESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAFGIN-DEDVLKDEFMLLYEIL 115

Query: 116 DEMMDYGIPQITETKMLKQYITQKSFK------------------LMKAVKKSK-AAPRP 156
           +  ++ GIPQ T+   +   +++K  +                  ++KA K SK ++   
Sbjct: 116 ELTLENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNILKAPKLSKRSSSSI 175

Query: 157 PTEVTNSVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPD 216
                +   WR   + +KKNE +LDI E I +L+ + G +++S + G +   S LSGMP 
Sbjct: 176 ALSSLSECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPL 235

Query: 217 LKLGINDK--------------GIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCV 262
            +LG+ND                + S+Y   +   +  A        ++ LED KFHQCV
Sbjct: 236 CQLGLNDTYSIHGNEKSELSIVEMMSEYDIKNKKAIPNAAA-----GSVILEDCKFHQCV 290

Query: 263 RLSKFENEKIITFIPPDGAFELMNYRLSMPVKPLIWCDVNVQVHSQSRIEIHCRARAQIK 322
           +L+K+E   +I F+PPDG F+LM YR+   +         V++   S +      R+   
Sbjct: 291 QLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFP 350

Query: 323 KRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMGL 382
               A  V + IPVP       F  + G  K+   +  ++WK   + G  E ++S ++ +
Sbjct: 351 SNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAI 410

Query: 383 PSINALDKPKVKR----PVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSG 438
           P+  + D   + R    P+ + F+I  F+ SG+ VR+LK  EP+L Y+   W++YI+ SG
Sbjct: 411 PA-TSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSG 469

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  184 bits (466), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 140/491 (28%), Positives = 242/491 (49%), Gaps = 68/491 (13%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M+SA+     +G  I+++  +  +  S  D F    +Q+     V  P L+     +  I
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFR---IQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QHN---DLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           + +    L++VA++ S A N   ++ FL+KL  +++ Y    +E ++++NF+  YE+LD 
Sbjct: 58  RSDGSDSLWLVAVSRSNA-NSGAIWEFLYKLNVIMDVY-GLTKEGTLKENFMNCYEILDT 115

Query: 118 MMDYG-IPQITE-----TKML----KQ----------YITQKSFKLMKAVKKSKAAPRPP 157
           +++ G IP  TE     +KM     KQ           +T  S  L      S     P 
Sbjct: 116 VLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPK 175

Query: 158 TEVTNS--------------VSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIG 203
               N+              +SWR   I +KKNE  L++ E I++L+++ G +L+S + G
Sbjct: 176 FLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDG 235

Query: 204 QIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKT-------NIELEDL 256
            I + + LSGMP  + G+ND    S  VE   D ++       KK         + LED 
Sbjct: 236 TIDLTTHLSGMPICQFGLND----SLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDC 291

Query: 257 KFHQCVRLSKFENEKIITFIPPDGAFELMNY----RLSMPVK--PLIWCDVNVQVHSQSR 310
           KFHQCV L KF  +++I F+PPDG+ ELM Y     L++P K  P++       +   + 
Sbjct: 292 KFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIV-----TSIGRGNT 346

Query: 311 IEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTG 370
           I+     ++    +  A  V + IPVP          ++G  K+VP+++A++WK   +TG
Sbjct: 347 IDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTG 406

Query: 371 GKEYSMSAQMGLPSINALD---KPKVKRPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKS 427
             E ++SA + +PS +      +   + P+ + F+I  F+ SG+ VRY K+++    Y++
Sbjct: 407 LTENTLSA-VTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRT 465

Query: 428 YPWVRYITQSG 438
             W++YI++SG
Sbjct: 466 AKWIKYISKSG 476

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score =  184 bits (467), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 132/467 (28%), Positives = 225/467 (48%), Gaps = 102/467 (21%)

Query: 48  PCLSHDGIQYLFIQHNDLYVVALATSLATNV-AQVFAFLHKLMEVLEEYL-KSVEEESVR 105
           P LSH G  Y++IQ + LY ++L+  + T V   VFA+L +L ++ ++YL + +  + + 
Sbjct: 41  PVLSHRGYDYIYIQRDGLYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLNRQLIM 100

Query: 106 DNFIIIYELLDEMMDYGIPQITETKMLKQYIT----------------QKSFKLMKAVKK 149
           DNF ++YEL+DE +D GIPQ+T+  +++ Y+                  K+ +     ++
Sbjct: 101 DNFHLVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAEDGEKHAGKHKAKRDKAGKEE 160

Query: 150 SKAAPRPPTE----------VTNSVSWRAPNIVHKKNEAFLDIVESINMLMN-QQGQVLR 198
            +A P    E           T+++SWR   I + KNE FLD+VE +  LM+ ++ QV  
Sbjct: 161 EEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQVRL 220

Query: 199 SEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKF 258
           +++ G I  +S LSGMP L +G+N      K V  D D  T+ V               F
Sbjct: 221 NQVHGAINCRSYLSGMPQLTVGLN------KMVAQDRD-FTSQV--------------HF 259

Query: 259 HQCVRLSKFENEKIITFIPPDGAFELMNYRLS-----MPVKPLIWCDVNVQVHSQ----S 309
           HQCV L +   ++ ITF+PPDG F+L +Y+L+      P+  L  C   V+   +     
Sbjct: 260 HQCVDLERLATDRHITFVPPDGEFQLCHYKLARGANEQPLIKLEECRAAVKPRRRPADAD 319

Query: 310 RIEIHCRARAQIKKRSIANSVEILIPVP--------DDADTPSFKYTHGSVKWVPQKNAI 361
           R+ +        K +   + +++ +P+         D +  P FK   G V +    + +
Sbjct: 320 RLVLTVSISTNFKLQDATSVLKVRVPLARVFEQWKVDLSFPPRFKCDAGCVMFNITDDYL 379

Query: 362 LWKI---RSFTGGKEYSMSAQMGL--------------PSINAL------------DKPK 392
           LW I   +   G + ++M +Q  L               S++ L            ++  
Sbjct: 380 LWDIGKAKGSHGDRRFTMQSQFHLYDEAYYSRRRAQLSTSMDPLPAHPGQQLEALYNQTH 439

Query: 393 VKRP------VQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRY 433
              P      +++ F++PY T SG++V +LKI EP+L Y+S+PW+RY
Sbjct: 440 ASAPTHASALLRVDFEVPYHTISGLKVEFLKILEPQLQYQSFPWIRY 486

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score =  184 bits (466), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 142/532 (26%), Positives = 250/532 (46%), Gaps = 114/532 (21%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M S+++  D +  P++ + ++    +   + FA    ++ + S+V  P + H GI ++ I
Sbjct: 1   MSSSIFLLDEQLNPLIVKSFKS---VQHPEAFAYRFKEVYKVSNV--PVIYHKGIVFISI 55

Query: 61  QHNDLYVVALAT-SLATNVAQVFAFLHKLMEVLEEYLK--SVEEESVRDNFIIIYELLDE 117
             + LY V+++  SL +++     +L+    +L++YL+  +++   + DNF +IYELLDE
Sbjct: 56  CRDGLYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTRIVDNFNLIYELLDE 115

Query: 118 MMDYGIPQITETKMLKQYI----------------------TQKSFKLMKAVKKSKAAPR 155
            +D+GIPQ+T+  +++  I                       Q+   + +  +KS     
Sbjct: 116 SLDFGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKSNKHGF 175

Query: 156 PPTE----------VTNSVSWRAPNIVHKKNEAFLDIVESINMLMN-QQGQVLRSEIIGQ 204
              E           T ++SWR   I + KNE F+D++ES   +M+ +  QV ++ I G+
Sbjct: 176 QDDEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFIFGR 235

Query: 205 IKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRL 264
           I  +S LSGMP +K+ IN        +  D D   ++               KFHQCV L
Sbjct: 236 IICRSYLSGMPVVKICINK-------MLKDRDQFLSSA--------------KFHQCVSL 274

Query: 265 SKFENEKIITFIPPDGAFELMNYRL-----SMPVKPLIWCDVNVQVHSQSRIEIHCRARA 319
               ++  I FIPPDG F+L  Y++       PV  LI   V V+   + +++I  + + 
Sbjct: 275 ESLSSQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLIEYKV-VEKPKKHKLQISMKIQP 333

Query: 320 QIKKRSIANSVEILIPVPDDADT--------PSFKYTHGSVKWVPQKNAILWKIRSFTGG 371
             K ++ A  ++I +P+ D  +T        P FK   GS+ +      +LWK     GG
Sbjct: 334 HFKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSILFNLSDGYLLWKANGMKGG 393

Query: 372 KE---YSMSAQMGLPSI-----------NALDKPKVKRPVQI------------------ 399
                +SM  +  L              N++D P ++  V++                  
Sbjct: 394 HGETYHSMQVEFFLFDAEAHRKEAEELKNSMDPPPLREGVRMEELYALAHEEKGQINNPV 453

Query: 400 ------KFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDYTIKL 445
                 +F++PYFT+SG++V YLKI E +L Y+S+PWVRY T +  +Y  ++
Sbjct: 454 RNMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVRYKTINDTEYAFQM 505

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  180 bits (456), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 138/481 (28%), Positives = 232/481 (48%), Gaps = 61/481 (12%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M++ V    GKG  I+S+  + +   S  D F    +Q+     V  P L+     +  I
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFR---VQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QHND---LYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           + N    L++VA+  S A N   ++ FL+K   +L  +     E ++++ F+  YELLD 
Sbjct: 58  RSNSRDHLWLVAVTRSNA-NSGAIWEFLYKFDSLLNAFGLD-NETTLKEEFMTCYELLDL 115

Query: 118 MMDY-GIPQITETKMLKQYITQKSF---------------------KLMKAVKKSKAAPR 155
           M++  G+P  TE   +   ++ K                       K +    +S +   
Sbjct: 116 MLNVDGVPLDTELSSVSAKMSTKPLHSINSPSDSSLDNSSSPLSISKFLNRNNRSMSVDT 175

Query: 156 PPTEVTNSVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMP 215
             TE +N   WR   I +KKNE FL+I E I++L+++   +L++ + G + + S LSG P
Sbjct: 176 MNTEPSN-YPWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTSHLSGTP 234

Query: 216 DLKLGINDKGIFSK--YVEGDSD--------PVTTAVTEGKKKTNIELEDLKFHQCVRLS 265
             + G+ND     +  Y   D +        P  TA T       + LED KFH+CV L 
Sbjct: 235 TCQFGLNDSLSVDEPNYYNSDDNGFRNQQNIPRATAGT-------VVLEDCKFHECVSLD 287

Query: 266 KFENEKIITFIPPDGAFELMNYRLSMPVKPLIWCDVNVQVHSQSRIEIHCR--ARAQIKK 323
           KF  ++II F+PPDG  ELM Y +   +        NV ++S+SR  +  R   ++    
Sbjct: 288 KFNRDRIIKFVPPDGHIELMKYHVRDNINLPFKVTPNV-INSRSRTGLDYRITLKSLFPS 346

Query: 324 RSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMGLP 383
           +  AN V + IPVP          ++G  ++VP+++ I+WK   + G  E  +SA     
Sbjct: 347 KLSANDVVLKIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLTENKLSAV---- 402

Query: 384 SINALDKPKV------KRPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQS 437
           ++++ D  ++      + P+ + F+I  F+ SG+ VRYLKI E    Y++  W++YI++S
Sbjct: 403 TVSSNDTTQLMLQQWARPPISLDFEIMMFSNSGLVVRYLKIMEKDQKYRTVKWIKYISRS 462

Query: 438 G 438
           G
Sbjct: 463 G 463

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  178 bits (452), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 138/487 (28%), Positives = 236/487 (48%), Gaps = 66/487 (13%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M++A++    +G  I+S+ + + +  S  D F    +Q+     V  P L+     +  I
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFR---IQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QHN---DLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           + N    L++V ++ + A N   ++ FL+K   +L+ Y    +EE ++++F+I YE+LD 
Sbjct: 58  RSNGSDSLWIVTVSRTNA-NSGAIWEFLYKFNAILDAY-DLTKEEKLKEDFMICYEILDV 115

Query: 118 MMDY-GIPQITETKMLKQYIT---QKSFKLMKAVKKSKAAPRPPTEVTNS---------- 163
           ++   GIP  TE   +   I+    KS       K S  A  P + ++ S          
Sbjct: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175

Query: 164 ----------------VSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQIKV 207
                             WR   I +KKNE FL + E IN+L+++ G +L++ + G I +
Sbjct: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235

Query: 208 KSKLSGMPDLKLGINDKGIFSKYVE-GDSDPVTTAVTEGKKKT------NIELEDLKFHQ 260
            + LSG P  + G+ND    S  VE GDS  + T     KK        ++ LED KFHQ
Sbjct: 236 TTHLSGTPICQFGLND----SPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQ 291

Query: 261 CVRLSKFENEKIITFIPPDGAFELMNY----RLSMPVK--PLIWCDVNVQVHSQSRIEIH 314
           CV L KF  E+II F+PPDG  ELM Y     L++P K  P++           S +E  
Sbjct: 292 CVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVV-------TPCGSTVEYR 344

Query: 315 CRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEY 374
              ++    +  A  V + IPVP          ++G  K+  ++NA++W+   + G  E 
Sbjct: 345 ITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTEN 404

Query: 375 SMSAQMGLPSINALD---KPKVKRPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWV 431
           ++SA + +P+ +      +   + P+ + F+I  F+ SG+ VRY ++++    Y+   W+
Sbjct: 405 TLSA-VTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWI 463

Query: 432 RYITQSG 438
           +YI++SG
Sbjct: 464 KYISKSG 470

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  178 bits (452), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 139/500 (27%), Positives = 234/500 (46%), Gaps = 77/500 (15%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M+S V     +G  +L++ +++ +  S  D F    +Q+     V  P L+     +  I
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFR---VQVINNLDVRSPVLTLGSTTFHHI 57

Query: 61  Q--HND-LYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           +  H D L++V +  S A N A ++ FL+KL  V+  Y +   EE++++ F+I++E+LD 
Sbjct: 58  RSRHGDNLWLVTITRSNA-NSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 MMD-YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRP-------------------P 157
           M+   GIP  TE   L   I Q S K ++ +     +P                     P
Sbjct: 116 MLGGNGIPIDTE---LNSVIAQMSVKPVRNMGGLLDSPDGNDVLSSSSSPTSSAGELHFP 172

Query: 158 TEVT-------------------NSVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLR 198
             +T                   N ++WR   I+HKK+E FL + E IN+L+++ G +L+
Sbjct: 173 KFLTKRSSSFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILK 232

Query: 199 SEIIGQIKVKSKLSGMPDLKLGIND----------KGIFSKYVEGDSDPVTTAVTEGKKK 248
           S + G I + + LSG P  + G+ND          K +  +     SD            
Sbjct: 233 SYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQRHSGSDFGNKNFIPKAAA 292

Query: 249 TNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYR------LSMPVKPLIWCDVN 302
            ++ LED KFH+CV L KF    II F+PPDG+ ELM Y       L   V P++     
Sbjct: 293 GSVLLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNINLPFKVTPIV----- 347

Query: 303 VQVHSQSRIEIHCR--ARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNA 360
              HS    EI  R   ++    +  A  V + IPVP          ++G  K+VP++NA
Sbjct: 348 --THSTRDNEIDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENA 405

Query: 361 ILWKIRSFTGGKEYSMSA-QMGLPSINALDKPKVKR-PVQIKFQIPYFTTSGIQVRYLKI 418
           ++W+   + G  E ++SA  +       L+  +  R P+ ++F++  F+ SG+ VRY  I
Sbjct: 406 MIWRFNKYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTI 465

Query: 419 TEPKLLYKSYPWVRYITQSG 438
           +     +++  W++YI+++G
Sbjct: 466 SGKDSKHRAVKWIKYISKAG 485

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  177 bits (450), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 141/504 (27%), Positives = 243/504 (48%), Gaps = 85/504 (16%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M+S V     +G  IL++ +++ +  S  D F    +Q+     V  P L+     +  I
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFR---VQVINNLDVRSPVLTLGSTTFHHI 57

Query: 61  Q--HND-LYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           +  H D L++V +  S A N A ++ FL+KL  V+  Y +   EE++++ F+I++E+LD 
Sbjct: 58  RSKHGDNLWLVTITRSNA-NSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 MMD-YGIPQITETKMLKQYITQKSFKLM-------------------------------- 144
           M+   GIP  TE   L   + + S K M                                
Sbjct: 116 MLGGNGIPIDTE---LNSVVARMSVKPMRNTGGLLDGADGSDILSSSSSPSSAGGELHFP 172

Query: 145 KAVKKSKAAPRPPTEVT------NSVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLR 198
           K +KKS ++     + T      N ++WRA  I+HKK+E FL + E +N+L+++ G +L+
Sbjct: 173 KFLKKSSSSFLGQGDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILK 232

Query: 199 SEIIGQIKVKSKLSGMPDLKLGINDK-GIFS---------KYVEGDSDPVTTAVTEGKKK 248
           S + G I + + L+G P  + G+ND  G+ S         ++    SD            
Sbjct: 233 SYVDGTIDIVTHLNGTPVCRFGLNDSLGMQSEDEKNWLAQQHQHSRSDFGNKNFLPKAAA 292

Query: 249 TNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYR----LSMPVK--PLIWCDVN 302
            ++ LED KFH+CV + KF    II FIPPDG+ ELM Y     +++P K  P++     
Sbjct: 293 GSVLLEDCKFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNINLPFKITPIV----- 347

Query: 303 VQVHSQSRIEIHCR--ARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNA 360
              HS    EI  R   ++    +  A  V + IPVP          ++G  K+VP++NA
Sbjct: 348 --SHSTRDNEIDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENA 405

Query: 361 ILWKIRSFTGGKEYSMSAQMGLPSINALDKPKV------KRPVQIKFQIPYFTTSGIQVR 414
           ++W+   + G  E ++SA     +++  D  ++      + P+ + F++  F+ SG+ VR
Sbjct: 406 MIWRFNKYNGLTENTLSA----ATVSTSDTTQLSFQQWTRPPMSLDFEVMMFSNSGLVVR 461

Query: 415 YLKITEPKLLYKSYPWVRYITQSG 438
           Y  I+     +++  W++YI++SG
Sbjct: 462 YFTISGKDSKHRAVKWIKYISKSG 485

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  176 bits (447), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 139/500 (27%), Positives = 239/500 (47%), Gaps = 77/500 (15%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M+S V     +G  IL++ +++ +  S  D F    +Q+     V  P L+     +  I
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFR---VQVINNLDVRSPVLTLGSTTFHHI 57

Query: 61  QH---NDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           +    ++L++V +  S A N A ++ FL+KL  V+  Y +   EE++++ F+I++E+LD 
Sbjct: 58  RSMRGDNLWLVTITRSNA-NSAAIWEFLYKLDSVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 MMD-YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVT--------------- 161
           M+   GIP  TE   L   I Q S K ++ V     +P     ++               
Sbjct: 116 MLGGNGIPIDTE---LNSVIAQMSVKPIRNVGGLLESPDSIDMLSSTSSPSSVGGELHFP 172

Query: 162 -----------------------NSVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLR 198
                                  N ++WR   I+HKK+E FL + E +N+L+++ G +L+
Sbjct: 173 KFLKKRSSSFLGQGDSHSDFSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSILK 232

Query: 199 SEIIGQIKVKSKLSGMPDLKLGINDK-GIFSKYVEG---DSDPVTTAVTEGKK------K 248
           S + G I + + LSG P  + G+ND  G+ S+  E      D  +    E K        
Sbjct: 233 SYVDGTIDITTHLSGTPVCRFGLNDSLGMQSEDQENWLSQQDQHSHNGFENKNCFPKAAA 292

Query: 249 TNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYR----LSMPVK--PLIWCDVN 302
            ++ LED KFH+CV + KF    II F+PPDG+ ELM Y     +++P K  P++     
Sbjct: 293 GSVLLEDCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNINLPFKITPIV----- 347

Query: 303 VQVHSQSRIEIHCR--ARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNA 360
              HS    E+  R   ++    +  A  V + IPVP          ++G+ K+VP++NA
Sbjct: 348 --AHSARDNEVDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENA 405

Query: 361 ILWKIRSFTGGKEYSMSA-QMGLPSINALDKPKVKR-PVQIKFQIPYFTTSGIQVRYLKI 418
           ++W+   F G  E ++SA  +       L   +  R P+ + F++  F+ SG+ VRY  I
Sbjct: 406 MIWRFNKFNGLTENTLSAVTVSTSDTTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTI 465

Query: 419 TEPKLLYKSYPWVRYITQSG 438
           +     +++  W++YI++SG
Sbjct: 466 SSRDSKHRAVKWIKYISKSG 485

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  176 bits (445), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 146/535 (27%), Positives = 237/535 (44%), Gaps = 121/535 (22%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M S V+  D +  P++ R  +    I+  + +A    ++  +S    P +   GI Y++I
Sbjct: 1   MSSCVFILDEQLNPLILRNLK---SIAHPEWYALYFKRVHPQSR--GPVIYSKGIIYIYI 55

Query: 61  QHNDLYVVALATS-LATNVAQVFAFLHKLMEVLEEYLK--SVEEESVRDNFIIIYELLDE 117
             + LY V+++   L  N+  + A+L+    +L +YLK   V+   + DNF +IYEL DE
Sbjct: 56  LRDGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDRTGIIDNFNLIYELFDE 115

Query: 118 MMDYGIPQITETKMLKQYITQKSFK-------------------LMKAVKKSKA---APR 155
            +DYGIPQ+T+  +++  I  ++                     L     K KA     R
Sbjct: 116 SLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEILQSKENKDKADIHGFR 175

Query: 156 PPTEVTNS---------VSWRAPNIVHKKNEAFLDIVESINMLMN-QQGQVLRSEIIGQI 205
              +  NS         +SWR   I + KNE F+DI+E  + LM+ +  QV ++ + G+I
Sbjct: 176 DDEQYINSFVLRTTTQAISWRPKGIYYTKNELFVDIIERQSYLMDFKNSQVRQTFVYGKI 235

Query: 206 KVKSKLSGMPDLKLGIN----DKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQC 261
             +S LSGMP +++ IN    DK +F                         L   KFHQC
Sbjct: 236 NCRSYLSGMPIVRVCINKMLKDKDLF-------------------------LGSSKFHQC 270

Query: 262 VRLSKFENEKIITFIPPDGAFELMNYRL-----SMPVKPLIWCDVNVQVHSQSRIEIHCR 316
           V L    ++  I FIPPDG F+L  Y+L       P+  LI   +N +   + R+ +   
Sbjct: 271 VSLESLSSQDYIEFIPPDGDFQLCEYKLKRHINDSPIIKLIDYKIN-ERQKKHRLHLSVT 329

Query: 317 ARAQIKKRSIANSVEILIPVP--------DDADTPSFKYTHGSVKWVPQKNAILWKIRSF 368
            +   K ++ A +++I IP          D    P FK  HGSV +      +LW  +  
Sbjct: 330 IQPHFKAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHGSVFFNLSDELLLWDAQGI 389

Query: 369 TGGK---EYSMSAQMGLPS-----------INALDKPKVKRPVQI--------------- 399
            GG     YSM  +  L               ++D P ++    +               
Sbjct: 390 KGGHGETSYSMHVEFALFDEEEHARKLEQIKKSMDPPPLREGAHLEELYAQVKSNKEGKG 449

Query: 400 ---------KFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDYTIKL 445
                    +F++PY+T+SG++V YLKI+E  L Y+S+ WVRY T +  +Y  ++
Sbjct: 450 QFQSNAITAEFEVPYYTSSGLRVEYLKISEENLKYQSFSWVRYKTINDTEYAYQV 504

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  174 bits (441), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 140/504 (27%), Positives = 236/504 (46%), Gaps = 85/504 (16%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M+S V     +G  +L++ +++ +  S  D F    +Q+     V  P L+     +  I
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFR---VQVINNLDVRSPVLTLGSTTFHHI 57

Query: 61  Q--HND-LYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           +  H D L++V +  S A N A ++ FL+KL  V+  Y +   EE++++ F+I++E+LD 
Sbjct: 58  RSRHGDNLWLVTITRSNA-NSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 MMD-YGIPQITETKMLKQYITQKSFK--------------------------------LM 144
           M+   GIP  TE   L   I Q S K                                  
Sbjct: 116 MLGGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLSSSSSPSSVSGELHFP 172

Query: 145 KAVKKSKAAPRPPTEVT------NSVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLR 198
           K +KKS ++     +        N ++WR   I HKK+E FL + E +N+L+++ G +L+
Sbjct: 173 KFLKKSSSSFLGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILK 232

Query: 199 SEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIE------ 252
           S + G I + + LSG P  + G+ND    S  ++ + +    A  +   + N E      
Sbjct: 233 SYVDGTIDITTHLSGTPICRFGLND----SLGMQSEDEKKWLAQQQHHSRGNFESKNFIH 288

Query: 253 --------LEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYR----LSMPVK--PLIW 298
                   LED KFH+CV L KF     I F+PPDG+ ELM Y     +++P K  P++ 
Sbjct: 289 KAAAGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIV- 347

Query: 299 CDVNVQVHSQSRIEIHCR--ARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVP 356
                  HS    EI  R   ++    +  A  V + IPVP          ++G  K+VP
Sbjct: 348 ------THSTRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVP 401

Query: 357 QKNAILWKIRSFTGGKEYSMSA-QMGLPSINALDKPKVKR-PVQIKFQIPYFTTSGIQVR 414
           ++NA++W+   + G  E ++SA  +       L+  +  R P+ + F++  F+ SG+ VR
Sbjct: 402 EENAMMWRFNKYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVR 461

Query: 415 YLKITEPKLLYKSYPWVRYITQSG 438
           Y  I      +++  W++YI++SG
Sbjct: 462 YFTIFGKDSKHRAVKWIKYISRSG 485

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  171 bits (432), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 121/432 (28%), Positives = 217/432 (50%), Gaps = 31/432 (7%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M+ A +    +G  I+S+    +   S  + F    LQ+     +  P L+     +  I
Sbjct: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFR---LQVINGLEIRSPVLTLGSTTFQHI 57

Query: 61  Q-HNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMM 119
           +    L++V +    A + A ++ FL+ + ++L+ Y  + EE ++ D+F++ YELLD ++
Sbjct: 58  RTSGGLWMVVVVRGNADSAA-IWEFLYHMNKLLDAYAINTEE-ALLDDFMLCYELLDVVL 115

Query: 120 DYGIPQITETKMLKQYITQK--------------SFKLMKAVKKSKAAPRPPTEVTNSVS 165
           D G+PQ TE   +   +++K              S +L +   K+ +         +   
Sbjct: 116 DSGLPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCP 175

Query: 166 WRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGIND-K 224
           WR   I +KKNE +LD++E +++L+N+ G +L++ + G ++  + LSGMP    G ND +
Sbjct: 176 WRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDSQ 235

Query: 225 GIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFEL 284
            +  +       P      E   + ++ LED KFHQCV+L+KF+ E++I F+PPDG FEL
Sbjct: 236 SLRQRSPRRQYAPRVFGTDE---RESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFEL 292

Query: 285 MNYRLSMPVKPLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPS 344
           M Y +   ++P       V   ++  IE     ++    +  A  VE+ IP P    +  
Sbjct: 293 MKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAK 352

Query: 345 FKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSA-----QMGLPSINALDKPKVKRPVQI 399
              + G  K+VP++NAI+WKI  F G  E ++SA     + G  +   LD+   + P+ +
Sbjct: 353 VNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGHYA-QVLDQWP-RPPISM 410

Query: 400 KFQIPYFTTSGI 411
           K +I  F+T+ +
Sbjct: 411 KLEIMMFSTAAL 422

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  169 bits (428), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 128/488 (26%), Positives = 236/488 (48%), Gaps = 63/488 (12%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M++AV     +G  ++ + ++  +  +  D F    +Q+    ++  P L+     + FI
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFR---VQVINNDNIRSPILTLGSTTFHFI 57

Query: 61  Q---HNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           +    + L++VA+  S A + A ++ +L+KL  ++E Y     E+ ++D FI+ +ELLD 
Sbjct: 58  RTTAGSKLWLVAVTRSNADSGA-IWEYLYKLNSLMEVY-GLTHEDILKDEFIVCHELLDI 115

Query: 118 MMDY-GIPQITETKMLKQYITQKSFKLMKAVKK-------------------------SK 151
            +   G+P  TE   +   +T K  +++ +                            S+
Sbjct: 116 TLGMNGLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGHNSTPISMPKFLSR 175

Query: 152 AAPRPPTEVTNS------VSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQI 205
            + R  T+   S      + WR+ +I +KKNE  ++++E IN+L+ +   +LR+ + G I
Sbjct: 176 NSNRSVTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTI 235

Query: 206 KVKSKLSGMPDLKLGIND-----KGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQ 260
            + + LSGMP  ++G+ND      G  + +   D      A+ +      I LE  KFHQ
Sbjct: 236 DITAHLSGMPMCQIGMNDLSTIQGGENAHWTNEDRASNRDAMPDVSGDRVI-LEGSKFHQ 294

Query: 261 CVRLSKFENEKIITFIPPDGAFELMNYR----LSMPVKPLIWCDVNVQVHSQSRIEIHCR 316
           CV L K+  + +I FIPPDG FELM Y     L++P +  I   V +  H  + +    +
Sbjct: 295 CVALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFR--ITPQVTLTSHGTA-LSYAIK 351

Query: 317 ARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSM 376
            ++   ++  A +V + IPVP          + G  K++P++N ++W    F G  E  +
Sbjct: 352 LKSLFPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHRFNGSTENHL 411

Query: 377 SAQ------MGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPW 430
           +AQ      +   SI    +P    P+ + F++  F+ +G+ VRYLK+ E  + Y +  W
Sbjct: 412 NAQTVPTQSIASQSIKQWTRP----PMSLDFKVLMFSNTGLIVRYLKVQEKNMHYNTIKW 467

Query: 431 VRYITQSG 438
           ++YI+ +G
Sbjct: 468 IKYISAAG 475

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score =  164 bits (416), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 143/527 (27%), Positives = 233/527 (44%), Gaps = 112/527 (21%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQ--LEEESSVIPPCLSHDGIQYL 58
           M S     D    P++ R  R   PI  +D  A L LQ  L+       P    +G  Y 
Sbjct: 1   MSSCFLLLDETYEPLIRRALR---PIHFLDD-AILQLQNNLKHHKGCTKPIFEGNGWHYA 56

Query: 59  FIQHNDLYVVALATSLATNVA--QVFAFLHKLMEVLEEYLK-SVEEESVRDNFIIIYELL 115
            I  ++LY  A+   +  +V+   V  +L ++ ++  +++   + + +VRDNF +I+E++
Sbjct: 57  VITRDNLYF-AMIMQVNNSVSPISVLHYLDEIYQLCRKFMGMKLNKLNVRDNFHLIFEVI 115

Query: 116 DEMMDYGIPQITETKMLKQYITQKSFK-----LMKAVKKSKAAPRPPTE----------V 160
           +E  DYGI Q+T   ++  +I  +  K        A +K +  P    E          +
Sbjct: 116 EESSDYGIIQVTNYNIIHDFIKVEVIKPDDDSENTASEKHELPPGDQDETFINSYILRTM 175

Query: 161 TNSVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEII-GQIKVKSKLSGMPDLKL 219
           T++VSWR   I + KNE FLD++E +  +M+ +  V+R+ +I G I  +S LSGMP L +
Sbjct: 176 TSAVSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIICRSYLSGMPQLSI 235

Query: 220 GINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKF--ENEKIITFIP 277
           G+N   +  K V                     ++ LKFH+CV L     E   +I FIP
Sbjct: 236 GLNK--LMQKNVHF-------------------MKRLKFHECVDLHTLIKEESPVIKFIP 274

Query: 278 PDGAFELMNYRLSMPV--KPLIWCDV-------NVQVHSQSRIEIHCRARAQIKKRSIAN 328
           PDG FEL NY+L+ P+  +P+I                +Q ++ +        K +  A 
Sbjct: 275 PDGEFELCNYKLNRPLLDEPVIKLQSFGLSQKPRKNQETQDKLLLKAAITTHFKAQDSAK 334

Query: 329 SVEILIPVP--------DDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGG---KEYSMS 377
            + I IP+         D    P FK   G V +     +I+WKI +  GG   K Y + 
Sbjct: 335 ELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAGSIIWKINNLKGGHGNKNYGLK 394

Query: 378 AQ-----------MGLPSINALDKPKVKRP------------------------------ 396
                        + +   N++D P ++                                
Sbjct: 395 CMFEIWDRQIHEALEVQLRNSMDPPPLRTGPKLERIWDQYHGKTTEYDGNENQKEDVDKF 454

Query: 397 --VQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDY 441
             + + F+IPY+  SG++V Y KI EP+L Y+S+PWVRY T + ++Y
Sbjct: 455 ALIAMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRYKTVNDNEY 501

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score =  160 bits (405), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 153/552 (27%), Positives = 240/552 (43%), Gaps = 142/552 (25%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIP---PCLSHDGIQY 57
           M S ++  D    P++S+       I AI     +L   +  S   P   P +S     +
Sbjct: 1   MSSCIFITDENLEPLISKN------IKAIPNLQGILRLFK--SVYTPESQPVISASSFHF 52

Query: 58  LFIQHNDLYVVAL--ATSLATNVAQVFAFLHKLMEVLEEYL--KSVEEESVRDNFIIIYE 113
           + I+ + L  V++  A   + NV  +  FL +   +L++YL   ++++  V DN ++I E
Sbjct: 53  VHIKRSSLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNMVLDNVLLIME 112

Query: 114 LLDEMMDYGIPQITETKMLKQYITQKS--------------------------------- 140
           L+DE +D+G+ QIT+  +++ YI  K                                  
Sbjct: 113 LIDESIDFGVIQITDASIMRDYIRVKVNMPENKTIDDLSLGDSDTDEEDNKKTKRRSGKP 172

Query: 141 --FKLMKAVKKSK--------AAPRPPTEVT-NS---------VSWRAPNIVHKKNEAFL 180
             +K ++  K           AA     E + NS         VSWRA  I + +NE FL
Sbjct: 173 NLYKFLRGAKDGTHKAEHTDTAAKEDDVEDSYNSYIAKATIMPVSWRAKGIHYARNEFFL 232

Query: 181 DIVESINMLMNQQGQVLRSEII-GQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVT 239
           D+VE +  LM+    +++  +I G+I  KS LSGMP LK+       F+K  + D   ++
Sbjct: 233 DVVEQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIA------FNKLSQKDEQFIS 286

Query: 240 TAVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVK----- 294
            +               KFHQCV      NEK I FIPPDG F L  Y L   VK     
Sbjct: 287 HS---------------KFHQCVTWPS-SNEKEIEFIPPDGDFVLCQYELKRHVKDQPML 330

Query: 295 PLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPD-------DADTPS-FK 346
            L+   V  ++  + +I++ C      K R+  +++ + IP+         D   P+ FK
Sbjct: 331 KLVSFGVKPKL-KKYKIQMSCTIETHFKARNSTSTLNLKIPLARLFQEYQIDLKKPARFK 389

Query: 347 YTHGSVKWVPQKNAILWKIRSFTGGK---EYSMSAQMGL--------------PSIN--- 386
              G V +    + +LW I    GG    + SM+A+  L               S+N   
Sbjct: 390 SDSGKVLFNISDDFLLWDIEVMKGGHGDTQLSMAAEFSLFNKKEFEEEQEELKNSMNPPP 449

Query: 387 ALDKPKVK-----------------RPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYP 429
             D PK++                 R + +KF+IPY T SG+QV YLKI E +L Y+S+P
Sbjct: 450 LRDGPKLEELYDQVHNEKGPSKMASRLLSMKFEIPYSTCSGLQVEYLKIDEEQLQYQSFP 509

Query: 430 WVRYITQSGDDY 441
           WVRY T + ++Y
Sbjct: 510 WVRYKTVNDEEY 521

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score =  159 bits (402), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 129/492 (26%), Positives = 223/492 (45%), Gaps = 125/492 (25%)

Query: 48  PCLSHDGIQYLFIQHNDLYVVALATSLATNV--AQVFAFLHKLMEVLEEYL-KSVEEESV 104
           P L +    Y+FIQ + LY ++L+  L TNV    VF++L++L  + ++YL +++ +  +
Sbjct: 41  PILQNMDYDYIFIQRDGLYFLSLSYQL-TNVYPMVVFSYLNQLHMLFQKYLGENLNKVLI 99

Query: 105 RDNFIIIYELLDEMMDYGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTE----- 159
             NF +I+EL+DE +  G PQ+T+  +++ YI          V+  K +P P T      
Sbjct: 100 TGNFHLIHELIDESIFMGTPQLTDYNIIRDYI---------KVQVVKDSPEPATREATVT 150

Query: 160 --------------------------------VTNSVSWRAPNIVHKKNEAFLDIVESIN 187
                                            T+++SWR   I + KNE +LD++E + 
Sbjct: 151 NTKKNKKKDSKKKEEDTEATDENYMNSYIARTTTSAISWRPKGIHYNKNEFYLDVIEHLE 210

Query: 188 MLMNQQGQVLRSEII-GQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTTAVTEGK 246
            L++ Q   ++S  + G I+ +S LSGMP L +G+N     ++Y                
Sbjct: 211 YLVDFQCMNIKSNTVYGYIQCRSYLSGMPMLTIGLNKLNSENEYF--------------- 255

Query: 247 KKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLS--MPVKPLIW---CDV 301
                 +    FHQCV L +   +K+I+F PPDG F+L NY+L+  M   P+I    C V
Sbjct: 256 ------MRRANFHQCVNLDQLTTDKLISFTPPDGEFQLCNYKLTRNMSDPPMIKLEDCKV 309

Query: 302 NVQVHSQ----SRIEIHCRARAQIKKRSIANSVEILIPVP--------DDADTPSFKYTH 349
            ++         R+ +        K +   + + I +P+         D +  P FK   
Sbjct: 310 KLKPRKTKDGLDRLILAVTISTYFKLQDSTSLLNIKVPLSKVFRDWDVDLSYQPRFKCEQ 369

Query: 350 GSVKWVPQKNAILWKIRSFTGG---KEYSMSAQMGLPS-----------INALDKPKVKR 395
           G V +    + +LW++    GG   K   M ++  L +            N++D   ++R
Sbjct: 370 GKVMFNITDDYLLWEVGKVKGGHGDKTLKMQSEFHLHNREHEARIKQQLSNSMDPKPIRR 429

Query: 396 P----------------------VQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRY 433
                                  ++++F+IPY+T SG++V +LKI E +L ++S+PWVRY
Sbjct: 430 GPHLEKLYQQTHELNSPTSEAALLKVEFEIPYYTISGLKVEFLKIEEKQLQFQSFPWVRY 489

Query: 434 ITQSGDDYTIKL 445
            T + D Y  +L
Sbjct: 490 KTINHDIYAYQL 501

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  154 bits (389), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 115/423 (27%), Positives = 203/423 (47%), Gaps = 69/423 (16%)

Query: 65  LYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMM-DYGI 123
           L++VA+  S A N   ++ FL+KL  +L  Y  +  EE + + F++ YE++D M+    +
Sbjct: 65  LWIVAITRSNA-NSGVIWEFLYKLDSMLTAYDLN-NEEKLMEKFMVYYEMIDVMLTSNAM 122

Query: 124 PQITETKMLKQYITQKSFKLMKAV---------------------KKSKAAPRPPTEVTN 162
           P  TE   L    ++ S++L K +                     + S++  +  + +T 
Sbjct: 123 PINTE---LSSIASKISYRLPKTISNSPTNEKNNNNGLSIPKFLTRNSRSMSQEFSNITQ 179

Query: 163 S-VSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGI 221
           S + WR   I +KKNE FL + E IN+L+++   +L++ + G I + S LSG P  + G+
Sbjct: 180 SDIPWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLVSHLSGTPICQFGL 239

Query: 222 ND-----------KGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKFENE 270
           ND           +G   ++   D + ++T        +++++ED  FHQCV L KF +E
Sbjct: 240 NDYLSMTGNNISNRGDEFRHDFMDDEDLSTG---RSSSSSVKIEDCTFHQCVSLDKFNDE 296

Query: 271 KIITFIPPDGAFELMNYRLSMPVKPLIWCDVNVQVHSQSRIEI---HCRARAQIKKRSI- 326
           ++I F+PPDG+FELM Y         +  D+N+      R+ I    C  R +I  +S+ 
Sbjct: 297 RLINFVPPDGSFELMRYH--------VRDDLNIPFKVTPRVSISSSRCSMRYKIILKSLF 348

Query: 327 -----ANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSM----- 376
                A    + IP+P          + G   +    N  +WK   + G  E  +     
Sbjct: 349 PTSLSAADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKGLTENELILETV 408

Query: 377 -SAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYIT 435
            S+   + S+    +P    P+ + F+I  F+ SG+ V+YLK+ E    Y+   W++Y++
Sbjct: 409 PSSSTDILSLQQWTRP----PMSMNFEIIMFSNSGLVVKYLKVMERVQKYRPVKWIKYVS 464

Query: 436 QSG 438
           +SG
Sbjct: 465 KSG 467

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  152 bits (383), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 122/483 (25%), Positives = 230/483 (47%), Gaps = 60/483 (12%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M++AV     +G  I+S+ ++  +  S  D F    +Q+     V  P L+     + ++
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFR---VQVINSLDVRSPILTLGSTTFHYV 57

Query: 61  Q--HNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEM 118
           +     L+VV+++ +   N A  + FL+K   +L  Y +   EE +++ F++ +ELLD M
Sbjct: 58  RTPGEGLWVVSVSRN-NENSAATWEFLYKFATMLAAY-RLDSEEVLKEEFMLAWELLDTM 115

Query: 119 MDYG-IPQITETKMLKQYITQKSFKLMKAVK-KSKAAPRPPTEVTNSVSWRAPNIVH--- 173
           ++ G IP  T+   +   ++ K    M  V  ++ A  +  T  T +     P ++H   
Sbjct: 116 VEGGGIPSETDPHRIISAMSVK--PAMSPVDVRADARQQQTTTSTGAFGHAFPQLLHRAS 173

Query: 174 ------------------KKNEAFLDIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMP 215
                             K+NE  + + ESI++L+++ G +L++ + G I + +KL G  
Sbjct: 174 NPGGISILPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTTKLEGAA 233

Query: 216 DLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIE----------LEDLKFHQCVRLS 265
             + G+ND            DP+ +  T+G   TN+E          L D KFHQCV L 
Sbjct: 234 VCQFGLNDSLSTDNSSNSKWDPLRSKETQG---TNLEMKNAHVGTVLLRDCKFHQCVSLE 290

Query: 266 KFENEKIITFIPPDGAFELMNYR----LSMPVKPLIWCDVNVQVHSQSRIEIHCRARAQI 321
           +F+ ++II F PP+G  ELM Y     L++P K            +  R+ I    ++  
Sbjct: 291 RFDRDRIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPTANNETDYRVTI----KSLF 346

Query: 322 KKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMG 381
             +  A +V + IPVP          ++G+ K++P++NA++WK   + G  E  +SA + 
Sbjct: 347 PGKLSAKNVTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTENKLSA-IT 405

Query: 382 LPSINALD---KPKVKRPVQIKFQIPYFTTSGIQVRYLKITEP---KLLYKSYPWVRYIT 435
           +P+ +      +   + P+ + F+I  ++ +G+ VRY  + +       +K+  W++Y++
Sbjct: 406 VPTRDTTQLALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTKFKTVKWIKYVS 465

Query: 436 QSG 438
            SG
Sbjct: 466 HSG 468

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score =  148 bits (373), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 146/564 (25%), Positives = 237/564 (42%), Gaps = 150/564 (26%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M S ++  D    P++S+  +    ++ I +F    L  +E     PP  +     Y+FI
Sbjct: 1   MSSCLFILDESLEPLISKNVKSVRNLTGILEF--FKLNYKENG---PPVFTVLEWHYVFI 55

Query: 61  QHNDLYVVAL---ATSLATNVAQVFAFLHKLMEVLEEYLK--SVEEESVRDNFIIIYELL 115
           + + L+ +          TN+  +  +L +L  +L+ Y    S++   V DN ++I EL+
Sbjct: 56  KRDSLWFMTAIHETDDRITNLMALTFYLDQLYLLLKTYFNRSSLDRNIVLDNVLLIIELI 115

Query: 116 DEMMDYGIPQITETKMLKQ------------------------------YITQKS--FKL 143
           DE MD+GI Q+T+  ++K                               YI  K+   KL
Sbjct: 116 DESMDFGIVQLTDPSIIKDYIRVKVNSPITHLTSDDDSDTEEKHKGLSTYIPGKTDIVKL 175

Query: 144 MKAVKKSKAAPRPPTEVTN--------------------SVSWRAPNIVHKKNEAFLDIV 183
            K      A      E  N                     VSWR   I + KNE FLD++
Sbjct: 176 WKGQPAVTANEGKSNEQDNYDDDDDENFINSYIAKTTIMPVSWRTKGIYYAKNEFFLDVI 235

Query: 184 ESINMLMN-QQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTTAV 242
           E +  LM+   G++ ++ I G+IK K  LSGMP LK+ +N      K ++ D   ++ + 
Sbjct: 236 EKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALN------KLIKNDEQFISNS- 288

Query: 243 TEGKKKTNIELEDLKFHQCVRLSKFE------------NEKIITFIPPDGAFELMNYRLS 290
                         KFHQCV ++  +            + K I FIPPDG F L  Y L 
Sbjct: 289 --------------KFHQCVSINSLKREINNEEEENTYHGKEIEFIPPDGEFVLCKYELK 334

Query: 291 MPVK--PLIWCDVNVQVH---SQSRIEIHCRARAQIKKRSIANSVEILIPVP-------- 337
             V+  P+I    N+++     + +I+IH       KK++  + + I IP+         
Sbjct: 335 RHVRDVPVIKLS-NIEIKPKLKKYKIQIHVTIETHFKKQNSTSVLTIKIPLRMVFSQYKI 393

Query: 338 DDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGG-----------------KEYS----- 375
           D    P FK   G V +    + ++W++ S  GG                 +EY      
Sbjct: 394 DLTKQPRFKSDFGEVLFNISDDFLIWEVGSMKGGNGESKNNMVAEFFIFNQEEYDRLQEE 453

Query: 376 MSAQMGLPSI-----------------NALDKPKV-KRPVQIKFQIPYFTTSGIQVRYLK 417
           M   M  P +                 +  DK  + ++ + +KF++PY T SG++V YLK
Sbjct: 454 MKTSMNPPPLREGPKLEEIYEQTHDNRDEHDKNGISQQLLTMKFEVPYSTCSGLKVEYLK 513

Query: 418 ITEPKLLYKSYPWVRYITQSGDDY 441
           I E ++ Y+S+PWVRY T + D+Y
Sbjct: 514 IEENQVNYQSFPWVRYKTINDDEY 537

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score =  134 bits (338), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 110/358 (30%), Positives = 164/358 (45%), Gaps = 95/358 (26%)

Query: 160 VTNSVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEII-GQIKVKSKLSGMPDLK 218
            T +VSWR   I + KNE FLD+VES+  LMN + +V+R  +I GQIK KS LSGMP L+
Sbjct: 221 TTMAVSWRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLR 280

Query: 219 LGINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLS------------- 265
           + +N      K ++ D   +  A               KFHQCV L+             
Sbjct: 281 IALN------KILQDDKQFLGHA---------------KFHQCVSLNSINIKDLEKDLEG 319

Query: 266 -------KFENEKIITFIPPDGAFELMNYRLSMPVK--PLI-WCDVNVQVH-SQSRIEIH 314
                   F N+K I FIPPDG F L  Y L   VK  P+I     +++ +  + R++I 
Sbjct: 320 PNDISNKNFVNKKEIEFIPPDGEFVLCQYELRRHVKDPPVINMTSFDIKPNFKKFRVQIS 379

Query: 315 CRARAQIKKRSIANSVEILIPVP--------DDADTPSFKYTHGSVKWVPQKNAILWKIR 366
            +     K+++  + + I IP+         D +  P FK   G V +   ++ ++W+I 
Sbjct: 380 LKIETHFKRQNSTSLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNISEDFLIWEID 439

Query: 367 SFTGG---KEYSMSAQMGLPSINALDK-----------------PKVK------------ 394
           +  GG    E  M A+  L +    D+                 PK++            
Sbjct: 440 ALKGGHGENEKGMVAEFFLFNQEEYDRLQEEAKISMNPPPLRNGPKLEELYEEMHENEDA 499

Query: 395 ---------RPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDYTI 443
                    + V ++F+IPY T SG++V YLKI E  L Y+S+PWVRY T + D+Y  
Sbjct: 500 EDTALKMKTQYVFMQFEIPYSTCSGLKVEYLKIEEDLLKYQSFPWVRYKTLNDDEYAF 557

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 76/146 (52%), Gaps = 14/146 (9%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEES--SVIPPCLSHDGIQYL 58
           M S ++  D    P++S+  +   P+  +    P +++  +ES     PP ++     Y+
Sbjct: 1   MSSCLFILDELLEPLISKNTK---PVRNL----PDIIKSFKESWTPTSPPIITVSNWHYV 53

Query: 59  FIQHNDLYVVALATSL---ATNVAQVFAFLHKLMEVLEEYLKS--VEEESVRDNFIIIYE 113
           +++ + L+ VA    +     N+  +  +L +L  +L+ Y K   + +  + DN +++ E
Sbjct: 54  YVKRDALWFVAAIHYMDEKCMNLMMILFYLDQLYYLLKNYFKKELLTKLLIIDNALLVTE 113

Query: 114 LLDEMMDYGIPQITETKMLKQYITQK 139
           L+DE +D+GI Q+T+  +++ YI  K
Sbjct: 114 LMDESIDFGIIQMTDPSIIRDYIRVK 139

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  130 bits (326), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 114/465 (24%), Positives = 218/465 (46%), Gaps = 70/465 (15%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M+SA+     +G  I+S+ YR++I  S  + F    +Q+    +V  P L+     +  I
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFR---IQVINNFNVRSPILTLGSTTFHHI 57

Query: 61  QH-------NDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYE 113
           +        ++L++V +  + A N A ++ FL KL  +L++Y     E  ++D F+ ++E
Sbjct: 58  RSTANDPTDDELWLVCVNRNNA-NSAAIWEFLQKLNLILQQY-GITSESKLKDEFMTVHE 115

Query: 114 LLDEMM-DYGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSV-SWRAPNI 171
           +LD M+   GI Q T+   LK  + + S K +    ++ +      +  N++ +    N 
Sbjct: 116 ILDNMLLGTGIIQNTD---LKSIVDKMSVKPISRTNETTSTQTGFLKRRNTILTTPGANF 172

Query: 172 ---------VHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGIN 222
                     HKKNE F  + ES+N+L+++ G +L++ + G+I++KS L+G P  +  + 
Sbjct: 173 SLIPTNRHDAHKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSHLNGNPTCQFELV 232

Query: 223 DKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAF 282
           D          D   +T               D KF QC+   +    + +     DG  
Sbjct: 233 D----------DQTKIT---------------DFKFDQCIEKVQ---SRTVRVAATDGEL 264

Query: 283 ELMNY-----RLSMPVK--PLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIP 335
           E++NY     ++++P K  P++          +  ++     ++   K   A  V + IP
Sbjct: 265 EIVNYHVRDDKINIPFKITPIVST-------VKDTVDYRISLKSLFPKNLSATDVVLTIP 317

Query: 336 VPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKR 395
           VP +        ++G  K+  ++NA++W    F G  E ++SA         ++     R
Sbjct: 318 VPPNTIDCKINVSNGHCKFKAEQNAVIWTFNKFNGSTENTLSAITIADGRQIMNLESWTR 377

Query: 396 P-VQIKFQIPYFTTSGIQVRYLKITEP-KLLYKSYPWVRYITQSG 438
           P +Q+ F+I  ++ SG+ +R L IT+  K  YK+  W++YI+++G
Sbjct: 378 PSIQLTFEITMYSISGLLLRNLMITDKDKRRYKASRWIKYISRAG 422

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score =  128 bits (322), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 104/338 (30%), Positives = 155/338 (45%), Gaps = 78/338 (23%)

Query: 160 VTNSVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEII-GQIKVKSKLSGMPDLK 218
            T  VSWRA  I + KNE FLD+VE +  L + + +V+R  +I G+I  KS LSGMP LK
Sbjct: 232 TTMPVSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLK 291

Query: 219 LGINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPP 278
           + +N      K ++ D+  ++ +               KFHQCV L    NEK + FIPP
Sbjct: 292 IALN------KLLQRDAQFMSHS---------------KFHQCVALETL-NEKELEFIPP 329

Query: 279 DGAFELMNYRL-----SMPVKPLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEIL 333
           DG F L  Y L       P+  +   ++  Q+  + ++ I        K R+  + + + 
Sbjct: 330 DGEFILCEYELKRHVNDTPILKITSFEIKPQL-KKFKLRILLTIETHFKTRNSTSILNVK 388

Query: 334 IPVPD-------DADTPS-FKYTHGSVKWVPQKNAILWKIRSFTGGK---EYSMSAQMGL 382
           IP+         D   P+ FK   G V +    + +LW+I    GG    ++SM A+  L
Sbjct: 389 IPLAKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMVAEFSL 448

Query: 383 -------------------------PSINAL-------DKPKV------KRPVQIKFQIP 404
                                    P +  L         P+V       + V + F+IP
Sbjct: 449 FNKEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQSQLVGMDFEIP 508

Query: 405 YFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDYT 442
           Y T SG++V YLKI E +L Y+S+PWVRY T S ++Y 
Sbjct: 509 YTTCSGLKVEYLKIEEEQLQYQSFPWVRYKTISDEEYA 546

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score =  121 bits (304), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 94/339 (27%), Positives = 149/339 (43%), Gaps = 82/339 (24%)

Query: 163 SVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEII-GQIKVKSKLSGMPDLKLGI 221
           SVSWRA  I + KNE FLD++E +   M+    +++  +I G+I  KS LSGMP LK+ +
Sbjct: 222 SVSWRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSL 281

Query: 222 NDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGA 281
           N      K +  D   +++                KFHQCV     +  K++ F+PPDG 
Sbjct: 282 N------KIIYQDKQFLSSC---------------KFHQCVMPDSVDEGKVLEFVPPDGD 320

Query: 282 FELMNYRL-----SMPVKPLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPV 336
           F L  Y L      +P+  LI  +V  ++  + ++++     +  KK +    + I IP+
Sbjct: 321 FVLCKYELKRHVNDLPLLKLISYEVKPKL-DKYKLKLFVTIESTFKKTNSTTKLNIKIPL 379

Query: 337 P--------DDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGK-EYSMSAQMGL----- 382
                    D +     +   G + +    + +LW+I +  GG  +  M A   L     
Sbjct: 380 KVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKGGNSQLKMGADFALFNEEE 439

Query: 383 --------------------PSINAL-------------------DKPKVKRPVQIKFQI 403
                               P +  L                   D+ K    +++ F+I
Sbjct: 440 YLRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTRKGESSDETK-GNLIKMDFEI 498

Query: 404 PYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDYT 442
           PY T+SG++V YLKI EP L Y+++PWVRY T S D Y 
Sbjct: 499 PYNTSSGLKVEYLKIEEPNLQYQAFPWVRYKTISDDGYA 537

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 72/142 (50%), Gaps = 14/142 (9%)

Query: 1   MVSAVYFCDGKGRPILSRRYRD----DIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQ 56
           M S +Y  +     +LS+  +     DIP+S   K      Q  +     P  +  D I 
Sbjct: 1   MSSILYILNEDLESLLSKSIKALESPDIPLSLFKK------QFHKHQVTTPVIIYEDYI- 53

Query: 57  YLFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYL--KSVEEESVRDNFIIIYEL 114
           +  IQ + LY V+ +    TN+ +   +L++   +L+ Y   K +++  + DN + I EL
Sbjct: 54  FTCIQRDTLYFVS-SIDCKTNILETLHYLNEFYILLKNYFNVKQLDKNIIMDNLVPILEL 112

Query: 115 LDEMMDYGIPQITETKMLKQYI 136
           ++E +D+GI QIT++ ++K YI
Sbjct: 113 IEESVDFGIIQITDSNLMKDYI 134

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score =  120 bits (301), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 102/359 (28%), Positives = 155/359 (43%), Gaps = 101/359 (28%)

Query: 164 VSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEII-GQIKVKSKLSGMPDLKLGIN 222
           +SWR   I + KNE FLD++E +   M+ +  V+R  +I G+I  +S LSGMP LK+ IN
Sbjct: 250 ISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN 309

Query: 223 DKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRL---------------SKF 267
              I  + V+                    L ++KFHQCV L                K 
Sbjct: 310 --KILKQDVQF-------------------LSNVKFHQCVSLDSIRARSNPPAVEEDGKK 348

Query: 268 ENEKI--------ITFIPPDGAFELMNYRLSMPVK--PLIWC---DVNVQVHSQSRIEIH 314
           +NE+         I FIPPDG F L  Y L   VK  P+I     ++  ++H + +I+IH
Sbjct: 349 KNEEADTLGNKGEIEFIPPDGEFLLCKYELKRHVKDQPMIKLRNFEIIPKLH-KFKIKIH 407

Query: 315 CRARAQIKKRSIANSVEILIPVP--------DDADTPSFKYTHGSVKWVPQKNAILWKIR 366
                  K  +  + + + IP+         D +  P FK   G+V +      +LW++ 
Sbjct: 408 VIIETHFKTTNSTSKLNLRIPITNLFQSYRIDLSKQPKFKCEQGTVLFNLSDKFLLWEVG 467

Query: 367 SFTGG---KEYSMSAQMGL-------------------------PSINAL---------- 388
           +  GG      SM A+  L                         P +  L          
Sbjct: 468 TMNGGHGENTLSMMAEFALFNEEEYKKMEEERKTSMNPPPLREGPKLEELYKKIHEEGDS 527

Query: 389 ----DKPKVKRPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDYTI 443
                + K +  + + F++PY T SG+++ YLKI E +L Y+S+PWVRY T S D+Y  
Sbjct: 528 DEVSTRKKNESLLTMDFEVPYCTCSGLKIEYLKIEEDQLQYQSFPWVRYKTISDDEYAF 586

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 79/145 (54%), Gaps = 11/145 (7%)

Query: 1   MVSAVYFCDGKGRPILSRRYRD--DIPISAIDKFAPLLLQLEEESSVIP-PCLSHDGIQY 57
           M S+++  D    PI+ +  R   ++P S + KF     +L   + V P P L+    Q+
Sbjct: 1   MSSSIFILDETLEPIICKNIRALPNLP-SLVTKFQ----ELYRSNGVSPLPILNDIDWQF 55

Query: 58  LFIQHNDL-YVVALATSLATNVAQVFAFLHKLMEVLEEYLKS--VEEESVRDNFIIIYEL 114
           L I+ + L ++  +  +   N+  VF +L +  ++L++YL    +    + DNF+++ EL
Sbjct: 56  LHIKRDSLVFLSVVENNSRCNLLGVFTYLEEFYKLLKDYLHVGILNRNLLIDNFLVVIEL 115

Query: 115 LDEMMDYGIPQITETKMLKQYITQK 139
           +DE +D+G+ Q T++ ++K Y+  K
Sbjct: 116 IDESLDFGVVQFTDSSLIKDYVRVK 140

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score =  118 bits (296), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 96/348 (27%), Positives = 151/348 (43%), Gaps = 91/348 (26%)

Query: 164 VSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEII-GQIKVKSKLSGMPDLKLGIN 222
           +SWR   I + KNE FL+++E +   M+    V++  +I G+I+ K  LSGMP+LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSIN 312

Query: 223 DKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKFE--NEKIITFIPPDG 280
                              V E K+     L + KFHQCV L+  E  + K + F+PPDG
Sbjct: 313 -----------------KIVNEDKQF----LANCKFHQCVSLASLESSDHKDVEFVPPDG 351

Query: 281 AFELMNYRLSMPVK--PLIWCDVNVQVH---------SQSRIEIHCRARAQIKKRSIANS 329
            F L  Y L   V+  P++   VN +V              IE H +      K ++   
Sbjct: 352 EFTLCRYELKRHVRDEPMVKL-VNFEVKPKLKKFKLKLLLTIETHFKTTNATSKLALRVP 410

Query: 330 VEILIPV--PDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGG---------------- 371
           ++ L      D +     K   G++ +    + +LW++ S +GG                
Sbjct: 411 IKQLFREYRVDLSKNLKSKCDRGAILFNISDDFLLWEVGSMSGGHGETQLSMGVEFALFN 470

Query: 372 -KEYSMSAQMGLPSIN---ALDKPK---------------------------------VK 394
            +EY    +M   S+N     + PK                                 + 
Sbjct: 471 QEEYDREQEMLKTSMNPPPLREGPKLEELYKQIHEDDDDDDGNTEPVAEHRLQPRTREID 530

Query: 395 RPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDYT 442
           + + + F++PY T+SG++V YLKI EP+L Y+S+PWVRY T S  +Y 
Sbjct: 531 KLLTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFPWVRYTTLSDAEYA 578

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 71/146 (48%), Gaps = 16/146 (10%)

Query: 1   MVSAVYFCDGKGRPILSRRYRD----DIPISAIDKFAPLLLQLEEESSVIPPCLS-HDGI 55
           M S +Y  D     ++S+  +     + PI+   K            S  PP +  HD  
Sbjct: 1   MSSVLYILDENLETLISKNIKAVPSLEYPIAQFKKLY---------GSNAPPVIDYHDLF 51

Query: 56  QYLFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYL--KSVEEESVRDNFIIIYE 113
            + +IQ + L  V++   + T + +   +L    EVL+ YL  K +++  V DN ++I E
Sbjct: 52  TFTYIQRDSLLFVSVVDRVDTGLVETLVYLEHFYEVLKNYLGVKVLDKNIVTDNSVLISE 111

Query: 114 LLDEMMDYGIPQITETKMLKQYITQK 139
           L++E +D+G  Q+T++ +L  YI  K
Sbjct: 112 LIEETIDFGAIQVTDSGLLADYIKMK 137

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score =  118 bits (296), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 102/368 (27%), Positives = 156/368 (42%), Gaps = 110/368 (29%)

Query: 164 VSWRAPNIVHKKNEAFLDIVESINMLMN-QQGQVLRSEIIGQIKVKSKLSGMPDLKLGIN 222
           VSWRA  I + KNE FLD++E +  L++ + G V RS I GQI  +S LSGMP LK+ +N
Sbjct: 249 VSWRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN 308

Query: 223 DKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKFEN------------- 269
                 K ++ D   ++                ++FHQCV L   E              
Sbjct: 309 ------KLLQNDKQFISQ---------------VQFHQCVSLDSIEKVIKYAEEHSDELK 347

Query: 270 ---------EKIITFIPPDGAFELMNYRLSMPVK--PLI-WCDVNVQVH-SQSRIEIHCR 316
                    E  I FIPPDG F L +Y L   ++  P++  C   +     + +++I   
Sbjct: 348 TLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFEITPKWKKYKLKISAA 407

Query: 317 ARAQIKKRSIANSVEILIPVPD-------DADTP-SFKYTHGSVKWVPQKNAILWKIRSF 368
                K  +  + +++ IP+         D   P  FK ++G V +    + +LW+I   
Sbjct: 408 VETHFKPTNSTSKLDVKIPISKVFKDYQIDLKKPIKFKTSNGRVVYNISDDFLLWEIGVI 467

Query: 369 TGGKEY-------------SMSAQMGL-------------------------PSINAL-- 388
            GGK +             +M+A+ GL                         P +  +  
Sbjct: 468 KGGKMHGSKEDISKFDNVATMAAEFGLFNEEEYERERKERETSMNPPPLRTGPKLEDIYK 527

Query: 389 -------------DKPKVK-RPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYI 434
                         KPK     + + F+IPY T SG++V YLKI E +L Y+S+PWVRY 
Sbjct: 528 ETHEENDGYNSVGQKPKNNLNLLSMDFEIPYCTCSGLKVEYLKIDEDQLQYQSFPWVRYK 587

Query: 435 TQSGDDYT 442
           T + D+Y 
Sbjct: 588 TINDDEYA 595

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 74/141 (52%), Gaps = 10/141 (7%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M S++Y  D    P++S+  +    +  +++   L      +S    P +     ++++I
Sbjct: 1   MSSSIYIFDETLEPLVSKSVKG---LPNVNELGDLFRYHVRQSQ--NPIIDVYNWRFVYI 55

Query: 61  QHNDLYVVALATSLATNVAQVFA---FLHKLMEVLEEYL--KSVEEESVRDNFIIIYELL 115
           + + LY VA+  +    +A   A   +L +L ++  +Y+  K ++   V DN +++ EL+
Sbjct: 56  KRDTLYFVAVVDAADDAIANYLAILTYLEQLYQLFRDYVGVKVLDRNLVLDNTLLVMELI 115

Query: 116 DEMMDYGIPQITETKMLKQYI 136
           DE +DYGI Q+TE  ++K YI
Sbjct: 116 DETLDYGIVQLTEPSIMKDYI 136

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  117 bits (292), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 99/362 (27%), Positives = 156/362 (43%), Gaps = 104/362 (28%)

Query: 164 VSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEII-GQIKVKSKLSGMPDLKLGIN 222
           +SWR   I + KNE FLD++E +  LM+ +  ++R  +I G+I  +S LSGMP LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISIN 312

Query: 223 DKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKFE-------------- 268
                 K +  D   ++ +                FHQCV L                  
Sbjct: 313 ------KILNRDPQFMSNS---------------NFHQCVSLDSINTIEKGQEKEQNTGD 351

Query: 269 -----NEKIITFIPPDGAFELMNYRLSMPVK--PLIWC-DVNVQVH-SQSRIEIHCRARA 319
                + + I F+PPDG F L  Y L   VK  P+I   D  ++    +S+I+I  + + 
Sbjct: 352 SQAAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKPKLKKSKIQILTKIQT 411

Query: 320 QIKKRSIANSVEILIPVP--------DDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGG 371
             K  +  + + + IP+         D +    FK  +G V +    + +LW+I++  G 
Sbjct: 412 NFKPTNSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVFNLSDDFLLWEIQTMKGH 471

Query: 372 KE----------------YSMSAQMGLPSINALDK-----------------PKVK---- 394
           +E                 SM A+  L +    D+                 PK++    
Sbjct: 472 RERNASNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQEEMKTSMNPPPLRTGPKLEELYN 531

Query: 395 --------------RPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDD 440
                         R V I F+IPY T SG++V YLK+ EP+L Y+S+PWVRY T + ++
Sbjct: 532 QVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYKTVNDEE 591

Query: 441 YT 442
           Y 
Sbjct: 592 YA 593

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 78/144 (54%), Gaps = 10/144 (6%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M S+++  D    P++S+  R    +S++        Q   + S  PP L  +   ++ +
Sbjct: 1   MSSSLFILDEDLEPVVSKNIRALPNLSSV---LSSFKQCYHDGS--PPILFQNDWFFIHL 55

Query: 61  QHNDLYVVALATSL---ATNVAQVFAFLHKLMEVLEEY--LKSVEEESVRDNFIIIYELL 115
           + + L++V++  +      ++  + AFL +   +L++Y  +K + ++ + DN +++ EL+
Sbjct: 56  KRDFLHLVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIKVLSKDLILDNVLLVLELM 115

Query: 116 DEMMDYGIPQITETKMLKQYITQK 139
           DE +D+GI Q+T+  ++K YI  K
Sbjct: 116 DECIDFGIVQVTDPSIIKDYIRVK 139

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score =  115 bits (288), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 96/362 (26%), Positives = 156/362 (43%), Gaps = 104/362 (28%)

Query: 164 VSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEII-GQIKVKSKLSGMPDLKLGIN 222
           +SWR   I + KNE FLD++E +  LM+ +  ++R  +I G+I  +  LSGMP LK+ IN
Sbjct: 260 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 319

Query: 223 DKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKFE-------------- 268
                 K +  D+  ++ +                FHQCV L   +              
Sbjct: 320 ------KILNRDAQFLSNS---------------SFHQCVSLDSIKTIEKREEKEDDDTG 358

Query: 269 -----NEKIITFIPPDGAFELMNYRLSMPVK--PLIWC-DVNVQVH-SQSRIEIHCRARA 319
                + K + F+PPDG F L  Y L   VK  P+I   D  ++    + +I+I  + + 
Sbjct: 359 LQAAADAKELEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKPKLKKFKIQIETKIQT 418

Query: 320 QIKKRSIANSVEILIPVP--------DDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGG 371
             K  +  + + + IP+         D +    FK   G V +    + +LW+I++  G 
Sbjct: 419 NFKPTNSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWEIQAMKGH 478

Query: 372 KEY----------------SMSAQMGLPSINALDK-----------------PKVK---- 394
           +E+                SM A+  L +    D+                 P+++    
Sbjct: 479 REHNTNKTSQDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPPPLRTGPRLEELYR 538

Query: 395 --------------RPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDD 440
                         + V I F+IPY T SG+++ YLK+ EP+L Y+S+PWVRY T S D+
Sbjct: 539 QVHDQQIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWVRYKTTSDDE 598

Query: 441 YT 442
           Y 
Sbjct: 599 YA 600

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 59/98 (60%), Gaps = 5/98 (5%)

Query: 47  PPCLSHDGIQYLFIQHNDLYVVALATSL---ATNVAQVFAFLHKLMEVLEEY--LKSVEE 101
           PP LS +   ++ ++ + L+ V++  +      ++  + AFL +   +L+EY  +K + +
Sbjct: 42  PPILSQNDWFFIHLKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQEYFEIKVLTK 101

Query: 102 ESVRDNFIIIYELLDEMMDYGIPQITETKMLKQYITQK 139
           + + DN +++ EL+DE +D+GI Q+T+  ++K YI  K
Sbjct: 102 DVILDNVLLVLELMDECIDFGIVQVTDPSIIKDYIRVK 139

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  111 bits (277), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 99/364 (27%), Positives = 154/364 (42%), Gaps = 107/364 (29%)

Query: 164 VSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEII-GQIKVKSKLSGMPDLKLGIN 222
           +SWR   I + KNE FLD++E +  LM+ +  ++R  +I G+I  +  LSGMP LK+ IN
Sbjct: 252 ISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 311

Query: 223 DKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKFE-------------- 268
                 K +  D   ++ +               KFHQCV L                  
Sbjct: 312 ------KLLNRDPQFMSNS---------------KFHQCVSLDSINIIEEEGRDTDDAGS 350

Query: 269 ----NEKIITFIPPDGAFELMNYRLSMPVK--PLI---WCDVNVQVHSQSRIEIHCRARA 319
               + K I FIPPDG F L  Y L   VK  P+I     ++  ++  + +I+I  + + 
Sbjct: 351 QTATDTKEIEFIPPDGEFVLCQYELKRHVKDAPMIKLQGFEIKPKL-KKFKIQIITKIQT 409

Query: 320 QIKKRSIANSVEILIPVP--------DDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGG 371
             K  +  + + + IP+         D +    FK   G V +    + +LW+I +  G 
Sbjct: 410 NFKPTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANLGKVVFNLSDDFLLWEIGTMKGH 469

Query: 372 KE---------------YSMSAQMGLPSINALDK-----------------PKVK----- 394
           +E                SM A+  L +    D+                 PK++     
Sbjct: 470 RERNTGTVPQEDDASTLASMVAEFPLFNQEEYDRLQEELKTSMNPPPLRTGPKLEELYKQ 529

Query: 395 ----------------RPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSG 438
                           + V + F+IPY T SG++V YLK+ EP+L Y+S+PWVRY T S 
Sbjct: 530 VHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYKTISD 589

Query: 439 DDYT 442
           D+Y 
Sbjct: 590 DEYA 593

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 77/145 (53%), Gaps = 12/145 (8%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEE-ESSVIPPCLSHDGIQYLF 59
           M S+++  D    P++S+  R      AI   + +L   ++      PP LS +G  ++ 
Sbjct: 1   MSSSLFILDEDLEPLVSKNIR------AIPNLSSILSSFKQCYHRDSPPILSQNGWFFIH 54

Query: 60  IQHNDLYVVALATSL---ATNVAQVFAFLHKLMEVLEEY--LKSVEEESVRDNFIIIYEL 114
           ++ + L+ +++  +      ++  + AFL +   +L++Y  +  + +  + DN +++ EL
Sbjct: 55  LKRDFLHFISVIHATDKPNIDLMSILAFLEQFYHLLKKYFEINVLSKNIILDNVLLVLEL 114

Query: 115 LDEMMDYGIPQITETKMLKQYITQK 139
           +DE +D+GI Q+T+  ++K YI  K
Sbjct: 115 VDECIDFGIVQVTDPSIIKDYIRVK 139

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score =  110 bits (275), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 97/366 (26%), Positives = 154/366 (42%), Gaps = 108/366 (29%)

Query: 164 VSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEII-GQIKVKSKLSGMPDLKLGIN 222
           +SWR   I + KNE FLD++E +  LM+ +  V+R  +I G+I  +  LSGMP LK+ IN
Sbjct: 258 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISIN 317

Query: 223 DKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKFE-------------- 268
                 K +  D   ++ +                FHQCV L                  
Sbjct: 318 ------KILNRDPQFMSNS---------------SFHQCVSLDSINTIEKDEEKNSDDDA 356

Query: 269 ------NEKIITFIPPDGAFELMNYRLSMPVK--PLIWC-DVNVQVH-SQSRIEIHCRAR 318
                 + + I FIPPDG F L  Y L   VK  P++   D  ++    + +I+I  + +
Sbjct: 357 GLQAATDAREIEFIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKPKLKKFKIQIVTKIQ 416

Query: 319 AQIKKRSIANSVEILIPVP--------DDADTPSFKYTHGSVKWVPQKNAILWKIRSFTG 370
              K  +  + + + IP+         D +    FK   G V +    + +LW+I++  G
Sbjct: 417 TNFKPTNSTSKLNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSDDFLLWEIQTMKG 476

Query: 371 GKEY-------------------SMSAQMGLPSINALDK-----------------PKVK 394
            +E+                   SM A+  L +    D+                 P+++
Sbjct: 477 HREHSTNKSSQYNSDEDDPNTCASMVAEFPLFNQEEYDRLQEEMKTSMNPPPLRTGPRLE 536

Query: 395 ------------------RPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQ 436
                             + V I F+IPY T SG++V YLK+ EP+L Y+S+PWVRY T 
Sbjct: 537 ELYRQVHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYKTV 596

Query: 437 SGDDYT 442
           S ++Y 
Sbjct: 597 SDEEYA 602

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 77/144 (53%), Gaps = 10/144 (6%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M S+++  D    P++S+  R    +S++        Q   + S  PP LS +   ++ +
Sbjct: 1   MSSSLFILDENLEPLVSKNIRALPNLSSV---LSSFKQCYHDGS--PPILSQNDWFFIHL 55

Query: 61  QHNDLYVVALATSL---ATNVAQVFAFLHKLMEVLEEY--LKSVEEESVRDNFIIIYELL 115
           + + L+ V++  +      ++  + AFL +   +L++Y  ++ + +  + DN +++ EL+
Sbjct: 56  KRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIEVLTKNVILDNILLVLELI 115

Query: 116 DEMMDYGIPQITETKMLKQYITQK 139
           DE +D+GI Q+T+  ++K YI  K
Sbjct: 116 DECIDFGIVQVTDPSIIKDYIRVK 139

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/229 (30%), Positives = 109/229 (47%), Gaps = 37/229 (16%)

Query: 164 VSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEII-GQIKVKSKLSGMPDLKLGIN 222
           +SWR   I + KNE FLD++E    +M+ +  ++R  +I G+I  +  LSGMP LK+ +N
Sbjct: 287 ISWRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN 346

Query: 223 DKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAF 282
                 K ++ D                  L  L+FHQCV L   +N K I FIPPDG F
Sbjct: 347 ------KLLQKDQQF---------------LSQLRFHQCVSLETIQN-KEIEFIPPDGEF 384

Query: 283 ELMNYRLSMPVK-----PLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVP 337
            L  Y L   VK      LI  ++  ++  + +I+I+       K ++  + + + IP+ 
Sbjct: 385 ILCEYELKRHVKDPPNIKLISFEIKPKL-KKFKIQINLSITTFFKVQNSTSILNLKIPLE 443

Query: 338 --------DDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSA 378
                   D   +P FK   G VK+    + +LW+I S  GG   ++ A
Sbjct: 444 KLFNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKGGHGENIKA 492

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 34/45 (75%)

Query: 397 VQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDY 441
           + + F+IPY+  SG++V YLKI E +LLY+S+PWVRY T +  DY
Sbjct: 609 LTVDFEIPYYACSGLKVEYLKIEEEQLLYQSFPWVRYKTTNDKDY 653

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 69/143 (48%), Gaps = 7/143 (4%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           M+S ++  D    P++S+  R    I        L  +    ++   P +S +   ++ I
Sbjct: 1   MLSCIFILDENLEPLISKNIR---AIPNFKSIVELFRKHRSTNTTELPIVSINDWNFIQI 57

Query: 61  QHNDLYVVALAT--SLATNVAQVFAFLHKLMEVLEEYLKS--VEEESVRDNFIIIYELLD 116
           + + L  +         +++  +  +L K   +L+ +LK+  +    + DN ++I EL+D
Sbjct: 58  KRDSLIFLGAININDYMSDLMSMSIYLDKFYYLLKMHLKTDTLNRNIILDNILLIMELID 117

Query: 117 EMMDYGIPQITETKMLKQYITQK 139
           E +D+GI Q+T+  ++K Y+  K
Sbjct: 118 ESIDFGIIQMTDPNIIKDYVRVK 140

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/263 (29%), Positives = 112/263 (42%), Gaps = 62/263 (23%)

Query: 164 VSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEII-GQIKVKSKLSGMPDLKLGIN 222
           +SWR   I + KNE FLD++E +   M+ +  ++R  +I G+I  K  LSGMP LK+ IN
Sbjct: 295 ISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN 354

Query: 223 DKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKF--------------- 267
                 K ++ DS  ++ A                FHQCV L                  
Sbjct: 355 ------KILQNDSQFLSNA---------------HFHQCVSLDSLHLQSAEDDDGDDNAN 393

Query: 268 --ENE--------KIITFIPPDGAFELMNYRL-----SMPVKPLIWCDVNVQVHSQSRIE 312
             ENE        K I FIPPDG F L  Y L      +PV  L   D+  ++ S+ +++
Sbjct: 394 VNENENHDERDRKKEIEFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIKPKL-SKYKLK 452

Query: 313 IHCRARAQIKKRSIANSVEILIPVP--------DDADTPSFKYTHGSVKWVPQKNAILWK 364
           IH       K  +  + + + IP+         D +    FK   G V +    N ++W+
Sbjct: 453 IHVIIETHFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFNLSDNFLIWE 512

Query: 365 IRSFTGGK-EYSMSAQMGLPSIN 386
           I S  GG  E +MS     P  N
Sbjct: 513 IGSMKGGHGEVTMSMMAEFPIFN 535

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 37/46 (80%)

Query: 397 VQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDYT 442
           ++I F+IPY+T SG+++ YLKI EP+L Y+S+PWVRY T S ++Y 
Sbjct: 624 LKIDFEIPYYTCSGLKIEYLKIEEPQLQYQSFPWVRYKTISDEEYA 669

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 84/169 (49%), Gaps = 36/169 (21%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEE-------------ESSVIP 47
           M S ++  D    PIL++  R      +I     LLL+ +E             +S V+P
Sbjct: 1   MSSCIFILDENLEPILNKNIR------SIGNNFELLLKFQEIYRKQQNEIHNNDDSKVLP 54

Query: 48  PCLSHD--------------GIQYLFIQHNDLYVVALATSLATN-VAQVFAFLHKLMEVL 92
              ++D              G Q+L I+ + L  V++  + + N +  +F++L +  ++L
Sbjct: 55  ILNTNDYGMSNSTNGGGGNCGWQFLHIKRDSLIFVSIIENNSMNSLMIIFSYLEEFYKLL 114

Query: 93  EEYLK--SVEEESVRDNFIIIYELLDEMMDYGIPQITETKMLKQYITQK 139
           + YL    +++  + DNF+++ ELLDE +D+GI Q T++ ++K YI  K
Sbjct: 115 KSYLNVTKLDKGLLIDNFLLVMELLDESLDFGIVQFTDSSLIKDYIRVK 163

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/269 (24%), Positives = 119/269 (44%), Gaps = 67/269 (24%)

Query: 63  NDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEES------VRDNFIIIYELLD 116
           N LY   L +    +  Q++ F+  +ME LE+ L +  E+       + +N+  I  +L 
Sbjct: 79  NKLYFWCLVSGRLNSKEQLYPFV--IMEELEQSLMTYFEKEELTITKLVNNYDRISLILY 136

Query: 117 EMMDYGIPQITE----------------TKMLKQYITQKSFKLMKAVKKSKAAPRPPTEV 160
            + D G P + +                +K++          L K+ K+    P      
Sbjct: 137 WLFDGGEPTVGKRYNNWIKHNIPSKYDFSKVINNTAHNIQIALQKSQKQQSNFPYQDMNF 196

Query: 161 TNSVS--WRAPNIVHKKNEAFLDIVESINMLM----------NQQGQVLRSEIIGQIKVK 208
            ++V+  WR  N+ H  NE +LD+VESI++++          N   +++   IIG+  VK
Sbjct: 197 DSNVAVPWRMRNVDHVNNELYLDLVESIHVVLETKKRKSSYANSTMKIVTGNIIGKALVK 256

Query: 209 SKLSGMPDLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRL---- 264
           S L+G P +++ I+  G                          +LE +  H+CV+     
Sbjct: 257 SVLNGNPIVEMKIDMAGN-------------------------DLESIFLHECVKSKDVD 291

Query: 265 --SKFENEKIITFIPPDGAFELMNYRLSM 291
              +FEN K+I F+PPDG+F+L +Y +++
Sbjct: 292 KDQEFENTKLIKFLPPDGSFKLFDYNINL 320

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 75/342 (21%), Positives = 130/342 (38%), Gaps = 81/342 (23%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIP-----ISAIDKFAPLLLQLE--EESSVIPP----- 48
           M  + Y  D +   I     R D P     ++ I   AP LL     + S+ +P      
Sbjct: 1   MFLSFYITDARNNLIFQYLLRSDSPGFKQIVTKIQSVAPQLLNAASCDVSAELPTVTLSR 60

Query: 49  ----CLSH---DGIQYLFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKS--V 99
               C  H   DG++Y  +Q  ++           N  + F FL  +  +L +Y     +
Sbjct: 61  NLELCSYHSPADGLRYWCLQRTEI-----GEGSTPNPVEPFVFLQTVDTILNQYFGKDVL 115

Query: 100 EEESVRDNFIIIYELLDEMMDYGIPQITETKMLKQ----------YITQKSFKLMKAVKK 149
           +   +  N+  +  L + M+D G P IT+   LK+           I   +  + K +  
Sbjct: 116 KASKITKNYDRVTLLFNSMVDAGEPDITDLNRLKEIVPLKNNFARVINSTASSIGKTISN 175

Query: 150 SKAAPRPPTEVTNS--------------VSWRAPNIVHKKNEAFLDIVESINMLM----N 191
           ++         +NS              V WR+  + +  NE ++D+ E++N+++    N
Sbjct: 176 AEGNQMFSKHSSNSRIGSSVSYANRDRTVPWRSAGVKYTNNELYVDMAETVNIILAKTRN 235

Query: 192 QQGQV-LRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKTN 250
               V +   I G++  K  LS  P ++L +N  G                         
Sbjct: 236 STSLVPISGSIDGEVGFKCYLSENPLVELDLNTNG------------------------- 270

Query: 251 IELEDLKFHQCVRLSKFE-NEKIITFIPPDGAFELMNYRLSM 291
            +L    FH+CVR    + +   + FIPPDG F LM Y + +
Sbjct: 271 HDLGIPAFHRCVRTEGSDFHPGTLRFIPPDGDFCLMEYNIDL 312

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 97/230 (42%), Gaps = 48/230 (20%)

Query: 84  FLHKLMEVLEEYL--KSVEEESVRDNFIIIYELLDEMMDYGIPQITETKMLKQYI----- 136
           FL +  +VL EY   +++  + + +N   +  LL  M+D G   +T++  L+Q +     
Sbjct: 41  FLAQYHQVLIEYFDKEALTVKKLVNNADRLALLLHAMLDAGEVAVTDSNRLRQLVPLRND 100

Query: 137 -----TQKSFKLMKAVKKSKA-----AP--RPPTEVTNSVSWRAPNIVHKKNEAFLDIVE 184
                   +  L   VK + +     AP      E   +V WR  +  +  NE ++D+VE
Sbjct: 101 LSTILNSATKTLANTVKYADSKQLFGAPVATGKVEAGQTVPWRTADCRYVNNEIYVDLVE 160

Query: 185 SINMLMNQQGQVL---RSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTTA 241
           ++N  + Q+G  L      + G+I VK  LSG P ++L +   G                
Sbjct: 161 TVNATLRQKGSSLTLINGSLSGKIDVKCYLSGNPTVQLKLRTSGH--------------- 205

Query: 242 VTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSM 291
                      L++   H+CV L +      + F+PPDG F L  Y + +
Sbjct: 206 ----------PLDNSALHRCVELGE-AGVATMNFVPPDGRFTLAEYAIDL 244

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 75/328 (22%), Positives = 132/328 (40%), Gaps = 59/328 (17%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPI-----SAIDKFAPLLLQLEEESSVIP---PCLSH 52
           M  A Y  D K   +       + P+     + I    P LL  ++E+   P    C++ 
Sbjct: 1   MFIAFYITDSKNSLVFQYLLGSNSPLFSHLLARIRAVCPGLLSKDDENDNTPLFHCCIAK 60

Query: 53  DGIQYLF-IQHNDLYVVALATSLATN-VAQVFAFLHKLMEVLEEYLKS--VEEESVRDNF 108
           D   Y +  Q N+L    LA+   +      F FL  L + L EY     +    + +N+
Sbjct: 61  DLEVYKYHSQVNNLNYYCLASGADSRPQTDTFTFLQLLDQTLLEYFDKDKLTVTKIVNNY 120

Query: 109 IIIYELLDEMMDYGIPQITETKM------------LKQYITQKSFKLMKAVKKSK----A 152
             I  +    +D G P +                 L + I   +  L +AV++ +    A
Sbjct: 121 DRITMIFYMSIDSGEPCVGSLNSNRIRRVIPVKSDLSKMINNTAHTLQRAVRQPRQGILA 180

Query: 153 APRPPTEVTNSVSWRAPNIVHKKNEAFLDIVESINMLM-----NQQGQVLRSEIIGQIKV 207
           A     E    V WR+ ++ +  +E ++DI+E+++++      N   Q++   I GQ+ V
Sbjct: 181 ATPEILESEEVVPWRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSVQMVSGTINGQVNV 240

Query: 208 KSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKF 267
           KS LSG P +++ ++  G                          E+     HQCV + + 
Sbjct: 241 KSYLSGNPTVEMDMDLAGN-------------------------EMYAPSMHQCVEMPQ- 274

Query: 268 ENEKIITFIPPDGAFELMNYRLSMPVKP 295
            +   + FIPPDG   L+NY + + + P
Sbjct: 275 GSPSSLCFIPPDGNCNLLNYTIDLDMNP 302

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 82/340 (24%), Positives = 136/340 (40%), Gaps = 59/340 (17%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIP-----ISAIDKFAPLLLQLEEESSVIPPCLSHD-G 54
           M  A Y CD K + +         P     ++ I    P +L +E   +V     S D  
Sbjct: 1   MYIAFYICDTKNQLVFQYLCDSIAPHFSKLLTRIHSLCPEVLDVETRGNV-----SKDLK 55

Query: 55  IQYLFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLK--SVEEESVRDNFIIIY 112
           I   F   N+L   AL      +  +    L  +  +L EY    ++    + +N+  + 
Sbjct: 56  IYRYFSATNNLNYYALTIVSRHHDLEPHHVLESIDTLLVEYFNKTNLTTTKIMNNYDRMT 115

Query: 113 ELLDEMMDYGI---PQITETKMLKQYITQKSFK--LMKAVKKSKAAPRPPTEVTNSV-SW 166
            L D ++D GI         K+  Q   +  F   +  A K  +    P   V N V  W
Sbjct: 116 ILFDLLIDGGIIDGNNFYMNKLRNQIPLKNDFSNFINDAAKSLQKGQAPSKTVDNEVVPW 175

Query: 167 RAPNIVHKKNEAFLDIVESINMLM------NQQGQVLRSEIIGQIKVKSKLSGMPDLKLG 220
           R+  I   +NE ++D+ E++ + +      + + ++L   I G + V S + G+P L++ 
Sbjct: 176 RSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSIGGVPMLEVS 235

Query: 221 INDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDL--KFHQCVRLSKF--ENEKIITFI 276
                       G  D                 +D+  KFH CV +++F   +  II FI
Sbjct: 236 F-----------GGCD----------------FKDIIPKFHDCVEVNEFLTNDGNIIKFI 268

Query: 277 PPDGAFELMNYRLSMPV--KPLIWCD-VNVQVHSQSRIEI 313
           PPDG F+LM Y +++      LI C+  N   +S    EI
Sbjct: 269 PPDGKFQLMEYSMALSSFNDNLISCNFTNGLGNSNDEFEI 308

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 61/144 (42%), Gaps = 45/144 (31%)

Query: 164 VSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLR----------SEIIGQIKVKSKLSG 213
           V WR   + +  NE ++D+ ESI+++  + G+  R            I GQ  VK  LSG
Sbjct: 211 VPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSG 270

Query: 214 MP--DLKLGI--NDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKFEN 269
            P  DL+L +  ND G+          P                    FH+CV L   +N
Sbjct: 271 NPTVDLQLDLAGNDLGV----------PA-------------------FHECVELDNHQN 301

Query: 270 EK--IITFIPPDGAFELMNYRLSM 291
                + FIPPDG F LM Y + +
Sbjct: 302 PSNCDLRFIPPDGRFNLMQYSIDL 325

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 71/150 (47%), Gaps = 31/150 (20%)

Query: 164 VSWRAPNIVHKKNEAFLDIVESINMLMNQQG------------------QVLRSEIIGQI 205
           V WR+ N+ +  NE ++D++E I+++  ++                   +++R++IIG++
Sbjct: 256 VPWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADIIGEL 315

Query: 206 KVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLS 265
            V+S LS  P +++ + D+    +          T  +E      + L    FH CV + 
Sbjct: 316 NVRSYLSDNPMVEVTLVDRNYSDQ---------KTGWSENDLFKQLNLGLPMFHDCVEID 366

Query: 266 --KFENEKI--ITFIPPDGAFELMNYRLSM 291
             K  N+    I FIPPDG F LM Y + +
Sbjct: 367 YEKGINQDFRHIKFIPPDGKFSLMKYNIDL 396

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 96/226 (42%), Gaps = 50/226 (22%)

Query: 162 NSVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMP--DLKL 219
           + V WR   I +  NE F+D+ E IN ++ ++G++L   I G I + + LSG P  ++KL
Sbjct: 208 SGVPWRMSGINYANNEIFIDMSEEINAIV-EKGKLLTGHIKGCIDLNNHLSGQPLVEMKL 266

Query: 220 GINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKFE--NEKI----- 272
           G+ D  +        S   TT                 FH+C+   K    N+ I     
Sbjct: 267 GLLDHKL--------SHLNTT-----------------FHRCILEDKANSINDLIAGKFT 301

Query: 273 -ITFIPPDGAFELMNYRLSMPVKPLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVE 331
            +TF+PPDG   L  Y L     PL+  D N+ +       I    ++ + KR   +  E
Sbjct: 302 KLTFVPPDGRTRLCQYTL-----PLVKRDSNLGI-------IDVNLQSSLGKR--LDEFE 347

Query: 332 ILIPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMS 377
           + + V         +    +++       I+  +R+  GG E +M+
Sbjct: 348 VRVTVGMSTTVKEIENMSMTIRMNRNFKGIVRVMRNTHGGVETNMT 393

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 115/240 (47%), Gaps = 53/240 (22%)

Query: 87  KLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMDYGIPQI--TETKMLKQYI-------- 136
           KLM+  ++   SV++  + +N+  I  +   M++ G P +  T T  +K+ +        
Sbjct: 109 KLMDYYDKDGLSVKK--ISNNYDQISLIFYWMINGGEPNVGKTSTNFIKENVPMKVDLSK 166

Query: 137 --TQKSFKLMKAVKKSKAAPRPP------TEVTNSVSWRAPNIVHKKNEAFLDIVESINM 188
             T  +  + KA++ S+A  +P        E   +  WR+ N+ H  NE ++D+VES+++
Sbjct: 167 VFTSTAQNIQKAIQSSQAQ-KPIFQDFSFQENKANAPWRSQNVKHNNNEIYIDLVESVHV 225

Query: 189 LMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKK 248
           +   Q ++ RS  +     +SK S           K I + Y++G +     +   G   
Sbjct: 226 VY--QTKIRRSNEL----TRSKQS----------IKKIVNGYLKGTA--YVQSFLNGNPL 267

Query: 249 TNIELE----DL---KFHQCVRLSKF----ENEKI--ITFIPPDGAFELMNYRLSM-PVK 294
             ++LE    D+    FH+CV + ++    +N  I  + FIPPDG F LM+Y +++ P K
Sbjct: 268 VELQLELSGNDIGHPSFHECVDIDEYLKNIDNSSISSLKFIPPDGKFTLMDYTITLDPTK 327

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 59/287 (20%), Positives = 113/287 (39%), Gaps = 63/287 (21%)

Query: 114 LLDEMMDYGIPQITETKMLKQYITQKS--FKLMKAVKKS---KAAPRPPTEVTN------ 162
           LL+ M+D   P +T+   L+  +  +    K++ +   S   + + R  ++V N      
Sbjct: 118 LLNCMVDANEPAVTDFNHLRDMVPSREDLSKVINSTASSLSNRISQRNTSQVLNIGDPAK 177

Query: 163 -------SVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQV-----LRSEIIGQIKVKSK 210
                   V WR+  + +  NE ++D+VE++++++ +  +      +R  + G +  +S 
Sbjct: 178 GPAAKEKLVPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDFRSH 237

Query: 211 LSGMPDLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKFENE 270
           LSG P + L +  +G                          +L     HQC   S     
Sbjct: 238 LSGNPVIALNLRLRGH-------------------------DLGMPALHQCCLDSYQGRP 272

Query: 271 KIITFIPPDGAFELMNYRL---SMPVKPLIWCDVNVQVHSQSRIEI-----HCRARAQIK 322
             + F+PPDG F+LM+Y +   S+  K  ++ ++ + V    R E+            I 
Sbjct: 273 DQLRFVPPDGKFQLMHYSIDLDSLQSKSKLFSNIGL-VSPDYRTELGDLGDEFEVNLNIA 331

Query: 323 KRSIANSVEILI------PVPDDADTPSFKYTHGSVKWVPQKNAILW 363
               A  V+ L+      P+P +      + THG  +     N   W
Sbjct: 332 GSQHAKVVDDLVITLSFGPLPSECKIKVLRSTHGHFENCASNNIGKW 378

>KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 536

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 73/145 (50%), Gaps = 8/145 (5%)

Query: 1   MVSAVYFCDGKGRPILSRRYRD---DIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQY 57
           +V AV     KG+P+LSR++RD   D  +  +  F  L+    ++ + +      + ++Y
Sbjct: 2   VVLAVSITTRKGKPLLSRQFRDITKDRVMELLSNFQTLVANSSKQHTFV----EDEHVRY 57

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           ++   +D Y++ L T+L +N+ Q    L+  ++ ++  LK + EE V D+   I    DE
Sbjct: 58  VYKPFDDYYII-LITNLHSNIIQDMDTLNIFVQTVDSTLKGLSEEDVFDSAFDILNSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKSFK 142
           ++  G  +      +K ++  +S +
Sbjct: 117 IITMGYKENLSLTQIKTFLAMESHE 141

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 59/133 (44%), Gaps = 30/133 (22%)

Query: 164 VSWRAPNIVHKKNEAFLDIVESINMLMNQ---QGQVL--RSEIIGQIKVKSKLSGMPDLK 218
           V WR   + +  NE ++D+VE+I++++ +    GQ++  R  I G +  +S L+G P + 
Sbjct: 186 VPWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVA 245

Query: 219 LGINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPP 278
           L +N  G                          +L     H C +     + + + F+PP
Sbjct: 246 LKLNLHGH-------------------------DLGVPALHPCCQAQYTGSPENLQFVPP 280

Query: 279 DGAFELMNYRLSM 291
           DG F LM Y + +
Sbjct: 281 DGKFRLMQYTIDL 293

>CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051c RET2
          Length = 536

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 95/208 (45%), Gaps = 19/208 (9%)

Query: 1   MVSAVYFCDGKGRPILSRRYRD---DIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQY 57
           +V A       G+P+LSR++R+   +  +  +  F  L+  +  + +     L  + ++Y
Sbjct: 2   VVLAASITTRNGKPLLSRQFRELTKERTMELLSNFQGLVSNISSDHTF----LEDEHVRY 57

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           ++   ++ Y++ L T+  +N+ Q  + L+     +  YL S +E  + DN   I    DE
Sbjct: 58  VYRPFDNYYII-LITNRQSNIIQDLSTLNLFSSTVNSYLASYDELEIFDNSFEILSSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKSF--KLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKK 175
           ++  G  +      ++ Y+  +S   ++ + ++++K       E T     RA  I  K+
Sbjct: 117 IVTMGYKENLSISQVETYLAMESHEERIQEIIERNKE-----IEATEERKRRAKEIARKE 171

Query: 176 NEAFLDI----VESINMLMNQQGQVLRS 199
            E  L I     E+ N++ N Q + + S
Sbjct: 172 QERKLGIYGGEFETANLVANSQNRFMAS 199

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 56/133 (42%), Gaps = 30/133 (22%)

Query: 164 VSWRAPNIVHKKNEAFLDIVESINMLMNQQG----QVLRSEIIGQIKVKSKLSGMPDLKL 219
           V WR PN+ +  NE ++D+VE++ + + Q       V    I G+I +K  L G P +++
Sbjct: 195 VPWRIPNLSNVNNEIYVDMVETLTLNLKQSRPNSFHVFHGVISGKIDLKCYLRGNPTMQI 254

Query: 220 GINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVR-LSKFENEKIITFIPP 278
            ++  G                            +    H+C+   S   +   + FIPP
Sbjct: 255 NLHSAG-------------------------HAFKPSALHRCLDPSSSSFDSSSLRFIPP 289

Query: 279 DGAFELMNYRLSM 291
           DG F L+ Y + +
Sbjct: 290 DGKFTLLEYTIDL 302

>ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 538

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 87/187 (46%), Gaps = 15/187 (8%)

Query: 1   MVSAVYFCDGKGRPILSRRYRD---DIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQY 57
           +V A       G+P+LSR++R+   D  +  +  F  L+  L  E + +      + ++Y
Sbjct: 2   VVLAASITTRSGKPLLSRQFRELTKDRVLELLSNFQSLVTNLSSEHTFV----EGNHVRY 57

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           ++   +D Y++ L T+  +N+ +  + L+ L + +   L S +E  + D+   I    DE
Sbjct: 58  VYRPFDDYYII-LITNRQSNIIEDLSTLNLLSQTVNNCLSSYDENEIYDSAFEILTAFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKSF--KLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKK 175
           ++  G  +   +  +  Y+T +S   ++ + ++++K       E T     RA  I  ++
Sbjct: 117 VVIMGYKENLSSTQVTTYLTMESHEERIQEIIERNKEF-----EATEERKRRAKEIAKRE 171

Query: 176 NEAFLDI 182
            E  + I
Sbjct: 172 QERRMGI 178

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/270 (20%), Positives = 109/270 (40%), Gaps = 60/270 (22%)

Query: 56  QYLFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKS--VEEESVRDNFIIIYE 113
           +Y  I +   Y    +TS +      F FL  +  +L EY     +  + + +N+  I  
Sbjct: 64  KYFSITNKLNYWCLASTSKSKGPLDCFTFLETMDCILLEYFDKDRLSIKKLVNNYDRISL 123

Query: 114 LLDEMMDYGIPQIT-------------ETKMLKQYITQKSFKLMKAVKKSKAAPRPP--- 157
           + +  ++ G P +              E   L ++I+  +  L +AV+  +   +     
Sbjct: 124 IFNCCIEAGEPNVNDFLYVNKIKEAVPERSDLSKFISSTAHNLQQAVQLPQQRQQQLQQN 183

Query: 158 ---------TEVTNSVSWRAPNIV-HKKNEAFLDIVESINMLMNQQGQVLR---SEIIGQ 204
                     E  + V WR      H+ NE ++D++E+ ++++ ++   LR    +I G 
Sbjct: 184 QMSRGNISLVEDEDIVPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGDICGA 243

Query: 205 IKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRL 264
           + V+S L+  P + + +N  G                          E+     H+CV +
Sbjct: 244 VDVRSYLNDNPLVSVKLNTMGN-------------------------EIGIPSLHECVEI 278

Query: 265 SKFENE---KIITFIPPDGAFELMNYRLSM 291
           +  + E     ITFIPPDG F L+ Y +++
Sbjct: 279 ND-DGEFTPSNITFIPPDGKFRLLEYSINL 307

>NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {ON}
           Anc_3.575 YFR051C
          Length = 547

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 85/182 (46%), Gaps = 15/182 (8%)

Query: 1   MVSAVYFCDGKGRPILSRRYRD---DIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQY 57
           +V A       G+P+LSR++R+   D  +  +  F  L+  +  + + +      + ++Y
Sbjct: 2   VVLAASITTRNGKPLLSRQFRELTKDRVMELLSNFQGLVSSISSDHTFV----EDEHVRY 57

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           ++   +D Y++ L T+  +N+ Q  + L+   + +  YL S +E  + DN   I    DE
Sbjct: 58  VYKPFDDYYII-LITNRQSNIIQDLSTLNLFSQTVNSYLSSYDETELYDNAFEILSSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKSF--KLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKK 175
           ++  G  +      +  Y++ +S   ++ + ++++K       E T     RA  I  ++
Sbjct: 117 IVVMGYKENLTAAQVSTYLSMESHEERIQEIIERNK-----ELEATEERKRRAKEIARRE 171

Query: 176 NE 177
           +E
Sbjct: 172 HE 173

>Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to
           Ashbya gossypii AFR274C
          Length = 537

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 75/156 (48%), Gaps = 10/156 (6%)

Query: 1   MVSAVYFCDGKGRPILSRRYRD---DIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQY 57
           +V AV      G+P+LSR++RD   D  +  +  F  L+     E + +      + ++Y
Sbjct: 2   VVLAVSITTKSGKPLLSRQFRDITKDRVMELLSNFQNLVASSSREHTFV----EEEHVRY 57

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           ++I  +D Y++ L T+  +N+ Q    L+   + +   LK   EE + ++   I    DE
Sbjct: 58  IYIPFDDYYII-LITNRQSNIIQDMDTLNLFSQTVNSNLKGFSEEDMLNSAFDILGSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKSF--KLMKAVKKSK 151
           ++  G  +      +  +++ +S   K+ + ++++K
Sbjct: 117 IISLGYKESLSLSQINTFLSMESHEEKIQEIIERNK 152

>KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 633

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 84/182 (46%), Gaps = 15/182 (8%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLE---EESSVIPPCLSHDGIQY 57
           +V AV     +G+P+LSR++RD   IS  D+   LL   +    +SS     +  + ++Y
Sbjct: 98  VVIAVSIVTRQGKPLLSRQFRD---ISK-DRVTELLSNFQGLVAKSSSQHTFVEDEHVRY 153

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           ++   +D Y++ L T+  +N+ Q    L    + +  YL S +E  + +N   I    DE
Sbjct: 154 VYKPFDDYYII-LITNRQSNIIQDLDTLKLFSQSMNTYLSSFDENEIFENAFEILSSFDE 212

Query: 118 MMDYGIPQITETKMLKQYITQKSF--KLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKK 175
           ++  G  +      +  Y++ +S   K+ + ++++K       E       RA  I  K+
Sbjct: 213 VITMGYKENLSISQINTYLSMESHEEKIQEIIERNK-----EFEAAEERKRRAKEISRKE 267

Query: 176 NE 177
            E
Sbjct: 268 QE 269

>Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]
           {ON} YFR051C (RET2) - vesicle coat component [contig
           344] FULL
          Length = 538

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 77/156 (49%), Gaps = 10/156 (6%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLE---EESSVIPPCLSHDGIQY 57
           +V AV     +G+P+LSR++R+   IS  D+   LL   +    +SS     +  + ++Y
Sbjct: 2   VVIAVSIVTRQGKPLLSRQFRE---ISK-DRVTELLSNFQGLVAKSSSQHTFVEDEHVRY 57

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           ++   +D Y++ L T+  +N+ Q    L    + +  YL S +E  + +N   I    DE
Sbjct: 58  VYKPFDDYYII-LITNRQSNIIQDLDTLKIFSQTMNTYLSSFDEHEIFENAFEILSSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKSF--KLMKAVKKSK 151
           ++  G  +      +  Y++ +S   K+ + ++++K
Sbjct: 117 VITMGYKENLSMTQINTYLSMESHEEKIQEIIERNK 152

>TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575
           YFR051C
          Length = 543

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 85/182 (46%), Gaps = 15/182 (8%)

Query: 1   MVSAVYFCDGKGRPILSRRYRD---DIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQY 57
           +V A       G+P+LSR++ D   D  +  +  F  L+ +   E + +      + ++Y
Sbjct: 2   VVLAASITTRNGKPLLSRQFTDVTKDRVMELLSNFQGLVAKGSSEHTYVED----EHVRY 57

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           L+   +D Y++ + T+  +N+ Q  + L    + +  YL S +E  + +N   I    DE
Sbjct: 58  LYKPFDDYYLIII-TNRQSNIIQDLSTLSLFSQTMNTYLASFDETDIFENAFEILSSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKSF--KLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKK 175
           ++  G  +      ++ Y+T +S   ++ + ++++K      +E T     RA  I  ++
Sbjct: 117 IIVMGYKENLTMAQVETYLTMESHEERIQEIIERNK-----ESEATAERKRRAKEIAKRE 171

Query: 176 NE 177
           ++
Sbjct: 172 HD 173

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 61/135 (45%), Gaps = 33/135 (24%)

Query: 164 VSWRAPNIV-HKKNEAFLDIVESINMLMNQQGQVLR---SEIIGQIKVKSKLSGMPDLKL 219
           V WR      H+ NE ++D++E+ +++   +   LR     I G + V+S L+  P + +
Sbjct: 199 VPWRTSKASKHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTVDVRSYLNNNPLVSV 258

Query: 220 GINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKFENEKI---ITFI 276
            +N  G                        +I +  L  H+CV + K + E +   ITFI
Sbjct: 259 KLNTMG-----------------------NDIGVPTL--HECVEI-KDDGEFLPSNITFI 292

Query: 277 PPDGAFELMNYRLSM 291
           PPDG F L+ Y + +
Sbjct: 293 PPDGKFRLLEYSVDL 307

>AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR051C
           (RET2)
          Length = 532

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 84/187 (44%), Gaps = 15/187 (8%)

Query: 1   MVSAVYFCDGKGRPILSRRYRD---DIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQY 57
           +V AV      G+P++SR+++D   D  +  +  F  L+      SS     +  + ++Y
Sbjct: 2   VVLAVSITTRSGKPLVSRQFKDISRDRIMELLSNFQGLVAN----SSRQHTFVEEEHVRY 57

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           ++   +D Y++ L T+  +N+ Q    L+   + +  +LK   E+ + DN   I    DE
Sbjct: 58  VYKPFDDYYII-LITNRQSNIIQDMDTLNLFSQTVNSHLKGFSEDEILDNAFDILGSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKSF--KLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKK 175
           ++  G  +      +  +++ +S   KL + ++++K       E       RA  I  ++
Sbjct: 117 IISLGCKENLSLSQINTFLSMESHEEKLQEIIERNK-----EFEAAEERKRRAREISQRE 171

Query: 176 NEAFLDI 182
            E  L I
Sbjct: 172 RERKLGI 178

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/262 (20%), Positives = 102/262 (38%), Gaps = 65/262 (24%)

Query: 66  YVVALATSLATNVAQVFAFLHKLMEVLEEYLKS--VEEESVRDNFIIIYELLDEMMDYGI 123
           Y    +TS +      F FL  +  +L EY     +  + + +N+  I  + +  ++ G 
Sbjct: 74  YWCLASTSKSKGPLDCFTFLETIDRILLEYFDKDKLSIKKIVNNYDRISLIFNCCVEAGE 133

Query: 124 PQIT-------------ETKMLKQYITQKSFKLMKAVKKSKA------------APRPPT 158
           P ++             E   L ++I+  +  L +AV+  +                   
Sbjct: 134 PNVSDMLYVNKIKEAVPERSDLSKFISSTAHNLQQAVQLPQQRQQQLQQNQISRGSNSLI 193

Query: 159 EVTNSVSWRAPNIV-HKKNEAFLDIVESINMLMNQQGQVLR---SEIIGQIKVKSKLSGM 214
           E    V WR      H+ NE ++D++E+ +++  ++   LR     I G + V+S L+  
Sbjct: 194 ENEEIVPWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDN 253

Query: 215 PDLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKFENEKI-- 272
           P + + +N  G                        +I +  L  H CV +    N+ +  
Sbjct: 254 PLVAVKLNTMG-----------------------NDIGIPSL--HDCVEI----NDGVFS 284

Query: 273 ---ITFIPPDGAFELMNYRLSM 291
              ITFIPPDG F L+ Y + +
Sbjct: 285 PSNITFIPPDGKFRLLEYSVDL 306

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 67/281 (23%), Positives = 112/281 (39%), Gaps = 57/281 (20%)

Query: 50  LSHDGIQYLFIQHNDLYVVALATSLATNVAQVF-AFLHKLMEVLEEYLKSVEEESVRDNF 108
           L+   + Y  +  ND  V  +    A    QVF   LH+  +  E  +  +   + R + 
Sbjct: 88  LAGSALTYWCLHSNDSNVYYMEPLFA---MQVFETRLHEYFDKEELTITKITNNADRVSI 144

Query: 109 IIIYEL------LDEMMDYGIPQIT-ETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVT 161
           I  Y L      +  M D  I +I  E   L + I+  +  +  AV K +  P     + 
Sbjct: 145 ICNYILNGGYYNVAGMYDSRIKEIVPERSDLSKLISSTAHTIQSAVNKQRNTPGFGNGMG 204

Query: 162 NSVS------------------WR-APNIVHKKNEAFLDIVESINMLMNQQ----GQVLR 198
            S+                   WR   NI + +NE + D+ E I ++  ++        R
Sbjct: 205 QSMGSKVSHIGSTLKGDDSVAPWRNGKNIHNDRNELYADVREVIQVVYQKKYSSKKNDSR 264

Query: 199 SEIIGQIK-----VKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIEL 253
            +I G+       V+  +SG  D++           ++ G+   V  A+ +G     I  
Sbjct: 265 RKIFGRRSGHLEYVRGNISGSVDMRC----------FLTGNP-LVEIALKQGGLDIGIP- 312

Query: 254 EDLKFHQCV-RLSKFENEKI--ITFIPPDGAFELMNYRLSM 291
               FH CV + S  + EKI  ++FIPPDG F LM Y +++
Sbjct: 313 ---GFHDCVDKTSLLKQEKISKLSFIPPDGRFTLMQYNINL 350

>TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {ON}
           Anc_3.575 YFR051C
          Length = 539

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/197 (20%), Positives = 91/197 (46%), Gaps = 15/197 (7%)

Query: 2   VSAVYFCDGKGRPILSRRYRD---DIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYL 58
           V A       G+P+LSR++ +   D  +  +  F  L+  +  + + +      + ++Y+
Sbjct: 3   VLAASITTRNGKPLLSRQFVEMSKDRVMELLSNFQGLVANISSDHTYVED----EHVRYV 58

Query: 59  FIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEM 118
           +   +D Y++ L T+  +N+ Q  + L+   + +  YL S +E  + +N   I    DE+
Sbjct: 59  YKPFDDYYLI-LMTNRQSNIIQDLSTLNLFSQTVNYYLNSFDENEIFENAFEILSSFDEI 117

Query: 119 MDYGIPQITETKMLKQYITQKSF--KLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKN 176
           +  G  +    + +  YI+ +S   ++ + ++K+K      +E       RA  I  K++
Sbjct: 118 IVMGHKENLTIQQVNNYISMESHEERIQEIIEKNK-----ESEANAERKRRAKEIARKEH 172

Query: 177 EAFLDIVESINMLMNQQ 193
           E  + +  S+  +  QQ
Sbjct: 173 ERKMGMPPSVYDIATQQ 189

>SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 545

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 76/156 (48%), Gaps = 10/156 (6%)

Query: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLE---EESSVIPPCLSHDGIQY 57
           +V AV      G+P+LSR++RD   IS  D+   LL   +     SS     +  + ++Y
Sbjct: 2   VVLAVSITTRSGKPLLSRQFRD---ISK-DRVTELLSNFQGLVANSSSQHTFVEDEHVRY 57

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           ++   +D Y++ L T+  +N+ Q    L+   + +   L+S +E  + +N   I    DE
Sbjct: 58  VYKPFDDYYII-LITNRQSNIIQDLDTLNLFSQTVNSSLRSFDENEIFENAFEILGSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKSF--KLMKAVKKSK 151
           ++  G  +      +  +++ +S   K+ + ++++K
Sbjct: 117 IIAMGYKENLSLTQINNFLSMESHEEKIQEIIERNK 152

>TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa]
           {ON} Anc_3.575 YFR051C
          Length = 536

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/190 (20%), Positives = 86/190 (45%), Gaps = 15/190 (7%)

Query: 1   MVSAVYFCDGKGRPILSRRYRD---DIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQY 57
           +V A       G+P+LSR++R+   D  +  +  F  L+  +  + + +      + ++Y
Sbjct: 2   VVLAASITTRTGKPLLSRQFREITKDRVLELLSNFQSLVTNISSDHTFV----EDEHVRY 57

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           ++   +D Y++ L T+  +N+    + L+   + +  YL S +E  + +N   I    DE
Sbjct: 58  VYRPFDDYYII-LITNRQSNIIMDLSTLNLFSQTVNSYLSSYDEAEIFENAFEILSSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKSF--KLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKK 175
           ++  G  +      +  Y++ +S   ++ + ++++K       E T     RA  I  ++
Sbjct: 117 IVVMGYKENLSITQVNTYLSLESHEERIQEIIERNK-----EFEATEERKRRAKEIARRE 171

Query: 176 NEAFLDIVES 185
            E  + I  S
Sbjct: 172 QERKMGIAPS 181

>NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa]
           {ON} Anc_3.575 YFR051C
          Length = 540

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 60/125 (48%), Gaps = 8/125 (6%)

Query: 1   MVSAVYFCDGKGRPILSRRYRD---DIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQY 57
           +V A       G+P+LSR++RD   D  +  +  F  L+  +  + + +      + ++Y
Sbjct: 2   VVLAASITTRHGKPLLSRQFRDLTKDRVMELLSNFQGLVANISSDHTFV----EDEHVRY 57

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           ++   +D Y++ L T+  +N+ Q  + L+   + +   L + +E  + DN   I    DE
Sbjct: 58  VYKPFDDYYII-LITNRQSNIVQDLSTLNLFSQTVNSSLSNFDENEIYDNAFEILSSFDE 116

Query: 118 MMDYG 122
           ++  G
Sbjct: 117 IVVMG 121

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 60/134 (44%), Gaps = 31/134 (23%)

Query: 164 VSWRAPNIV-HKKNEAFLDIVESINMLMNQQGQVLR---SEIIGQIKVKSKLSGMPDLKL 219
           V WR      H+ NE +LD++E+ +++  ++   +R     I G + V+S L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLV 258

Query: 220 GINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRLSKFE--NEKIITFIP 277
            +N  G                        +I +  L  H+CV ++     +   ITFIP
Sbjct: 259 KLNTMG-----------------------NDIGIPSL--HECVEINDGGVFSPSNITFIP 293

Query: 278 PDGAFELMNYRLSM 291
           PDG F L+ Y + +
Sbjct: 294 PDGKFRLLEYCVDL 307

>Kpol_380.13 s380 complement(21263..22870) [1608 bp, 535 aa] {ON}
           complement(21263..22870) [1608 nt, 536 aa]
          Length = 535

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/171 (21%), Positives = 80/171 (46%), Gaps = 15/171 (8%)

Query: 12  GRPILSRRYRD---DIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFIQHNDLYVV 68
           G+P+LSR++ +   D  +  +  F  L+  +  + + +      + ++Y++   +D Y++
Sbjct: 13  GKPLLSRQFTEITKDRVMELLSNFQGLVANISSDHTYVES----EHVRYVYKPFDDYYLI 68

Query: 69  ALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMDYGIPQITE 128
            L T+  +N+ Q  + L+   + +  YL S +E  + +N   I    DE++  G  +   
Sbjct: 69  -LVTNRQSNIIQDLSTLNLFSQTVNYYLNSFDEGEIFENAFEILSSFDEIIVMGNKEDLT 127

Query: 129 TKMLKQYITQKSF--KLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNE 177
              +  Y+  +S   K+ + ++++K      TE       RA  I  K++E
Sbjct: 128 ISQVNTYLAMESHEEKIQEIIERNK-----ETEANAERKRRAKEIARKEHE 173

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 64/154 (41%), Gaps = 55/154 (35%)

Query: 164 VSWRAPNIVHKKNEAFLDIVESI-----NMLMNQQGQ-------------------VLRS 199
           V WR  NI + KNE ++D+ E I     N + N++G+                   ++  
Sbjct: 259 VPWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNG 318

Query: 200 EIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFH 259
            I G I V+S L+G P +++ +N  G         +D  T ++                H
Sbjct: 319 YITGVIDVRSYLNGNPIVEMKLNTCG---------NDMGTPSL----------------H 353

Query: 260 QCVRLS---KFENEKI---ITFIPPDGAFELMNY 287
            CV L      +++K+   + FIPPDG F L  Y
Sbjct: 354 PCVELEGDMNGDDDKVMDSLKFIPPDGKFCLARY 387

>Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON}
           (49309..50910) [1602 nt, 534 aa]
          Length = 533

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 87/187 (46%), Gaps = 16/187 (8%)

Query: 1   MVSAVYFCDGKGRPILSRRYRD---DIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQY 57
           ++SA     G G+P+LSR++++   +  I  +  F  L+     +SS     +  + ++Y
Sbjct: 3   VLSAAIMTRG-GKPLLSRQFKELTKERVIELLSNFQGLV----SKSSSDHTYVEDEHVRY 57

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           ++   +D Y++ L T+  +N+ Q  + L+   + +  YL S +EE +  N   I    DE
Sbjct: 58  VYRPFDDYYLI-LVTNRQSNIIQDLSTLNLFSQSVNYYLNSFDEEEIFINAFEILSSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKSF--KLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKK 175
           ++  G  +      +  Y+  +S   ++ + ++++K A     E       RA  I  ++
Sbjct: 117 IIVMGNKENLTVSQVNTYLAMESHEERIQEIIEQNKEA-----EANAERKRRAKEIARRE 171

Query: 176 NEAFLDI 182
            E  L I
Sbjct: 172 QERKLGI 178

>Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON}
           YFR051C (REAL)
          Length = 546

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 36/183 (19%), Positives = 87/183 (47%), Gaps = 16/183 (8%)

Query: 1   MVSAVYFCDGKGRPILSRRYRD---DIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQY 57
           +V A      +G+P+LSR+++D   D  +  +  F  L+ ++  + + +        ++Y
Sbjct: 2   VVLAASITTRQGKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFV----EDKHVRY 57

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           ++   ++ Y++ L T+  +N+ +  A L+   + +  YL S +++ +  N   I    DE
Sbjct: 58  VYRPFDNYYII-LITNRQSNIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDE 116

Query: 118 MMDY-GIPQITETKMLKQYITQKSF--KLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHK 174
           ++   G  +      ++ Y++ +S   ++ + ++++K       E T     RA  I  K
Sbjct: 117 IVSMGGYKENLSFTQVQTYLSMESHEERIQEIIERNKE-----IEATEERKRRAKEIARK 171

Query: 175 KNE 177
           ++E
Sbjct: 172 EHE 174

>YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}
           RET2Delta subunit of the coatomer complex (COPI), which
           coats Golgi-derived transport vesicles; involved in
           retrograde transport between Golgi and ER
          Length = 546

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 36/183 (19%), Positives = 87/183 (47%), Gaps = 16/183 (8%)

Query: 1   MVSAVYFCDGKGRPILSRRYRD---DIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQY 57
           +V A      +G+P+LSR+++D   D  +  +  F  L+ ++  + + +        ++Y
Sbjct: 2   VVLAASITTRQGKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFVED----KHVRY 57

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           ++   ++ Y++ L T+  +N+ +  A L+   + +  YL S +++ +  N   I    DE
Sbjct: 58  VYRPFDNYYII-LITNRQSNIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDE 116

Query: 118 MMDY-GIPQITETKMLKQYITQKSF--KLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHK 174
           ++   G  +      ++ Y++ +S   ++ + ++++K       E T     RA  I  K
Sbjct: 117 IVSMGGYKENLSFTQVQTYLSMESHEERIQEIIERNK-----EIEATEERKRRAKEIARK 171

Query: 175 KNE 177
           ++E
Sbjct: 172 EHE 174

>Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON}
           YFR051C (REAL)
          Length = 598

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 35/183 (19%), Positives = 87/183 (47%), Gaps = 16/183 (8%)

Query: 1   MVSAVYFCDGKGRPILSRRYRD---DIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQY 57
           +V A      +G+P+LSR+++D   D  +  +  F  L+ ++  + + +        ++Y
Sbjct: 55  VVLAASITTRQGKPLLSRQFKDLSKDRVLELLSNFQNLVTEISSDHTFV----EDKHVRY 110

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           ++   ++ Y++ L T+  +N+ +  + L+   + +  YL S +++ +  N   I    DE
Sbjct: 111 VYRPFDNYYII-LITNRQSNIIKDLSTLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDE 169

Query: 118 MMDY-GIPQITETKMLKQYITQKSF--KLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHK 174
           ++   G  +      ++ Y++ +S   ++ + ++++K       E T     RA  I  K
Sbjct: 170 IVSMGGYKENLSFTQVQTYLSMESHEERIQEIIERNKE-----IEATEERKRRAKEIARK 224

Query: 175 KNE 177
           ++E
Sbjct: 225 EHE 227

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 67/332 (20%), Positives = 116/332 (34%), Gaps = 98/332 (29%)

Query: 164 VSWRAPNIVHKKNEAFLDIVESINMLM---------------NQQGQVLRSEIIGQIKVK 208
           V WR   I   K E ++D+ E + +                 N   +++   I G I V+
Sbjct: 189 VPWRRNGIKDAKEELYVDLKEEVYVTYRKSDRHHGRDGIRTSNPSMELVSGHIKGTIDVR 248

Query: 209 SKLSGMPDLKLGI----NDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQCVRL 264
             L+G P + L      ND GI S                             FH CV  
Sbjct: 249 CYLNGNPTVSLMFDTMGNDLGIPS-----------------------------FHACVEQ 279

Query: 265 S-------------KFENEKIITFIPPDGAFELMNYRLSM----PVKPLIWCDVNVQVH- 306
                          F+ ++++ F+PPDG F L  Y + +     +   +  D  +QV  
Sbjct: 280 EDQVQEQKQEQEPESFQGKRLLRFLPPDGKFRLAQYVIDLDGQGGMSRRMDRDGLIQVSF 339

Query: 307 ------SQSRIEIHCRARAQIKKRSIANSVEILIPV-----PDDADTPSFKYTHGSVKWV 355
                 ++   E+    R  I   ++ + VE L+        +D++    + THG+    
Sbjct: 340 EDGLGLNKDEFEVRLHVRESI---AVVDPVEDLVVTLQFSNGNDSNVKMLRATHGTFVGQ 396

Query: 356 PQKNAILWKIRSFTGGKEYSMSAQMGLPSINAL--DKPKVKR-------PVQIKFQIPYF 406
            +     W+  S     E S      LP +     D   V++        V +++  P  
Sbjct: 397 DEDRQCSWRFDS----DEISAGT---LPVLRGCIDDSKHVQQKKRSCLTSVAVRYGYPGE 449

Query: 407 TTSGIQVRYL--KITEPKLLYKSYPWVRYITQ 436
             SG +V  L   +  P++  K +  VR +T+
Sbjct: 450 LASGCRVTRLDVDVASPRVRGKVFKGVRCVTR 481

>Suva_12.6 Chr12 (7704..9344) [1641 bp, 546 aa] {ON} YFR051C (REAL)
          Length = 546

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 36/183 (19%), Positives = 86/183 (46%), Gaps = 16/183 (8%)

Query: 1   MVSAVYFCDGKGRPILSRRYRD---DIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQY 57
           +V A      +G+P+LSR+++D   D  +  +  F  L+ ++  + + +        ++Y
Sbjct: 2   VVLAASITTRQGKPLLSRQFKDLSKDRVLELLANFQNLVAEISSDHTFVEDK----HVRY 57

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           ++   ++ Y++ L T+  +N+ +  A L+   + +  YL S  ++ +  N   I    DE
Sbjct: 58  VYRPFDNYYII-LITNRQSNIIKDLATLNLFSQTINSYLSSFHDQEIFHNAFEILSSFDE 116

Query: 118 MMDY-GIPQITETKMLKQYITQKSF--KLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHK 174
           ++   G  +      ++ Y++ +S   ++ + ++++K       E T     RA  I  K
Sbjct: 117 IVSMGGYKENLSFTQVQTYLSMESHEERIQEIIERNK-----EIEATEERKRRAKEIARK 171

Query: 175 KNE 177
           ++E
Sbjct: 172 EHE 174

>Kwal_26.9448 s26 complement(1221754..1223409) [1656 bp, 551 aa]
           {ON} YMR296C (LCB1) - Probable component of serine
           palmitoyltransferase, which catalyzes the first step in
           biosynthesis of long-chain sphingolipids [contig 73]
           FULL
          Length = 551

 Score = 37.4 bits (85), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 10/87 (11%)

Query: 67  VVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDN-------FIIIYELLDEMM 119
            VAL  +L  + + V+ F H  ME LEE L  ++E  V+DN       FI+   L   + 
Sbjct: 235 TVALQNALQLSRSTVYYFNHNDMESLEELLDQLQEREVKDNLPTIPRKFIVTEGLFHSLG 294

Query: 120 DY-GIPQITETKMLKQY--ITQKSFKL 143
           D   +P++ E K   +Y  +  ++F L
Sbjct: 295 DIPNLPKLVELKRKYKYRLVVDETFSL 321

>NDAI0G05210 Chr7 (1268117..1268587) [471 bp, 156 aa] {ON} Anc_1.388
          Length = 156

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 53/115 (46%), Gaps = 5/115 (4%)

Query: 29  IDKFAPLLLQLEEESSVIPPCLSHDGIQYLFIQHNDLYVVALATSLATNVAQVFAFLHKL 88
           I    PL+L  + +   I   L +   +  + ++  LY +   T    N       +HK 
Sbjct: 34  IKNLVPLILSRKAKMCNI---LEYSDHKVAYRRYASLYFICGITPDVDNELLTLEIIHKY 90

Query: 89  MEVLEEYLKSVEEESVRDNFIIIYELLDEMM--DYGIPQITETKMLKQYITQKSF 141
           +E +++Y  +V E  +  NF   Y++L+EM+  D  + + ++T +LK   T  S 
Sbjct: 91  VETMDQYFGNVCELDIIYNFTKAYDILNEMIMCDGSLAETSKTVVLKDVRTMDSM 145

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 33.9 bits (76), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 61/155 (39%), Gaps = 41/155 (26%)

Query: 153 APRPPTEVTNSVSWRAPNIVHKKNEAFLDIVESINMLMNQQG------------QVLRSE 200
           AP   T+    V WR+  +  ++NE ++D+ ES+ +++ +              Q++   
Sbjct: 195 APLQHTDEEEIVPWRSAKVNSRRNEFYVDVRESVEVVVERAAHRSTSRGTPAPLQLVTGC 254

Query: 201 IIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKFHQ 260
           I G +  +  LS  P +++  N+ G                          +L     H 
Sbjct: 255 ITGVVDCRCYLSRDPIVEVTFNNHG-------------------------CDLGTPALHD 289

Query: 261 CVRLSKF----ENEKIITFIPPDGAFELMNYRLSM 291
           CV L        +   + FIPPDG F LM Y +++
Sbjct: 290 CVELDGVPEGPADHTTLKFIPPDGKFRLMEYSVTL 324

>KAFR0J00130 Chr10 (23191..24822) [1632 bp, 543 aa] {ON} Anc_3.575
           YFR051C
          Length = 543

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 83/184 (45%), Gaps = 16/184 (8%)

Query: 1   MVSAVYFCDGKGRPILSRRYRD---DIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQY 57
           +V A       G+P+LSR+++D   D  +  +  F   L+ L+  S+     +  D ++Y
Sbjct: 2   VVLAASITTSNGKPLLSRQFKDLSRDRVLELLSNFQN-LVSLKHSSN--HTFVEDDHVRY 58

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKS-VEEESVRDNFIIIYELLD 116
           ++   +D Y++ L T+  +N+ Q  + L+   + +  +L +  ++  + +    I    D
Sbjct: 59  VYKPFDDFYII-LITNRQSNIVQDLSTLNLFSQTINAFLNNQFDQYEIYNKAFEILSSFD 117

Query: 117 EMMDY-GIPQITETKMLKQYITQKSF--KLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVH 173
           E++   G  +      +  YI  +S   K+ + ++++K       E T     RA  I  
Sbjct: 118 EIVSMGGYKEHLSLNQVNTYIAMESHEEKIQEIIERNK-----EIEATEERKRRAKEIAR 172

Query: 174 KKNE 177
           K+ E
Sbjct: 173 KEQE 176

>ZYRO0E05236g Chr5 complement(399318..399788) [471 bp, 156 aa] {ON}
           highly similar to uniprot|P35181 Saccharomyces
           cerevisiae YLR170C APS1 Small subunit of the clathrin-
           associated adaptor complex AP-1 which is involved in
           protein sorting at the trans-Golgi network homolog of
           the sigma subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 31/62 (50%)

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           ++ ++  LY +   T  A N       +H+ +E ++ Y  +V E  +  NF   Y +LDE
Sbjct: 60  VYRRYASLYFICGITPEADNELLTLEIIHRYVETMDTYFGNVCELDIIFNFGKAYAILDE 119

Query: 118 MM 119
           M+
Sbjct: 120 ML 121

>KLLA0B06545g Chr2 (583095..583541) [447 bp, 148 aa] {ON} highly
           similar to uniprot|Q00381 Saccharomyces cerevisiae
           YJR058C APS2 Small subunit of the clathrin- associated
           adaptor complex AP-2 which is involved in protein
           sorting at the plasma membrane related to the sigma
           subunit of the mammalian plasma membrane clathrin-
           associated protein (AP-2) complex
          Length = 148

 Score = 32.3 bits (72), Expect = 1.2,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 28/54 (51%)

Query: 85  LHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMDYGIPQITETKMLKQYITQ 138
           +H  +EVL+ +  +V E  +  NF   Y ++DEM   G  Q T  K L + I Q
Sbjct: 90  IHLFVEVLDSFFGNVCELDILFNFYKTYLVMDEMFIAGEIQTTSKKELLERIGQ 143

>TBLA0A01260 Chr1 (299419..299889) [471 bp, 156 aa] {ON} Anc_1.388
           YLR170C
          Length = 156

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 31/59 (52%)

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMM 119
           ++  LY +   T+   N   +   +H+ +E ++ Y  +V E  +  NF   Y++LDEM+
Sbjct: 63  RYASLYFICGITAEVDNELLILEVIHRYVEAMDSYFGNVCELDIIFNFSKAYDILDEMI 121

>KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highly
           similar to uniprot|P35181 Saccharomyces cerevisiae
           YLR170C APS1 Small subunit of the clathrin- associated
           adaptor complex AP-1 which is involved in protein
           sorting at the trans-Golgi network homolog of the sigma
           subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/87 (21%), Positives = 45/87 (51%), Gaps = 2/87 (2%)

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           ++ ++  LY +   +S + N       +H+ +E ++ Y  +V E  +  NF   YE+L+E
Sbjct: 60  VYKRYASLYFICGISSDSDNELLTLEVIHRYVEAMDSYFNNVCELDIIFNFTKAYEILNE 119

Query: 118 MM--DYGIPQITETKMLKQYITQKSFK 142
           ++  D  + + ++  +L+  +T  S +
Sbjct: 120 VLVCDGSMTETSKQAILRSVMTMDSLE 146

>TDEL0A06390 Chr1 (1117890..1122350) [4461 bp, 1486 aa] {ON}
           Anc_8.694 YPL167C
          Length = 1486

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 65/140 (46%), Gaps = 10/140 (7%)

Query: 89  MEVLEEYLKSVEEESVRDNFIIIYELLDEMMDY-GIPQITETK-MLKQYITQKSFKLMKA 146
           ++VL +++++V++   RD      E LD+       P ++ TK ++++   Q+    + A
Sbjct: 263 IDVLPQFIRNVDDVHFRDLHHNFCEKLDDTSKLLSKPFVSSTKNIIREISAQRQALSLDA 322

Query: 147 VKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQI- 205
              S + PR    V  +V W++ N+   K E  +    S+N   N    V  S  I  + 
Sbjct: 323 FMASASIPRL---VDENVQWQSSNMFEGKFEKAVSQSGSLNTGTNFHNYVQSSAAIDTVK 379

Query: 206 KVKSKLSGM----PDLKLGI 221
           K++  +S +    PDL L +
Sbjct: 380 KIRDSISELWPRRPDLNLDL 399

>YJR058C Chr10 complement(544732..545175) [444 bp, 147 aa] {ON}
           APS2Small subunit of the clathrin-associated adaptor
           complex AP-2, which is involved in protein sorting at
           the plasma membrane; related to the sigma subunit of the
           mammalian plasma membrane clathrin-associated protein
           (AP-2) complex
          Length = 147

 Score = 31.6 bits (70), Expect = 1.8,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 53  DGIQYLFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIY 112
           D  + ++ ++  LY V +   L  +       +H  +EVL+ +  +V E  +  NF  +Y
Sbjct: 58  DSTKLIYRRYAGLYFV-MGVDLLDDEPIYLCHIHLFVEVLDAFFGNVCELDIVFNFYKVY 116

Query: 113 ELLDEMMDYG-IPQITETKMLKQ 134
            ++DEM   G I +I++  +L++
Sbjct: 117 MIMDEMFIGGEIQEISKDMLLER 139

>Smik_10.348 Chr10 complement(533694..534137) [444 bp, 147 aa] {ON}
           YJR058C (REAL)
          Length = 147

 Score = 31.2 bits (69), Expect = 2.3,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 53  DGIQYLFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIY 112
           D  + ++ ++  LY V +   L  +       +H  +EVL+ +  +V E  +  NF  +Y
Sbjct: 58  DSTKLVYRRYAGLYFV-MGVDLLDDEPIYLCHIHLFVEVLDAFFGNVCELDIVFNFYKVY 116

Query: 113 ELLDEMMDYG-IPQITETKMLKQ 134
            ++DEM   G I +I++  +L++
Sbjct: 117 MIMDEMFIGGEIQEISKDMLLER 139

>Kwal_27.10020 s27 (161799..162242) [444 bp, 147 aa] {ON} YJR058C
           (APS2) - Clathrin-associated protein, small subunit
           [contig 43] FULL
          Length = 147

 Score = 31.2 bits (69), Expect = 2.7,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 42/84 (50%), Gaps = 1/84 (1%)

Query: 53  DGIQYLFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIY 112
           D  + ++ ++  LY V +   L        + +H L+EVL+ +  +V E  +  NF   Y
Sbjct: 58  DSTKLVYKRYAGLYFV-MGVGLQDEELIYLSHIHLLVEVLDAFFGNVCELDIVFNFHKAY 116

Query: 113 ELLDEMMDYGIPQITETKMLKQYI 136
            +LDE++  G  Q T  ++L + I
Sbjct: 117 MILDELIIGGEIQETSKEVLLERI 140

>CAGL0L08800g Chr12 (960646..961200) [555 bp, 184 aa] {ON} highly
           similar to uniprot|P53600 Saccharomyces cerevisiae
           YPL010w RET3 coatomer complex zeta chain
          Length = 184

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 59/133 (44%), Gaps = 16/133 (12%)

Query: 2   VSAVYFCDGKGRPILSRRYRDDIPISAI-DKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60
           V AV   DG+G  + S+ Y    P   + D    +  Q + E  +       D    LF 
Sbjct: 7   VQAVLILDGQGERVFSKYYV--APHGGVEDNVFDVKKQRKFEKELFAKTHKQDSEILLFD 64

Query: 61  QHNDLY------VVALATSLATN---VAQVF-AFLHKLMEVLEEYLKSVEEESVRDNFII 110
            H  LY       + L  SL  N   + QVF AF   L  +L      ++++++++N+ +
Sbjct: 65  DHLVLYKEYIDVTLCLVASLEENEIVLQQVFSAFKGSLDLILN---SGIDKKNIQENYDM 121

Query: 111 IYELLDEMMDYGI 123
           +   +DEM+D G+
Sbjct: 122 VVLAIDEMIDNGV 134

>TDEL0F00550 Chr6 (94104..94547) [444 bp, 147 aa] {ON} Anc_1.505
           YJR058C
          Length = 147

 Score = 30.8 bits (68), Expect = 3.6,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 53  DGIQYLFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIY 112
           D  + ++ ++  LY V +   L    +   + +H  +EVL+ +  +V E  +  NF   Y
Sbjct: 58  DSTKLVYKRYAGLYFV-MGVDLQDEESIYLSHIHLFVEVLDAFFGNVCELDIVFNFYKAY 116

Query: 113 ELLDEMMDYG-IPQITETKMLKQ 134
            ++DEM   G I +I++  +L++
Sbjct: 117 MVMDEMFIGGEIQEISKDHLLER 139

>Ecym_3162 Chr3 (311476..311916) [441 bp, 146 aa] {ON} similar to
           Ashbya gossypii AFR370C
          Length = 146

 Score = 30.4 bits (67), Expect = 4.1,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 1/86 (1%)

Query: 53  DGIQYLFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIY 112
           D  + ++ ++  LY V +  SL  +     A +   +EVL+ +  +V E  +  NF   Y
Sbjct: 57  DRTKLVYRRYAGLYFV-MGVSLEEDGLLYLAHIQLFVEVLDLFFGNVCELDILFNFYKAY 115

Query: 113 ELLDEMMDYGIPQITETKMLKQYITQ 138
            ++DEM   G  + T  ++L   +TQ
Sbjct: 116 MVMDEMFIGGELRETSKELLLDRLTQ 141

>TDEL0B06190 Chr2 complement(1094337..1094807) [471 bp, 156 aa] {ON}
           Anc_1.388 YLR170C
          Length = 156

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           ++ ++  LY +   T    N       +H+ +E ++ Y  +V E  +  NF   YE+L+E
Sbjct: 60  VYRRYASLYFICGITPEYDNELLTLELIHRYVETMDSYFGNVCELDIIFNFSRAYEILNE 119

Query: 118 MM--DYGIPQITETKMLKQ 134
           M+  D  I +  + ++L+Q
Sbjct: 120 MIMCDGSIAESGKAEVLQQ 138

>Suva_12.147 Chr12 complement(222523..222966) [444 bp, 147 aa] {ON}
           YJR058C (REAL)
          Length = 147

 Score = 30.4 bits (67), Expect = 4.9,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 53  DGIQYLFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIY 112
           D  + ++ ++  LY V +   L  +       +H  +EVL+ +  +V E  +  NF   Y
Sbjct: 58  DSTKLIYRRYAGLYFV-MGVDLLDDEPIYLCHIHLFVEVLDAFFGNVCELDIVFNFYKAY 116

Query: 113 ELLDEMMDYG-IPQITETKMLKQ 134
            ++DEM   G I +I++  +L++
Sbjct: 117 MIMDEMFIGGEIQEISKDMLLER 139

>SAKL0D08074g Chr4 complement(673663..674133) [471 bp, 156 aa] {ON}
           highly similar to uniprot|P35181 Saccharomyces
           cerevisiae YLR170C APS1 Small subunit of the clathrin-
           associated adaptor complex AP-1 which is involved in
           protein sorting at the trans-Golgi network homolog of
           the sigma subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 43/87 (49%), Gaps = 2/87 (2%)

Query: 50  LSHDGIQYLFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFI 109
           L ++  + ++ ++  LY V   +    N       +H+ +E ++ Y  +V E  +  NF 
Sbjct: 52  LEYNDHKVVYKRYASLYFVCGVSPDKDNELLTLEIIHRFVETMDRYFGNVCELDIIFNFN 111

Query: 110 IIYELLDEMM--DYGIPQITETKMLKQ 134
             Y +LDE++  D  I + ++ ++LK 
Sbjct: 112 KAYSILDEVLICDGSITETSKKEVLKH 138

>Skud_10.282 Chr10 complement(502270..502713) [444 bp, 147 aa] {ON}
           YJR058C (REAL)
          Length = 147

 Score = 30.0 bits (66), Expect = 5.7,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 53  DGIQYLFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIY 112
           D  + ++ ++  LY V +   L  +       +H  +EVL+ +  +V E  +  NF   Y
Sbjct: 58  DSTKLIYRRYAGLYFV-MGVDLLDDEPIYLCHIHLFVEVLDAFFGNVCELDIVFNFYKAY 116

Query: 113 ELLDEMMDYG-IPQITETKMLKQ 134
            ++DEM   G I +I++  +L++
Sbjct: 117 MIMDEMFIGGEIQEISKDMLLER 139

>CAGL0B04983g Chr2 (484166..484636) [471 bp, 156 aa] {ON} highly
           similar to uniprot|P35181 Saccharomyces cerevisiae
           YLR170c APS1 Clathrin coat assembly protein AP19
          Length = 156

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           +F ++  LY +   T    N       +H+ +E ++ Y ++V E  +  NF   Y++LDE
Sbjct: 60  VFRRYASLYFICGITIGHDNELLTLELIHRYVETMDTYFENVCELDIIFNFHKAYDILDE 119

Query: 118 --MMDYGIPQITETKMLKQ 134
             M D  I + ++ ++L  
Sbjct: 120 LVMCDGAIAESSKKEVLHH 138

>AFR124W Chr6 (662389..662859) [471 bp, 156 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR170C (APS1)
          Length = 156

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 85  LHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE--MMDYGIPQITETKMLKQYITQKS 140
           +H+ +E ++ Y  +V E  +  NF   Y +LDE  M D    + ++T +LK   T  S
Sbjct: 87  IHRFVETMDRYFGNVCELDIIFNFTRAYNILDELIMCDGSFVESSKTDVLKNMATMDS 144

>Smik_12.232 Chr12 complement(447707..448177) [471 bp, 156 aa] {ON}
           YLR170C (REAL)
          Length = 156

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 31/59 (52%)

Query: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMM 119
           ++  L+ +   TS   N       +H+ +E ++ Y  +V E  +  NF  +Y++L+EM+
Sbjct: 63  RYASLFFIVGVTSDVDNELLTLEVIHRFVETMDTYFGNVCELDIIFNFNKVYDILNEMI 121

>NDAI0K00890 Chr11 complement(197412..199520) [2109 bp, 702 aa] {ON}
           Anc_8.762 YMR232W
          Length = 702

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 7/59 (11%)

Query: 256 LKFHQCVRLSKFENEKIITFIP---PDGAFELMNYRLSMP---VKPLIWCDVNVQVHSQ 308
           L +  C++LSKF+N ++I   P    D   EL+N +LSM    V   I CD  VQV  +
Sbjct: 257 LWYEHCIKLSKFQNLEVILSRPIKRIDELIELLN-KLSMNSAGVVNTILCDNIVQVREE 314

>YJL036W Chr10 (378825..380096) [1272 bp, 423 aa] {ON}  SNX4Sorting
           nexin, involved in retrieval of late-Golgi SNAREs from
           post-Golgi endosomes to the trans-Golgi network and in
           cytoplasm to vacuole transport; contains a PX
           phosphoinositide-binding domain; forms complexes with
           Snx41p and with Atg20p
          Length = 423

 Score = 30.8 bits (68), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 124 PQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFLDIV 183
           P ++++K+ K ++  K ++  + V +    P    EVT++    A   VHK+NE F +I 
Sbjct: 138 PDLSQSKVFKTFLVSKDWESHRKVLQDSLQPNKD-EVTDAF-MNAFKTVHKQNEEFTEIR 195

Query: 184 ESINML 189
           E  + L
Sbjct: 196 EKSDKL 201

>TBLA0B06600 Chr2 (1551799..1553736) [1938 bp, 645 aa] {ON}
           Anc_5.165 YJL019W
          Length = 645

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 391 PKVKRPVQIKFQIPYFTTSGIQVRYLKIT 419
           P+ K P  IK +IPY T   +  RY+K+T
Sbjct: 476 PRTKIPSNIKEEIPYLTPHQLDSRYIKLT 504

>YLR170C Chr12 complement(500579..501049) [471 bp, 156 aa] {ON}
           APS1Small subunit of the clathrin-associated adaptor
           complex AP-1, which is involved in protein sorting at
           the trans-Golgi network; homolog of the sigma subunit of
           the mammalian clathrin AP-1 complex
          Length = 156

 Score = 29.6 bits (65), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 32/62 (51%)

Query: 58  LFIQHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117
           ++ ++  LY +   T    N       +H+ +E ++ Y  +V E  +  NF  +Y++L+E
Sbjct: 60  VYKRYASLYFIVGMTPDVDNELLTLEIIHRFVETMDTYFGNVCELDIIFNFSKVYDILNE 119

Query: 118 MM 119
           M+
Sbjct: 120 MI 121

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,510,166
Number of extensions: 2064131
Number of successful extensions: 6291
Number of sequences better than 10.0: 158
Number of HSP's gapped: 6274
Number of HSP's successfully gapped: 198
Length of query: 447
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 334
Effective length of database: 40,524,141
Effective search space: 13535063094
Effective search space used: 13535063094
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)