Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C05214g7.126ON2702417831e-104
SAKL0F05368g7.126ON2311325501e-69
KAFR0K012007.126ON2021325358e-68
TDEL0H028807.126ON3541325452e-67
Ecym_83517.126ON2241325324e-67
NDAI0H013107.126ON2611325354e-67
Smik_9.1847.126ON2141325184e-65
Kwal_55.208397.126ON3051325256e-65
YIL010W (DOT5)7.126ON2151325141e-64
Suva_9.1947.126ON2151325132e-64
TBLA0A009407.126ON2881325175e-64
Kpol_1062.577.126ON2191325107e-64
ADL018W7.126ON2441325066e-63
NCAS0F008107.126ON2311325056e-63
Skud_9.1627.126ON2171325037e-63
CAGL0C03850g7.126ON2091325002e-62
KLLA0D14333g7.126ON2051324983e-62
KNAG0G010207.126ON2071324983e-62
KLTH0F12562g7.126ON2931324715e-57
TPHA0C043307.126ON2091324575e-56
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C05214g
         (270 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some si...   306   e-104
SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {O...   216   1e-69
KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {O...   210   8e-68
TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.1...   214   2e-67
Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON} ...   209   4e-67
NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.12...   210   4e-67
Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W (...   204   4e-65
Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W...   206   6e-65
YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear...   202   1e-64
Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W (...   202   2e-64
TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.12...   203   5e-64
Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {...   201   7e-64
ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic hom...   199   6e-63
NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.12...   199   6e-63
Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W (...   198   7e-63
CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {O...   197   2e-62
KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa] ...   196   3e-62
KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON...   196   3e-62
KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} simil...   186   5e-57
TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON...   180   5e-56

>ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some
           similarities with uniprot|P40553 Saccharomyces
           cerevisiae YIL010W DOT5 Nuclear thiol peroxidase
          Length = 270

 Score =  306 bits (783), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 163/241 (67%), Positives = 163/241 (67%)

Query: 1   MAGLRRSTRLSSKEDTLKNRPEENESTQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXF 60
           MAGLRRSTRLSSKEDTLKNRPEENESTQ                               F
Sbjct: 1   MAGLRRSTRLSSKEDTLKNRPEENESTQPPKKKSKKSDDNESLGEEEGDEEEESEGDSDF 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPIPDILLKNQDGKEISLKKVSDEH 120
                                              DPIPDILLKNQDGKEISLKKVSDEH
Sbjct: 61  KEQEGEGEGEGEGKEEEEEEEEEEEPEEAKELEEGDPIPDILLKNQDGKEISLKKVSDEH 120

Query: 121 KIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAAVFGLSADTVNAQKKFQEKQHLPFDL 180
           KIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAAVFGLSADTVNAQKKFQEKQHLPFDL
Sbjct: 121 KIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAAVFGLSADTVNAQKKFQEKQHLPFDL 180

Query: 181 LSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLKHKRVKISPEVSIXXXXXXXXXXXXQ 240
           LSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLKHKRVKISPEVSI            Q
Sbjct: 181 LSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLKHKRVKISPEVSIEEGKKEVLELVKQ 240

Query: 241 F 241
           F
Sbjct: 241 F 241

>SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {ON}
           highly similar to gnl|GLV|KLLA0D14333g Kluyveromyces
           lactis KLLA0D14333g and similar to YIL010W
           uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 231

 Score =  216 bits (550), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 95/132 (71%), Positives = 116/132 (87%)

Query: 96  DPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAA 155
           D IPD++LKNQD K+ISLK+++ +++IVV F YPKASTPGCTRQ CG+RDNYED+KEHAA
Sbjct: 78  DDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTRQVCGYRDNYEDLKEHAA 137

Query: 156 VFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLK 215
           VFGLSADT  AQK FQ KQ LP+DLLSDP+R  +GLLGAKK+P+SG+IRSHWVF++G L+
Sbjct: 138 VFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTPQSGVIRSHWVFSEGKLR 197

Query: 216 HKRVKISPEVSI 227
            KRVKISPE S+
Sbjct: 198 FKRVKISPETSV 209

>KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {ON}
           Anc_7.126 YIL010W
          Length = 202

 Score =  210 bits (535), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 92/132 (69%), Positives = 118/132 (89%)

Query: 96  DPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAA 155
           D +PDI L NQD ++ISL++V+  +KI+V+F YPKASTPGCTRQACGFRDNY++IK+HAA
Sbjct: 55  DIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNYDEIKKHAA 114

Query: 156 VFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLK 215
           VFGLSAD+V +QK+FQEKQ+LPF+LLSDP+R L+G+LGAKK+P+SGIIRSHWVF DG L+
Sbjct: 115 VFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSHWVFLDGKLR 174

Query: 216 HKRVKISPEVSI 227
            + +K+SPE SI
Sbjct: 175 FRNIKVSPERSI 186

>TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.126
           YIL010W
          Length = 354

 Score =  214 bits (545), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 95/132 (71%), Positives = 114/132 (86%)

Query: 96  DPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAA 155
           D IPD+ L+NQDGK++SL+ V+ EHKI++IF YPKASTPGCTRQACG+RDNY+++KEHAA
Sbjct: 206 DEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTRQACGYRDNYDELKEHAA 265

Query: 156 VFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLK 215
           VFGLS D  +AQKKFQ KQ LPFDLL DP R L+G LGAKK+ +SG +RSHWVF DG LK
Sbjct: 266 VFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTAQSGTLRSHWVFFDGKLK 325

Query: 216 HKRVKISPEVSI 227
           +KRVK+SPEVSI
Sbjct: 326 YKRVKVSPEVSI 337

>Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADL018W
          Length = 224

 Score =  209 bits (532), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 88/132 (66%), Positives = 117/132 (88%)

Query: 96  DPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAA 155
           D +P+I LKNQD KE++LK V+ ++KIV+IF YPKA+TPGCTRQACGFRDNYE++++HA 
Sbjct: 75  DNVPEIALKNQDDKEVNLKDVAKKNKIVLIFAYPKANTPGCTRQACGFRDNYEELQKHAV 134

Query: 156 VFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLK 215
           +FG+S+D+V +QK FQ KQHLPFDLLSDP+R L+G+LGAKK+ ++G+IRSHW+F +G LK
Sbjct: 135 IFGISSDSVKSQKAFQSKQHLPFDLLSDPDRELIGMLGAKKTAQAGVIRSHWIFCNGKLK 194

Query: 216 HKRVKISPEVSI 227
           +KRVK+SPE SI
Sbjct: 195 YKRVKVSPETSI 206

>NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.126
           YIL010W
          Length = 261

 Score =  210 bits (535), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 88/132 (66%), Positives = 118/132 (89%)

Query: 96  DPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAA 155
           D IPDI L NQ+GKEISLK+++  +KI+VIF +P+ASTPGCTRQACGFRDNY+++K++A 
Sbjct: 113 DDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDELKKNAI 172

Query: 156 VFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLK 215
           VFGLSAD +++QKKF+EKQHLP+DLLSDP+R L+GLLGAKK+P+SG +RS+W+F +G L 
Sbjct: 173 VFGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFVEGKLS 232

Query: 216 HKRVKISPEVSI 227
            KR+K+SPE+S+
Sbjct: 233 IKRIKVSPEISV 244

>Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W
           (REAL)
          Length = 214

 Score =  204 bits (518), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 92/132 (69%), Positives = 115/132 (87%)

Query: 96  DPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAA 155
           DPIPD+ L ++D   ISLKK+++E+KIVV F YPKASTPGCTRQACGFRDNY+D+K+H+A
Sbjct: 67  DPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDNYDDLKKHSA 126

Query: 156 VFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLK 215
           VFGLS+D+V +QK+FQ KQ+LP+ LLSDP+R  +GLLGAKK+P SG IRSH+VF DG L+
Sbjct: 127 VFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFVDGKLR 186

Query: 216 HKRVKISPEVSI 227
            KRVKISPEVS+
Sbjct: 187 FKRVKISPEVSV 198

>Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W
           (DOT5) - involved in telomeric silencing [contig 138]
           FULL
          Length = 305

 Score =  206 bits (525), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 95/132 (71%), Positives = 113/132 (85%), Gaps = 1/132 (0%)

Query: 96  DPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAA 155
           D +PD++LKNQD +E+SLKKV+ E+K+V+IF YPKASTPGCT QACGFRDNYED+KE  A
Sbjct: 51  DEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYEDLKEVGA 110

Query: 156 VFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLK 215
           VFGLSADT  AQ+KFQ+   LPFDLLSDP+R L+GLLGAKKSP SG  RSHWVFA+G L 
Sbjct: 111 VFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSP-SGTKRSHWVFANGKLI 169

Query: 216 HKRVKISPEVSI 227
           +KR+ +SPEVSI
Sbjct: 170 NKRIAVSPEVSI 181

>YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear
           thiol peroxidase which functions as an
           alkyl-hydroperoxide reductase during post-diauxic growth
          Length = 215

 Score =  202 bits (514), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 114/132 (86%)

Query: 96  DPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAA 155
           DPIPD+ L N+D   ISLKK+++ +++VV F YP+ASTPGCTRQACGFRDNY+++K++AA
Sbjct: 67  DPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGCTRQACGFRDNYQELKKYAA 126

Query: 156 VFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLK 215
           VFGLSAD+V +QKKFQ KQ+LP+ LLSDP+R  +GLLGAKK+P SG IRSH++F DG LK
Sbjct: 127 VFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFIFVDGKLK 186

Query: 216 HKRVKISPEVSI 227
            KRVKISPEVS+
Sbjct: 187 FKRVKISPEVSV 198

>Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W
           (REAL)
          Length = 215

 Score =  202 bits (513), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 95/132 (71%), Positives = 112/132 (84%)

Query: 96  DPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAA 155
           D IPD+ L N+D   +SLK+++ E+KIVV F YPKASTPGCTRQACGFRDNYED+KEHAA
Sbjct: 67  DDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDLKEHAA 126

Query: 156 VFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLK 215
           VFGLSAD+V +QKKFQ KQ LP+ LLSDP+R  +GLLGAKK+P SG IRSH+VF DG L+
Sbjct: 127 VFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFVDGKLR 186

Query: 216 HKRVKISPEVSI 227
            KRVKISPEVS+
Sbjct: 187 FKRVKISPEVSV 198

>TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.126
           YIL010W
          Length = 288

 Score =  203 bits (517), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 111/132 (84%)

Query: 96  DPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAA 155
           D +PD  LKNQ+ + ISLKKV +E++IVVIF YPKA+TPGCTRQACG RDNY D+K++A 
Sbjct: 131 DEVPDFELKNQNNETISLKKVMEENRIVVIFAYPKANTPGCTRQACGMRDNYNDLKKYAV 190

Query: 156 VFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLK 215
           VFG+SAD+V+AQK FQEKQ+LP+DLLSD  R L+G LG KK+P SGIIRSH++  +G LK
Sbjct: 191 VFGISADSVSAQKSFQEKQNLPYDLLSDKNRELIGALGCKKTPTSGIIRSHFIIVNGKLK 250

Query: 216 HKRVKISPEVSI 227
            KRVKISPEVS+
Sbjct: 251 FKRVKISPEVSV 262

>Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {ON}
           complement(128150..128809) [660 nt, 220 aa]
          Length = 219

 Score =  201 bits (510), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 115/132 (87%)

Query: 96  DPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAA 155
           D IPD+ L+NQDG +ISL++++ ++ I+V F YP+A TPGCTRQACGFRD Y+D+K+HAA
Sbjct: 72  DEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDTYDDLKKHAA 131

Query: 156 VFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLK 215
           VFGLSAD+ ++QKKFQ+K  LP+DLLSDP+R  +GLLGAKK+P+SGIIRSH++F DG L+
Sbjct: 132 VFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIRSHFIFVDGKLR 191

Query: 216 HKRVKISPEVSI 227
            KR+KISPE+S+
Sbjct: 192 FKRIKISPEISV 203

>ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL010W (DOT5)
          Length = 244

 Score =  199 bits (506), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 111/132 (84%)

Query: 96  DPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAA 155
           D +P+I LKNQD  ++ L  V  ++KIVV+F YPKASTPGCTRQACGFRDNY+++++HA 
Sbjct: 91  DVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYPKASTPGCTRQACGFRDNYQELQKHAV 150

Query: 156 VFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLK 215
           VFG+SAD+V +QK FQ+KQ LPFDLLSDP+R L+G LGA+K+ ++G+IRSHWVF DG L 
Sbjct: 151 VFGISADSVKSQKSFQQKQKLPFDLLSDPKRELIGALGARKTAQTGVIRSHWVFVDGKLG 210

Query: 216 HKRVKISPEVSI 227
            KR+KISPE+SI
Sbjct: 211 SKRIKISPEMSI 222

>NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.126
           YIL010W
          Length = 231

 Score =  199 bits (505), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 88/132 (66%), Positives = 115/132 (87%)

Query: 96  DPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAA 155
           D IPDI+L +++G  +SLKKV +E+KIVV F +PKA+TPGCTRQACGFRDNY+++KEHAA
Sbjct: 87  DDIPDIILPDEEGVSVSLKKVVEENKIVVFFAFPKANTPGCTRQACGFRDNYKELKEHAA 146

Query: 156 VFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLK 215
           V+G+SAD V AQKKF+ KQ+LP+ LLSD +R  +GLLGAKK+P+SG+IRS+++F DG LK
Sbjct: 147 VYGISADPVTAQKKFKTKQNLPYSLLSDSKRDFIGLLGAKKTPQSGVIRSYFIFVDGKLK 206

Query: 216 HKRVKISPEVSI 227
            KRVKISPE+S+
Sbjct: 207 VKRVKISPELSV 218

>Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W
           (REAL)
          Length = 217

 Score =  198 bits (503), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 91/132 (68%), Positives = 112/132 (84%)

Query: 96  DPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAA 155
           D IPD+ L ++D   ISLK+++ E+KIVV F YPKASTPGCTRQACGFRDNYED+K+HAA
Sbjct: 67  DSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDLKKHAA 126

Query: 156 VFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLK 215
           VFGLSAD V +QKKFQ KQ+LP+ L+SDP+R  +GLLGAKK+P SG IRSH+VF +G L+
Sbjct: 127 VFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHFVFVNGKLR 186

Query: 216 HKRVKISPEVSI 227
            KR+KISPEVS+
Sbjct: 187 FKRIKISPEVSV 198

>CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {ON}
           similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010w DOT5 involved in derepression of telomeric
           silencing
          Length = 209

 Score =  197 bits (500), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 110/132 (83%)

Query: 96  DPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAA 155
           D IPDI L+NQDGK++SLK ++ E+K+++IF YPKASTPGCTRQACGFRDN++D+KEH  
Sbjct: 62  DDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLKEHGL 121

Query: 156 VFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLK 215
           V GLS DT  AQ KF+EK  LP+DLL DP R  +G+LGAKK+P SG IRSH+VFADG LK
Sbjct: 122 VLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFADGKLK 181

Query: 216 HKRVKISPEVSI 227
            KR+KISPE+S+
Sbjct: 182 FKRLKISPEISV 193

>KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa]
           {ON} similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010W DOT5 Nuclear thiol peroxidase
          Length = 205

 Score =  196 bits (498), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 88/132 (66%), Positives = 109/132 (82%)

Query: 96  DPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAA 155
           D IPD+ L NQD + ISLK+V+ ++K+VV F YPKASTPGCTRQACG+RDNY ++KEHAA
Sbjct: 60  DDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYSELKEHAA 119

Query: 156 VFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLK 215
           VFGLSAD   +QK FQ KQ LPFDLLSDP+R  +G LGAKK+  SG++RSHW+F +G L+
Sbjct: 120 VFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWIFKNGKLE 179

Query: 216 HKRVKISPEVSI 227
            KRV++SPEVSI
Sbjct: 180 VKRVQVSPEVSI 191

>KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON}
           Anc_7.126 YIL010W
          Length = 207

 Score =  196 bits (498), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 83/132 (62%), Positives = 114/132 (86%)

Query: 96  DPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAA 155
           D IPD+ L +Q+G+ +SL +V+  +KI+VIF YP+ASTPGCTRQACGFRDNY ++K+HAA
Sbjct: 62  DEIPDLTLVDQEGELVSLTEVASNNKILVIFAYPRASTPGCTRQACGFRDNYAELKKHAA 121

Query: 156 VFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLK 215
           V+GLSADTV +QKKFQ KQ+LP++LLSDP+R  +G+LGAKK+ +SGIIRS+W+F +G L+
Sbjct: 122 VYGLSADTVASQKKFQTKQNLPYNLLSDPKREFIGVLGAKKTSQSGIIRSYWIFFNGKLR 181

Query: 216 HKRVKISPEVSI 227
            K++K+SPE S+
Sbjct: 182 IKKIKVSPEASV 193

>KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} similar
           to uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 293

 Score =  186 bits (471), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 87/132 (65%), Positives = 111/132 (84%), Gaps = 1/132 (0%)

Query: 96  DPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAA 155
           D +PD++LKNQ+G+E+SLK V  ++K+VV+F YPKASTPGCT+QACGFRDNYE++K++AA
Sbjct: 48  DEVPDVVLKNQEGEEVSLKSVVQQNKVVVVFAYPKASTPGCTKQACGFRDNYEELKKNAA 107

Query: 156 VFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLK 215
           VFGLS DT NAQ+KF+EK  LPFDLLSDP+R L+G LGA KSP SG  RS+WVF  G L+
Sbjct: 108 VFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKRSYWVFVQGKLR 166

Query: 216 HKRVKISPEVSI 227
            KR+ +SPE S+
Sbjct: 167 TKRISVSPEASV 178

>TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON}
           Anc_7.126 YIL010W
          Length = 209

 Score =  180 bits (457), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 79/132 (59%), Positives = 110/132 (83%), Gaps = 1/132 (0%)

Query: 96  DPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAA 155
           D IPD+ L+NQ+G+E+SL+ ++ ++KI+ IF YP+ASTPGCTRQACGFRDN++D+K+++ 
Sbjct: 65  DEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFDDLKKYSL 124

Query: 156 VFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLK 215
           + GLS D++ AQK F+ KQ+LP+DLL D E+ L+ +LG KK P SGIIRS+++F DG LK
Sbjct: 125 ILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-SGIIRSYFIFVDGKLK 183

Query: 216 HKRVKISPEVSI 227
            KRVK+SPEVSI
Sbjct: 184 LKRVKVSPEVSI 195

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,462,025
Number of extensions: 622679
Number of successful extensions: 1505
Number of sequences better than 10.0: 23
Number of HSP's gapped: 1541
Number of HSP's successfully gapped: 24
Length of query: 270
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 162
Effective length of database: 41,097,471
Effective search space: 6657790302
Effective search space used: 6657790302
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)