Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C05192g7.125ON58858826020.0
TDEL0H028707.125ON58754618070.0
SAKL0F05390g7.125ON59550216950.0
NCAS0E021307.125ON52652716820.0
Smik_6.4677.125ON54852116820.0
YPL260W7.125ON55152616780.0
Suva_16.447.125ON54952616760.0
Skud_16.187.125ON55052816690.0
NDAI0E036707.125ON52252816240.0
KLLA0D14355g7.125ON58851016270.0
KLTH0F12540g7.125ON59551016060.0
Kwal_55.208327.125ON57551815830.0
CAGL0H09108g7.125ON53251315620.0
KNAG0L009407.125ON54952615180.0
Ecym_83527.125ON57952214860.0
TBLA0A009307.125ON58651814670.0
Kpol_322.77.125ON53451513590.0
TPHA0C016107.125ON55152413510.0
KAFR0L004607.125ON51149813460.0
ADL019W7.125ON52547713121e-176
Kpol_1062.587.125ON4914183516e-35
KLLA0A04884g4.105ON105957771.1
TBLA0G001802.16ON1016118733.4
NDAI0E048507.249ON66038699.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C05192g
         (588 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} simila...  1006   0.0  
TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.1...   700   0.0  
SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {...   657   0.0  
NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.1...   652   0.0  
Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON...   652   0.0  
YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative sub...   650   0.0  
Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W (...   650   0.0  
Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W (...   647   0.0  
NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.1...   630   0.0  
KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]...   631   0.0  
KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} simi...   623   0.0  
Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260...   614   0.0  
CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly...   606   0.0  
KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7....   589   0.0  
Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}...   577   0.0  
TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.1...   569   0.0  
Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON} (16650..18...   528   0.0  
TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.1...   525   0.0  
KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.12...   523   0.0  
ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic ho...   509   e-176
Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [14...   139   6e-35
KLLA0A04884g Chr1 (433581..436760) [3180 bp, 1059 aa] {ON} simil...    34   1.1  
TBLA0G00180 Chr7 complement(28577..31627) [3051 bp, 1016 aa] {ON...    33   3.4  
NDAI0E04850 Chr5 (1100709..1102691) [1983 bp, 660 aa] {ON} Anc_7...    31   9.0  

>ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} similar
           to Q08977 YPL260W uniprot|Q7LGU3 Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score = 1006 bits (2602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/588 (86%), Positives = 506/588 (86%)

Query: 1   MNHSTLSQDITSSQHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQV 60
           MNHSTLSQDITSSQHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQV
Sbjct: 1   MNHSTLSQDITSSQHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQV 60

Query: 61  LTRVRELDDVRKSNHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAP 120
           LTRVRELDDVRKSNHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAP
Sbjct: 61  LTRVRELDDVRKSNHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAP 120

Query: 121 AAYSSLSTVQRLLEHLNESNVFTMHDLRPIKERLIEIKKIVXXXXXXXXXXXXXXXXYLK 180
           AAYSSLSTVQRLLEHLNESNVFTMHDLRPIKERLIEIKKIV                YLK
Sbjct: 121 AAYSSLSTVQRLLEHLNESNVFTMHDLRPIKERLIEIKKIVEKSCEKNKEAAKEEEEYLK 180

Query: 181 NAPDLDEADRNLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLF 240
           NAPDLDEADRNLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLF
Sbjct: 181 NAPDLDEADRNLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLF 240

Query: 241 QIRRXXXXXXXXXXXXXXXXXXXXXLENKHVLAPESVNTRVELLQKELNEIESYRDETGK 300
           QIRR                     LENKHVLAPESVNTRVELLQKELNEIESYRDETGK
Sbjct: 241 QIRRELLSLAASAKKTTSSASAEKELENKHVLAPESVNTRVELLQKELNEIESYRDETGK 300

Query: 301 FKSPESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKTTLE 360
           FKSPESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKTTLE
Sbjct: 301 FKSPESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKTTLE 360

Query: 361 NLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAIIYK 420
           NLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAIIYK
Sbjct: 361 NLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAIIYK 420

Query: 421 XXXXXXXXXXXXXXXHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVDGKF 480
                          HNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVDGKF
Sbjct: 421 LLESSEPVSESLQPLHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVDGKF 480

Query: 481 YDLDGNIPEGQATLNALLAECFDIIHEMKIEAEEKTESETQSEAEGDGDDLRQTYSEAER 540
           YDLDGNIPEGQATLNALLAECFDIIHEMKIEAEEKTESETQSEAEGDGDDLRQTYSEAER
Sbjct: 481 YDLDGNIPEGQATLNALLAECFDIIHEMKIEAEEKTESETQSEAEGDGDDLRQTYSEAER 540

Query: 541 ENPRLARFLDNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSSIVRN 588
           ENPRLARFLDN                              GSSIVRN
Sbjct: 541 ENPRLARFLDNSYSTVEDDEDDDRSSPSSSSDQSVLDDSEVGSSIVRN 588

>TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.125
           YPL260W
          Length = 587

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/546 (65%), Positives = 421/546 (77%), Gaps = 21/546 (3%)

Query: 11  TSSQHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDV 70
           ++SQHPQ VP+EEE +LNY L +R LL QLKQNR +YL+SK+VQ  Y+QVLT+VRELD +
Sbjct: 10  SNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELDQI 69

Query: 71  RKSNHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQ 130
           RKSNH+TPS+SATTLIH+ ELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA Y+SLSTVQ
Sbjct: 70  RKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQ 129

Query: 131 RLLEHLNESNVFTMHDLRPIKERLIEIKKIVXXXXXXXXXXXXXXXXYLKNAPDLDE--- 187
           RLLEHLNESNVFT HDLRPI+ERL+EI KIV                   N  D+DE   
Sbjct: 130 RLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSG-------DNLEDIDEKLP 182

Query: 188 -ADRNLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRRXX 246
            ADR   EE  +NKIEEDLLLRAKLQHCLDEY+STE+KVE +DP L+ IM+KLF+IRR  
Sbjct: 183 EADRKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGL 242

Query: 247 XXXXXXXXXXXXXXXXXXXLENKHVLAPESVNTRVELLQKELNEIESYRDETGKFKSPES 306
                                 K  L+ E V+ +VE L+ +L E+ES+RDE GKFKS E+
Sbjct: 243 LSLAASSKRSNPSLE-------KSPLSQEHVHEQVEKLESQLTELESHRDENGKFKSLET 295

Query: 307 EQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKTTLENLLITR 366
           ++  +KGQNVLNGLL DC+DL+ DLSHQKNGGIELD +LQPIY +LIDIKT+LENLL+TR
Sbjct: 296 DKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSLENLLVTR 355

Query: 367 RWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAIIYKXXXXXX 426
           RWTLRETDLFT+QK+L EIDSLRV+ KFPTDSG +KGQ+ILLYLLRRC+AIIYK      
Sbjct: 356 RWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIYKLLESSE 415

Query: 427 XXXXXXXXXHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVDGKFYDLDGN 486
                    HNQLSTVRRCLL L+RMGG+NN RELYPYQMKLASLD LR DGKFYD DGN
Sbjct: 416 PVSESLQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGKFYDSDGN 475

Query: 487 IPEGQATLNALLAECFDIIHEMKIEAEEKTESET--QSEAEGDGDDLRQTYSEAERENPR 544
           IPEGQ TLNALLAECFDI+HE+KIEA+E+ E+E+  QSEAE D   +  T ++ + + P 
Sbjct: 476 IPEGQGTLNALLAECFDIVHELKIEAQERAETESAQQSEAEQDDGLVNDTDNDNDGDQP- 534

Query: 545 LARFLD 550
           +AR+LD
Sbjct: 535 VARYLD 540

>SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {ON}
           highly similar to gnl|GLV|CAGL0H09108g Candida glabrata
           CAGL0H09108g and similar to Q08977 YPL260W
           uniprot|Q7LGU3 Saccharomyces cerevisiae Hypothetical ORF
          Length = 595

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/502 (64%), Positives = 388/502 (77%), Gaps = 4/502 (0%)

Query: 12  SSQHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDVR 71
           SS HPQ VP+EEE +LNYFL++R+ LS+LKQNR+++L+SK V  TY+QVLT+VRELDD R
Sbjct: 2   SSNHPQEVPKEEEEILNYFLDVRSFLSKLKQNRSQFLNSKDVMETYQQVLTKVRELDDTR 61

Query: 72  KSNHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQR 131
           KS+H TP+SSATTLIH+ +LHNRVDSVLDDVFQLLSL FLTVGLKNSAPA Y+SLSTVQR
Sbjct: 62  KSSHNTPASSATTLIHSVDLHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQR 121

Query: 132 LLEHLNESNVFTMHDLRPIKERLIEIKKIVXXXXXXXXXXXXXXXXYLKNAPDLDEADRN 191
           LLEHLNESNVFT HDLRPIKERL E+ +IV                    A + DE D  
Sbjct: 122 LLEHLNESNVFTHHDLRPIKERLDEVSEIVEKNSYRNEPENNKGKPQEPEAQE-DEQDIE 180

Query: 192 LSE---ETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRRXXXX 248
           L +   E  +NK+EEDLLLRAKL+HCL EY++ E+K+E +DP+L +IM+KLFQIRR    
Sbjct: 181 LKKADIEKDKNKVEEDLLLRAKLKHCLQEYFNIESKLEEIDPALQSIMEKLFQIRRGLLS 240

Query: 249 XXXXXXXXXXXXXXXXXLENKHVLAPESVNTRVELLQKELNEIESYRDETGKFKSPESEQ 308
                             +  H ++P  VN+++  LQ EL+E+ES+RD +GKFKS E+++
Sbjct: 241 LAASTKRNARSKESLEDKKRTHTVSPNFVNSKLNELQVELSELESHRDPSGKFKSLETDK 300

Query: 309 SAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKTTLENLLITRRW 368
             E+GQ+VLNGLL DC+DL+ DLSHQ + GI LD +LQPIY  LIDIKTTLENLL+TRRW
Sbjct: 301 VEERGQSVLNGLLDDCHDLINDLSHQTSRGISLDHKLQPIYDNLIDIKTTLENLLVTRRW 360

Query: 369 TLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAIIYKXXXXXXXX 428
           TLRETDLFTYQK LGEID+LRV+ KFPT+SGD+KGQ+ILLYLLRRCYAIIYK        
Sbjct: 361 TLRETDLFTYQKRLGEIDNLRVHGKFPTESGDSKGQSILLYLLRRCYAIIYKLLESSEPV 420

Query: 429 XXXXXXXHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVDGKFYDLDGNIP 488
                  HNQLSTVRRCLL L+RMGG+NN RELYPYQMKLASLD +RVDGKFYD DGNIP
Sbjct: 421 SEALQRIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDNMRVDGKFYDADGNIP 480

Query: 489 EGQATLNALLAECFDIIHEMKI 510
           EGQ TLNALLAECFDI+HE+KI
Sbjct: 481 EGQGTLNALLAECFDILHELKI 502

>NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.125
           YPL260W
          Length = 526

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/527 (62%), Positives = 398/527 (75%), Gaps = 23/527 (4%)

Query: 11  TSSQHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDV 70
           +++ HPQ VP+EEE +LNY L++R+ LS+LKQNRT+YL+SK VQ TY+ VLT+VRELD++
Sbjct: 6   SNTTHPQEVPKEEEDILNYLLDVRSFLSKLKQNRTQYLNSKDVQITYQNVLTKVRELDEI 65

Query: 71  RKSNHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQ 130
           RK++H+TPS SATTLIH+ ELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA Y+SLSTVQ
Sbjct: 66  RKNSHDTPSKSATTLIHSNELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQ 125

Query: 131 RLLEHLNESNVFTMHDLRPIKERLIEIKKIVXXXXXXXXXXXXXXXXYLKNAPDL---DE 187
            LLEHL+ESN+FT HDL PIK+RL EI KIV                     PD    D+
Sbjct: 126 SLLEHLSESNIFTHHDLSPIKDRLNEISKIVEKS--------------CGKLPDEQLNDD 171

Query: 188 ADRNLSE---ETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRR 244
            ++NL +   E  +NKIE+DLLLRAKLQHCLDEY   E+K+E +DPSL++ M+KLFQIRR
Sbjct: 172 EEQNLKDIDTERNKNKIEQDLLLRAKLQHCLDEYKQIESKLEEIDPSLTSTMEKLFQIRR 231

Query: 245 --XXXXXXXXXXXXXXXXXXXXXLENKHVLAPESVNTRVELLQKELNEIESYRDETGKFK 302
                                  LENKH+++ E VN ++  L+ E+  +E+ RDE+GKFK
Sbjct: 232 GLLSLAASTKKNMNQGSLTSEKELENKHLVSQEYVNKKLHALEAEVQALEANRDESGKFK 291

Query: 303 SPESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKTTLENL 362
           S E+ + AE GQNVLNGLL DC DL+ DLSHQ NG + LDP LQPIY  LIDIKTTLENL
Sbjct: 292 SLETNEVAENGQNVLNGLLDDCLDLINDLSHQTNGHLNLDPTLQPIYEMLIDIKTTLENL 351

Query: 363 LITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAIIYKXX 422
           +ITRRWTLRETDLFTYQK+LGEID++RV  +FPT   D+KGQ ILLYLLRRCYAIIYK  
Sbjct: 352 MITRRWTLRETDLFTYQKQLGEIDNMRVEGRFPTKHIDSKGQFILLYLLRRCYAIIYKLL 411

Query: 423 XXXXXXXXXXXXXHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVDGKFYD 482
                        HNQLSTVRRCL+ L+RMGG++N RELYPYQMKLASLD LRVDGKFYD
Sbjct: 412 ESSEPVSESLQPIHNQLSTVRRCLMELKRMGGVDNDRELYPYQMKLASLDNLRVDGKFYD 471

Query: 483 LDGNIPEGQATLNALLAECFDIIHEMKIEAEEKTESETQSEAEGDGD 529
            +GNIPEGQ TLNALLA CFDI+HE+K+EAEE+ E +++S+AE + D
Sbjct: 472 SEGNIPEGQGTLNALLAACFDIMHELKVEAEER-EEQSKSDAENNDD 517

>Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON}
           YPL260W (REAL)
          Length = 548

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/521 (62%), Positives = 389/521 (74%), Gaps = 26/521 (4%)

Query: 14  QHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDVRKS 73
           QHPQ VP+EEE +LNY LE+R+ L++LKQNRT+YL+SK VQ TY+ VLT+VRELDD+RK+
Sbjct: 8   QHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKN 67

Query: 74  NHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQRLL 133
           +HETP+ SA TLIHN ELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA Y+SLSTV+ LL
Sbjct: 68  SHETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL 127

Query: 134 EHLNESNVFTMHDLRPIKERLIEIKKIVXXXXXXXXXXXXXXXXYLKNAPDLDEADRNLS 193
           EHLNESNVFT HDL PIKERL EI KIV                   N    D+  R + 
Sbjct: 128 EHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTY----------NEDGNDDRLREID 177

Query: 194 EETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRRXXXXXXXXX 253
            E ++NKIEEDLLLRAKL+HC DEY + E+K+E +DPSLS++M+KLF+IRR         
Sbjct: 178 NERKKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVASA 237

Query: 254 XXXXXXXXXXXX----------------LENKHVLAPESVNTRVELLQKELNEIESYRDE 297
                                       +++KH+++ E V+ ++ +L+ ELNE+ES RD+
Sbjct: 238 KKTMSKSSANINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDD 297

Query: 298 TGKFKSPESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKT 357
           +GKFKS E+ Q A  GQ+VLNGLL DC+DL+ DLSHQ NGG+ LDP LQPIY +LIDIKT
Sbjct: 298 SGKFKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKT 357

Query: 358 TLENLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAI 417
           TLENL+ITRRWTLRETDLF+YQK+L EID+ R+N KFPT S D+KGQ+ILLYLLRRCYAI
Sbjct: 358 TLENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAI 417

Query: 418 IYKXXXXXXXXXXXXXXXHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVD 477
           IYK               HNQLSTVRRCLL L+RMGG+NN RELYPYQMKLASLD LR D
Sbjct: 418 IYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTD 477

Query: 478 GKFYDLDGNIPEGQATLNALLAECFDIIHEMKIEAEEKTES 518
           G FYD DGNIPEGQ  LNALLAECFDI+HE+K+EAEE+ ++
Sbjct: 478 GIFYDSDGNIPEGQGILNALLAECFDILHELKVEAEERAQN 518

>YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative
           substrate of cAMP-dependent protein kinase (PKA); green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YPL260W is not an essential
           gene
          Length = 551

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/526 (62%), Positives = 390/526 (74%), Gaps = 36/526 (6%)

Query: 14  QHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDVRKS 73
           QHPQ VP+EEE +LNY LE+R+ L++LKQNRT+YL+SK VQ TY+ VLT+VRELDD+RK+
Sbjct: 8   QHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKN 67

Query: 74  NHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQRLL 133
           +HETP+ SA TLIH+ ELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA Y+SLSTV+ LL
Sbjct: 68  SHETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL 127

Query: 134 EHLNESNVFTMHDLRPIKERLIEIKKIVXXXXXXXXXXXXXXXXYLKNAPDLDEAD---- 189
           EHLNESNVFT HDL PIKERL EI KIV                   ++P  DE      
Sbjct: 128 EHLNESNVFTHHDLSPIKERLEEISKIVEQK---------------NSSPAYDEDGNDDR 172

Query: 190 -RNLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRRXXXX 248
            R +  E ++NKIEEDLLLRAKL+HC DEY   E K+E +DPSLS +M+KLF+IRR    
Sbjct: 173 LREIDNERKKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLS 232

Query: 249 XXXXXXXXXXXX----------------XXXXXLENKHVLAPESVNTRVELLQKELNEIE 292
                                             ++KH+++ E V+ ++ +L+ EL+E+E
Sbjct: 233 LVASAKKTMSKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELE 292

Query: 293 SYRDETGKFKSPESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKL 352
           S RD++GKFKS ES Q AEKGQ+VLNGLL DC+DL+ DLSHQKNGG+ LDP LQPIY +L
Sbjct: 293 SNRDDSGKFKSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQL 352

Query: 353 IDIKTTLENLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLR 412
           IDIKTTLENL+ITRRWTLRETDLF+YQK+L EID+ R+N KFPT S D+KGQ+ILLYLLR
Sbjct: 353 IDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLR 412

Query: 413 RCYAIIYKXXXXXXXXXXXXXXXHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLD 472
           RCYAIIYK               HNQLSTVRRCLL L+RMGG+NN RELYPYQMKLASLD
Sbjct: 413 RCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLD 472

Query: 473 GLRVDGKFYDLDGNIPEGQATLNALLAECFDIIHEMKIEAEEKTES 518
            LR +G FYD DGNIPEGQ  LNALLAECFDI+HE+K+EAEEK ++
Sbjct: 473 NLRTEGIFYDSDGNIPEGQGILNALLAECFDILHELKVEAEEKAQN 518

>Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W
           (REAL)
          Length = 549

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/526 (61%), Positives = 388/526 (73%), Gaps = 37/526 (7%)

Query: 14  QHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDVRKS 73
           QHPQ VP+EEE +LNY LE+R+ L++LKQNRT+YL+SK VQ TY+ VLT+VRELDD+RK+
Sbjct: 8   QHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKN 67

Query: 74  NHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQRLL 133
           +H+TP+ SA TLIH+ ELHNRVDSVLDDVFQL+SLCFLTVGLKNSAPA Y+SLSTV+ LL
Sbjct: 68  SHDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASLSTVESLL 127

Query: 134 EHLNESNVFTMHDLRPIKERLIEIKKIVXXXXXXXXXXXXXXXXYLKNAPDLDEAD---- 189
           EHLNESNVFT HDL PIKERL EI+KIV                     P+ DE      
Sbjct: 128 EHLNESNVFTHHDLSPIKERLEEIRKIVEK----------------NTGPNYDEDGNDDQ 171

Query: 190 -RNLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRRXXXX 248
            R +  E  +N+IEEDLLLRAKL+HC DEY + E+K+E +DPSLS +M+KLF+IRR    
Sbjct: 172 LREIDNERNKNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLS 231

Query: 249 XXXXXXXXXXXXXXXXX----------------LENKHVLAPESVNTRVELLQKELNEIE 292
                                            +++KH+++ E VN ++  L+ ELNE+E
Sbjct: 232 LVASAKKTMSQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELE 291

Query: 293 SYRDETGKFKSPESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKL 352
           S RDE+GKFKS ES + AE GQ+VLNGLL DC+DL+ DLSHQ NGG+ LDP LQPIY +L
Sbjct: 292 SNRDESGKFKSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQL 351

Query: 353 IDIKTTLENLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLR 412
           IDIKTTLENL+ITRRWTLRETDLF+YQK+L EIDS RV  KFPT + D+KGQ+ILLYLLR
Sbjct: 352 IDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLR 411

Query: 413 RCYAIIYKXXXXXXXXXXXXXXXHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLD 472
           RCYAIIYK               HNQLSTVRRCLL L+RMGG+NN RELYPYQMKLASLD
Sbjct: 412 RCYAIIYKLLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLD 471

Query: 473 GLRVDGKFYDLDGNIPEGQATLNALLAECFDIIHEMKIEAEEKTES 518
            LR DG FYD DGNIPEGQ  LNALLAECFDI+HE+K+EAEE+ ++
Sbjct: 472 NLRTDGIFYDSDGNIPEGQGILNALLAECFDIMHELKVEAEERAQN 517

>Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W
           (REAL)
          Length = 550

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/528 (61%), Positives = 391/528 (74%), Gaps = 38/528 (7%)

Query: 11  TSSQHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDV 70
           ++ QHPQ VP+EEE +LNY LE+R+ L++LKQNRT+YL+SK VQ TY+ VLT+VRELDD+
Sbjct: 4   SAGQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDI 63

Query: 71  RKSNHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQ 130
           RK++H+TP+ SA TLIH+ ELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA Y+SLSTV+
Sbjct: 64  RKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVE 123

Query: 131 RLLEHLNESNVFTMHDLRPIKERLIEIKKIVXXXXXXXXXXXXXXXXYLKNAPDLDEAD- 189
            LLEHLNESNVFT HDL PIKERL EI KIV                  KN+  + E D 
Sbjct: 124 SLLEHLNESNVFTHHDLSPIKERLDEISKIVEQ----------------KNSSPMYEEDA 167

Query: 190 -----RNLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRR 244
                R +  E ++NKIEEDLLLRAKL+HC DEY + E+K+E +DPSLS +M+KLF+IRR
Sbjct: 168 NDARIREIDNERKQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRR 227

Query: 245 XXXXXXXXXXXXXXXXXXXXX----------------LENKHVLAPESVNTRVELLQKEL 288
                                                +++KH+++ E V+ ++ +L+ EL
Sbjct: 228 GLLSLVASAKKTMSKSSANINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNEL 287

Query: 289 NEIESYRDETGKFKSPESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPI 348
           +E+ES RD++GKFKS E+ +  EKGQ+VLNGLL DC+DL+ DLSHQ NGG+ LDP LQP 
Sbjct: 288 SELESNRDDSGKFKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPT 347

Query: 349 YAKLIDIKTTLENLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILL 408
           Y +LIDIKTTLENL+ITRRWTLRETDLF+YQK+L EIDS R+N KFPT S D+KGQ+ILL
Sbjct: 348 YEQLIDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILL 407

Query: 409 YLLRRCYAIIYKXXXXXXXXXXXXXXXHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKL 468
           YLLRRCYAIIYK               HNQLSTVRRCLL L+RMGG+NN RELYPYQMKL
Sbjct: 408 YLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKL 467

Query: 469 ASLDGLRVDGKFYDLDGNIPEGQATLNALLAECFDIIHEMKIEAEEKT 516
           ASLD LR +G FYD DGNIPEGQ  LNALLAECFDI+HE+K+EAEE+ 
Sbjct: 468 ASLDNLRTNGIFYDSDGNIPEGQGILNALLAECFDIMHELKVEAEERA 515

>NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.125
           YPL260W
          Length = 522

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/528 (61%), Positives = 390/528 (73%), Gaps = 18/528 (3%)

Query: 6   LSQDITSSQHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVR 65
           LS   ++S HPQ VP+EEEG+L Y L++R  L  LK+NRT+YL+S+ VQ TY++VLT+VR
Sbjct: 5   LSNYPSNSTHPQLVPKEEEGILKYLLDVRNYLQNLKRNRTQYLNSQAVQKTYQEVLTKVR 64

Query: 66  ELDDVRKSNHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSS 125
           ELD++RK+NH TPS+SATTLIH+ ELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA Y+S
Sbjct: 65  ELDEIRKNNHATPSNSATTLIHSMELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS 124

Query: 126 LSTVQRLLEHLNESNVFTMHDLRPIKERLIEIKKIVXXXXXXXXXXXXXXXXYLKNAPDL 185
           LSTVQ LLEHLNESN+FT HDL PIKERL +I KIV                 L N  D 
Sbjct: 125 LSTVQSLLEHLNESNIFTHHDLGPIKERLDQISKIVEESCSQEIK--------LDNEGD- 175

Query: 186 DEADRNLSE---ETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQI 242
           D+ ++ L E   E  +NKIE+DLLLRAKLQHCLDEY+  E+K+E +DPSL++I++KLFQI
Sbjct: 176 DQFNQYLDETELEQNQNKIEQDLLLRAKLQHCLDEYHEIESKLEEIDPSLNSILEKLFQI 235

Query: 243 RRXXXXXXXXXXXXXXXXXXXXXLENKHVLAPESVNTRVELLQKELNEIESYRDETGKFK 302
           RR                     L+ KH+++PE +N ++  L+KE  ++ES RDE GKFK
Sbjct: 236 RRGLLSLVASAKKNSLLSQKE--LDEKHLISPEYLNKKLLELEKEFKDLESNRDEFGKFK 293

Query: 303 SPESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKTTLENL 362
           S E+ +  E GQNVL GL  DC DL+ DLSHQ NG + LDP LQP+Y +LI+IKTTLE L
Sbjct: 294 SLETGEIPENGQNVLKGLEDDCNDLINDLSHQTNGRLTLDPDLQPVYEQLIEIKTTLEKL 353

Query: 363 LITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAIIYKXX 422
           +ITRRWTLRETDLFTYQK+LGEID+LRV  KFP+ S D+KGQ I+LYLLRRCYAIIYK  
Sbjct: 354 MITRRWTLRETDLFTYQKKLGEIDNLRVKGKFPSKSSDSKGQFIILYLLRRCYAIIYKLL 413

Query: 423 XXXXXXXXXXXXXHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVDGKFYD 482
                        HNQLSTVRRCLL ++R+GG++N RELYPYQMKLASLD LR DG FYD
Sbjct: 414 ECSEPVSESLQPIHNQLSTVRRCLLDIKRLGGVSNERELYPYQMKLASLDNLRKDGIFYD 473

Query: 483 LDGNIPEGQATLNALLAECFDIIHEMKIEAEEKTESETQSEAEGDGDD 530
            DGNIPEGQ TLNALLA CFDI+HEMK+EAE   +S   S    D DD
Sbjct: 474 SDGNIPEGQGTLNALLAACFDIVHEMKVEAEANNKSNDTS----DNDD 517

>KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]
           {ON} similar to uniprot|Q08977 YPL260W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/510 (61%), Positives = 383/510 (75%), Gaps = 12/510 (2%)

Query: 10  ITSSQHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDD 69
           ++ + HP  VP EEE +L YFL++R+ LS++KQNR+++L+SK V  TY++VLT+VRELD+
Sbjct: 1   MSVNSHPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDE 60

Query: 70  VRKSNHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTV 129
           +RK++H TPS+SATTLIH++ELHNRVDSV+DDVFQLLSL FLTVGLKNSAPA Y+SLSTV
Sbjct: 61  LRKNSHATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTV 120

Query: 130 QRLLEHLNESNVFTMHDLRPIKERLIEIKKIVXXXXXXXXXXXXXXXXYLKNAPDLDEAD 189
           Q LLEHLNESNV+T HDLRPIKERL E+  IV                   +A D+ E  
Sbjct: 121 QSLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNA---DADDIGEFA 177

Query: 190 RNLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRRXXXXX 249
               EE  +NKIEEDLLLRAKL+HC+DEY + E+K+E + P L + M+ LFQIRR     
Sbjct: 178 LQKDEELNKNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSL 237

Query: 250 XXXXXXXXXX---------XXXXXXLENKHVLAPESVNTRVELLQKELNEIESYRDETGK 300
                                     E K+VL  + ++ +++ LQ++L ++ES+RD  GK
Sbjct: 238 ASSTKRPHQKQLVPDPAVLSVESEASEKKNVLPDQVIDEKLKQLQEQLEKLESHRDINGK 297

Query: 301 FKSPESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKTTLE 360
           FKS E+++  EKGQNVLNGLL DC+DL+ DLSHQK+GGI LD +LQPIY +L+DIKTTLE
Sbjct: 298 FKSLETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLE 357

Query: 361 NLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAIIYK 420
           NLL+TRRWTLRETDLFTYQK+LGEID+LRVN KFPTD  D+KGQ+ILLYLLRRCYAIIYK
Sbjct: 358 NLLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYK 417

Query: 421 XXXXXXXXXXXXXXXHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVDGKF 480
                          HNQLSTVRRCLL L+RMGG++N RELYPYQMKLASLD +RVDGKF
Sbjct: 418 LLESSEPVSESLQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKF 477

Query: 481 YDLDGNIPEGQATLNALLAECFDIIHEMKI 510
           YD DGNIPEGQ TLNALLAECFDIIHE+KI
Sbjct: 478 YDTDGNIPEGQGTLNALLAECFDIIHELKI 507

>KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} similar
           to uniprot|Q08977 YPL260W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 595

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/510 (63%), Positives = 371/510 (72%), Gaps = 20/510 (3%)

Query: 14  QHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDVRKS 73
           +HPQ VP EEE  L YFLE+R  LS+LKQNR++YL+SK V +TY+QVLT+VRELD +RKS
Sbjct: 3   KHPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKS 62

Query: 74  NHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQRLL 133
           +H  P++SATTLIHN ELHNRVDSVLDDVFQLLSL FLTVGLKNSAPA Y+SLSTVQRLL
Sbjct: 63  SHHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLL 122

Query: 134 EHLNESNVFTMHDLRPIKERLIEIKKIVXXXXXXXXXXXXXXXXYLKNAP----DLDEAD 189
           EHL+ESNVFT HDLRPIKERL EI +IV                YL         +D A 
Sbjct: 123 EHLDESNVFTHHDLRPIKERLDEISEIVSQSS------------YLDGTEISDGRIDFA- 169

Query: 190 RNLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRRXXXXX 249
             + +E  RNKIEEDLLLRAKLQHCL EY   E+K+E +DP L + M+KLFQ+RR     
Sbjct: 170 -KIQDEKDRNKIEEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSL 228

Query: 250 XXXXXXXXXXXXXXXXLENKHVLAPESVNTRVELLQKELNEIESYRDETGKFKSPESEQS 309
                            ++  +L  E +  R+  L+ EL EIES+RD +GKF S E+ + 
Sbjct: 229 AASTKRNAMSKQGVKTPDS--LLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLETGEI 286

Query: 310 AEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKTTLENLLITRRWT 369
           A KGQNVLNGLL DC+DL+ DLSH  N  + LD +LQPIY  LIDIKTTLENLL+TRRWT
Sbjct: 287 AGKGQNVLNGLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRRWT 346

Query: 370 LRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAIIYKXXXXXXXXX 429
           LRETDLF+YQK L EID LRV  KFPT++ D KGQ ILLYLLRRCYAIIYK         
Sbjct: 347 LRETDLFSYQKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVS 406

Query: 430 XXXXXXHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVDGKFYDLDGNIPE 489
                 HNQLSTVRRCLL L+RMGG+ N RELYPYQMKLASLD +RVDGKFYD DGNIPE
Sbjct: 407 EALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPE 466

Query: 490 GQATLNALLAECFDIIHEMKIEAEEKTESE 519
           GQ TLNALLAECFDI+HE+KIEAEE+   E
Sbjct: 467 GQGTLNALLAECFDILHELKIEAEERETPE 496

>Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260W -
           Hypothetical ORF [contig 138] FULL
          Length = 575

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/518 (60%), Positives = 373/518 (72%), Gaps = 18/518 (3%)

Query: 14  QHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDVRKS 73
           +HPQ VP EEE  L YFLE+R  LS+LKQNR++YL+SK+V + Y+QVLT+VRELD++RK 
Sbjct: 3   KHPQEVPAEEEASLAYFLEVRNYLSRLKQNRSQYLNSKEVMSAYQQVLTKVRELDEIRKR 62

Query: 74  NHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQRLL 133
           +H  P +SATTLIHN ELHNRVDSVLDDVFQLLSL FLTVGLKNSAPA Y+SLSTVQRLL
Sbjct: 63  SHSAPRNSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLL 122

Query: 134 EHLNESNVFTMHDLRPIKERLIEIKKIVXXXXXXXXXXXXXXXXYLKNAPDLDEAD---R 190
           EHL+ESNVFT HDLRPIKERL EI +IV                + K   +++       
Sbjct: 123 EHLDESNVFTHHDLRPIKERLDEISEIVTQSS------------FFKEGGEINNGSIDFT 170

Query: 191 NLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRRXXXXXX 250
            +S+E  RNKIEEDLLLRAKL+HCL EY   E+K+E +DP L   M+KLF++RR      
Sbjct: 171 KISDEKDRNKIEEDLLLRAKLKHCLQEYAHIESKLEEIDPRLQKTMEKLFELRRGLLSLA 230

Query: 251 XXXXXXXXXXXXXXXLENKHVLAPESVNTRVELLQKELNEIESYRDETGKFKSPESEQSA 310
                           E+   L+ ESV  ++  L+ +L +IES R+ +G F S ++ +  
Sbjct: 231 ASTKRNAMLKDGHKAPESP--LSQESVKEKLHSLEAKLTQIESQRNASGYFVSADTGEIV 288

Query: 311 EKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKTTLENLLITRRWTL 370
           E+GQ+VLNGLL DC+DL+ DLSH  N  + LD +LQPIY  LI+IKTTLENLL+TRRWTL
Sbjct: 289 ERGQSVLNGLLDDCHDLINDLSHHANNVVTLDSKLQPIYDNLIEIKTTLENLLVTRRWTL 348

Query: 371 RETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAIIYKXXXXXXXXXX 430
           RETDLF YQK L EID LRV  KFPT+SGD KGQ ILLYLLRRCYAIIYK          
Sbjct: 349 RETDLFAYQKRLSEIDKLRVGGKFPTESGDAKGQAILLYLLRRCYAIIYKLLECSEPVSE 408

Query: 431 XXXXXHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVDGKFYDLDGNIPEG 490
                HNQLSTVRRCLL L+RMGG+ N RELYPYQMKLASLD +RVDGKFYD DGNIPEG
Sbjct: 409 ALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEG 468

Query: 491 QATLNALLAECFDIIHEMKIEAEEKTESETQSEAEGDG 528
           Q TLNALLAECFDI+HE+KIEAE +  S  + +AE D 
Sbjct: 469 QGTLNALLAECFDILHELKIEAEYRDGSGAE-DAESDA 505

>CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly
           similar to uniprot|Q08977 Saccharomyces cerevisiae
           YPL260w
          Length = 532

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/513 (59%), Positives = 381/513 (74%), Gaps = 20/513 (3%)

Query: 4   STLSQDITSSQHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTR 63
           S +   ++ + HPQ VP+EEEG+LNY LE+R+ LS+LK+NRT+YL+SK V  TY++VLTR
Sbjct: 2   SGVPMSVSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTR 61

Query: 64  VRELDDVRKSNHETP--SSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA 121
           VRELD +RKS+ +     + ATTLIH+ ++HNRVDSVLDDVFQLLSLCFLTVGLKNSAPA
Sbjct: 62  VRELDGIRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA 121

Query: 122 AYSSLSTVQRLLEHLNESNVFTMHDLRPIKERLIEIKKIVXXXXXXXXXXXXXXXXYLKN 181
            Y+SLSTVQ LLEHL ESNVFT HDLRPIKERL EI KIV                 +++
Sbjct: 122 TYASLSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKS--------------VES 167

Query: 182 APDLDEAD-RNLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLF 240
            P+ + A+ + +  E  +N+IE+DLLL+AKLQHC+DEY   E+K+E + P LS+IM++LF
Sbjct: 168 RPEDEVAEFKEIDTERNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLF 227

Query: 241 QIRRXXXXXXXXXXXXXXXXXXXXXL---ENKHVLAPESVNTRVELLQKELNEIESYRDE 297
           ++RR                         ++KHVL+ E ++  +E  +KE+ ++E+ RDE
Sbjct: 228 KVRRGLLSLAASSKKNIPDENYKEPAKLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDE 287

Query: 298 TGKFKSPESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKT 357
            G+F S  + ++ ++GQN+LNGLL DC DL+ DLSHQ NGG+ LDP LQPIY KLIDIKT
Sbjct: 288 NGQFVSKSTGKAEQRGQNILNGLLDDCNDLINDLSHQTNGGLTLDPYLQPIYEKLIDIKT 347

Query: 358 TLENLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAI 417
           TLENL+ITRRWTLRETDLFTYQK+L EID++RV+ KFPT S D+KGQ+I+LYLLRRCYAI
Sbjct: 348 TLENLMITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAI 407

Query: 418 IYKXXXXXXXXXXXXXXXHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVD 477
           IYK               HNQLSTVRRCLL L+RMGG+NN RELYPYQMKLASLD LR D
Sbjct: 408 IYKLLESSEPVSESLQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKD 467

Query: 478 GKFYDLDGNIPEGQATLNALLAECFDIIHEMKI 510
           GKFYD DGNIPEGQ  LNALLA CFDI+HE+K+
Sbjct: 468 GKFYDSDGNIPEGQGILNALLAGCFDILHELKV 500

>KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7.125
           YPL260W
          Length = 549

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/526 (56%), Positives = 380/526 (72%), Gaps = 32/526 (6%)

Query: 11  TSSQHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDV 70
           TS+Q  Q+VP+EEEG+LNYFL++RT LSQLK+NRT+YL+S +VQ TY++VLT+VRELD +
Sbjct: 7   TSTQPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELDAI 66

Query: 71  RKSNHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQ 130
           RK NH+  +++  TLIHNA+LHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA Y+SLSTV+
Sbjct: 67  RKKNHDAVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVE 126

Query: 131 RLLEHLNESNVFTMHDLRPIKERLIEIKKIVXXXXXXXXXXXXXXXXYLKNAPDLDEADR 190
            LL+HL E+ ++T HDL+PIK+RL EI KIV                 L+N  D ++A +
Sbjct: 127 SLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDA----LEN--DEEQAIK 180

Query: 191 NLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRRXXXXXX 250
           ++  E  RNK+E++LLL+AKL+HC+D Y   E+K+E +DP+L+++M+KLFQIRR      
Sbjct: 181 DIDAERTRNKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLV 240

Query: 251 X---------------XXXXXXXXXXXXXXLEN-------KHVLAPESVNTRVELLQKEL 288
                                         L N       K+ ++ + V  + E+L+ +L
Sbjct: 241 ASSRNMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDL 300

Query: 289 NEIESYRDETGKFKSPESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGG----IELDPR 344
             +E++RDE GKFKS E+++ AE GQ VLNGLL DC DL+ DLSHQ   G    + +DP 
Sbjct: 301 KNLEAHRDEDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPS 360

Query: 345 LQPIYAKLIDIKTTLENLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQ 404
           LQP+Y +L++IKTTLENL+ITRRWTLRETDLF+YQK+L EID+LRVN +FPT++ D++GQ
Sbjct: 361 LQPVYERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQ 420

Query: 405 TILLYLLRRCYAIIYKXXXXXXXXXXXXXXXHNQLSTVRRCLLSLQRMGGINNSRELYPY 464
           +ILLYLLRRCYAIIYK               HNQLSTVRRCLL L+RMGG+NN RELYPY
Sbjct: 421 SILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPY 480

Query: 465 QMKLASLDGLRVDGKFYDLDGNIPEGQATLNALLAECFDIIHEMKI 510
           QMKLASLD LR DG FYD DGNIPEGQ  LNALLA CFDIIHE+K+
Sbjct: 481 QMKLASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526

>Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}
           similar to Ashbya gossypii ADL019W
          Length = 579

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/522 (57%), Positives = 371/522 (71%), Gaps = 22/522 (4%)

Query: 11  TSSQHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDV 70
           +++Q  Q +P+EEE +L+YFLE+R  LS+LKQNR ++L SK V  TY++VLT+VRELD +
Sbjct: 3   SANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDKI 62

Query: 71  RKSNHETPSS--SATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLST 128
           RK+ HE+  +    TTLIH+ +LHNRVDSV+DDVFQLLSLCFLTVGLKNSAPA Y+SLST
Sbjct: 63  RKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLST 122

Query: 129 VQRLLEHLNESNVFTMHDLRPIKERLIEIKKIVXXXXXXXXXXXXXXXXYLKNAPDLDEA 188
           VQ LL+HLNESNV+T +DL+PIKERL EI +IV                   N P  D  
Sbjct: 123 VQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEKNSYW-------------NIP-TDGG 168

Query: 189 DRN-----LSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIR 243
           D N     L ++ + N IEE+LLLRAKL++CL  Y   EAK+E +   L   M++LFQIR
Sbjct: 169 DGNAFADDLEDKRKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIR 228

Query: 244 RXXXXXXXXXXXXXXXXXXXXXLENKHVLAPESVNTRVELLQKELNEIESYRDETGKFKS 303
           R                      +   +L+ E +N R++ L+ EL ++ S+R+E+GKF S
Sbjct: 229 RGLLSLAASAKSRVEQEEQDENDDELCILSHEKINERLKALETELADVRSHRNESGKFVS 288

Query: 304 P-ESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKTTLENL 362
             +     EKGQ VLNGLL DC+DL+ DLSHQ + G++LDP +QPIY  L+ IKT LENL
Sbjct: 289 VNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILENL 348

Query: 363 LITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAIIYKXX 422
           L+TRRWTLRETDLFTYQK+L E+DSLRVN KFP++S D+KGQ ILLYLLRRCYAIIYK  
Sbjct: 349 LVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYKLL 408

Query: 423 XXXXXXXXXXXXXHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVDGKFYD 482
                        HNQLSTVR CLL L+RMGG++N RELYPYQMKLASLD +RVDGKFYD
Sbjct: 409 ESSEPVSESLERIHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYD 468

Query: 483 LDGNIPEGQATLNALLAECFDIIHEMKIEAEEKTESETQSEA 524
            DGNIPEGQ TLNALLAECFDI+HEMKIEAE + E+   +EA
Sbjct: 469 PDGNIPEGQGTLNALLAECFDILHEMKIEAEVREEAAQSNEA 510

>TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.125
           YPL260W
          Length = 586

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/518 (55%), Positives = 371/518 (71%), Gaps = 6/518 (1%)

Query: 15  HPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDVRKSN 74
           HPQ VP EEE +LN+ LE+R  L++LKQNRT++L++K+VQ TY+ VLT+VRELD++RK++
Sbjct: 14  HPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDEIRKNS 73

Query: 75  HETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQRLLE 134
             TP+ +ATTLIH+++LHNRVDSVLDDVFQLLSLCFLTVG+KNSAPA YSSLSTVQ LLE
Sbjct: 74  LTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLSTVQCLLE 133

Query: 135 HLNESNVFTMHDLRPIKERLIEIKKIVXXXXXXXXXXXXXXXXYL-KNAPDLDEADRNLS 193
           HLNES +FTMHDLRPIKERL EI++IV                 L K   +L E    + 
Sbjct: 134 HLNESRMFTMHDLRPIKERLDEIQEIVEKSSYRNDEFNDSALVGLSKQEHELIE----IE 189

Query: 194 EETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRRXXXXXXXXX 253
            E  RN+IEEDLL+RAKLQ C++++   E+++E ++P+LS+I+DKL+ IRR         
Sbjct: 190 NERTRNRIEEDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLASPT 249

Query: 254 XXXXXXXXXXXXLENKHVLAPESVNTRVEL-LQKELNEIESYRDETGKFKSPESEQSAEK 312
                           H ++ +S    V L ++K+L EIES RDE G +KS E+ +   +
Sbjct: 250 NDTLSKSDNNHIASTNHNVSDKSHKELVLLKMKKQLVEIESQRDENGYYKSLETNKVEME 309

Query: 313 GQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKTTLENLLITRRWTLRE 372
           GQ ++N L+ DC DL+ DLSH +NG I  DP LQ IY  LIDIKT L NL++TRRWTLRE
Sbjct: 310 GQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNLANLMVTRRWTLRE 369

Query: 373 TDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAIIYKXXXXXXXXXXXX 432
           TDLF+YQK+L EIDSLRVN KF + + D KGQ+I+LYLLRRCYAIIYK            
Sbjct: 370 TDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIYKLLESSEPISESL 429

Query: 433 XXXHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVDGKFYDLDGNIPEGQA 492
              H QLSTVRRCL++L+R+GG+ + +ELYPYQMKLASLD LR+DGKFYD +G+IPEGQ 
Sbjct: 430 QSIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFYDANGDIPEGQG 489

Query: 493 TLNALLAECFDIIHEMKIEAEEKTESETQSEAEGDGDD 530
            LNA+LAECFD++HE+K +AE  + SE  +    D +D
Sbjct: 490 ILNAMLAECFDMVHELKCDAEAYSSSENATPINTDKED 527

>Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON}
           (16650..18254) [1605 nt, 535 aa]
          Length = 534

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/515 (54%), Positives = 348/515 (67%), Gaps = 52/515 (10%)

Query: 13  SQHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDVRK 72
           S++   VP+EEE +L Y L++R  L++LK NR+++L+SK+VQ  +++VLT+VRELDD+RK
Sbjct: 14  SKYMYGVPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRK 73

Query: 73  SNHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQRL 132
                 +  + T+IHN  LHN+VDS+LDDVFQLLSLCFLTVGLKNSAPA YSSLSTVQ+L
Sbjct: 74  RQAGEDAVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKL 133

Query: 133 LEHLNESNVFTMHDLRPIKERLIEIKKIVXXXXXXXXXXXXXXXXYLKNAPDLDEADRNL 192
           LEHL+ESN+FT HDLRPIK+RL EI  IV                 L N  D  E  RN 
Sbjct: 134 LEHLDESNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFD------LTNPADETEEKRN- 186

Query: 193 SEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRRXXXXXXXX 252
                +NKIEEDLLLRAKL+HCLDEY    +K+E + P LS+IM+KL+ IRR        
Sbjct: 187 -----KNKIEEDLLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIRRSLLS---- 237

Query: 253 XXXXXXXXXXXXXLENKHVLAPES--VNTRVELLQ----KELNEIES-----------YR 295
                              LA  S  ++TR +  Q    KE  E  S           +R
Sbjct: 238 -------------------LASPSRKIDTREDFSQFNSSKESQEALSSLEQELEELESHR 278

Query: 296 DETGKFKSPESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDI 355
           DE G FKS E+ +   KGQNVL GL+ +C+DL+ D ++  NG   +DP L+PIY +LI+I
Sbjct: 279 DENGNFKSLETGEVVLKGQNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINI 338

Query: 356 KTTLENLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCY 415
           KT L NL+ITRRWTLR+TDLF YQK+L  ID+ RVN KFPT SGD KGQ ILLYLLRRCY
Sbjct: 339 KTNLANLMITRRWTLRDTDLFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCY 398

Query: 416 AIIYKXXXXXXXXXXXXXXXHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLR 475
           AIIYK               HNQLST RRCLLSL+RMGG+N+ RELYPYQ+KLASLD LR
Sbjct: 399 AIIYKLLESSVPVSESLQSIHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELR 458

Query: 476 VDGKFYDLDGNIPEGQATLNALLAECFDIIHEMKI 510
           +DGKF+D +G IPEGQ TLNALLAECFDI+HE++I
Sbjct: 459 IDGKFFDANGEIPEGQGTLNALLAECFDIMHELEI 493

>TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.125
           YPL260W
          Length = 551

 Score =  525 bits (1351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/524 (53%), Positives = 353/524 (67%), Gaps = 28/524 (5%)

Query: 19  VPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDVRKSN---- 74
           VP+ E  +L Y +++R  L+QLK NR+KYL+SK+V+  +++VLT+VRELDD+RKS     
Sbjct: 17  VPESEHDILKYLIDVRVRLTQLKTNRSKYLNSKEVRLLHQEVLTKVRELDDIRKSKLKDD 76

Query: 75  --HETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQRL 132
              ++ +   TTL+ N  LHN+VDS++DDVFQLLSLCFLTVGLKNSAPA Y+SLSTVQ+L
Sbjct: 77  GQDDSQTQQITTLLCNLTLHNKVDSLVDDVFQLLSLCFLTVGLKNSAPATYTSLSTVQKL 136

Query: 133 LEHLNESNVFTMHDLRPIKERLIEIKKIVXXXXXXXXXXXXXXXXYLKNAPDLDEADRNL 192
           LEHL+ESN+FT HDLRPIKERL EI KIV                Y     + DE + N 
Sbjct: 137 LEHLDESNIFTNHDLRPIKERLDEISKIVQNNS------------YKNYEFNEDEINPNQ 184

Query: 193 --SEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRRXXXXXX 250
              +E ++N IEEDLLLRAKL+ C DE+    +K+E +DP L++IM+KL+ IRR      
Sbjct: 185 VDDDEIKQNLIEEDLLLRAKLKFCNDEFARIHSKLEEIDPELNSIMEKLYHIRRNLLSLA 244

Query: 251 XXXXXXXXXXXXXXXLENKHVLAPESVNTRVELLQKELNEIESYRDETGKFKSPESEQSA 310
                            N      E     ++ L  EL E+E++RDE G FKS E+ +  
Sbjct: 245 SPTHKIDTTENISIFNNN------EESRKMLKHLSDELTELETHRDEDGNFKSLETNEVK 298

Query: 311 EKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKTTLENLLITRRWTL 370
            KGQN L GL+ +C+DL+ D ++       LD  LQPIY  LI+IKT L NL+ITRRWTL
Sbjct: 299 LKGQNALAGLVDNCHDLINDFTNSSGDNQILDKNLQPIYNNLINIKTNLANLMITRRWTL 358

Query: 371 RETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAIIYKXXXXXXXXXX 430
           RETDLF YQK L EID  RVN KFP++SG+ KGQ+ILLYLLRRCYAIIYK          
Sbjct: 359 RETDLFQYQKRLKEIDDQRVNGKFPSESGNTKGQSILLYLLRRCYAIIYKLLESSEPVSE 418

Query: 431 XXXXXHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVDGKFYDLDGNIPEG 490
                HNQLST RRCLL+L+RMGG+N+ RELYPYQ+KLASLD LR+DGKFYD  G IPEG
Sbjct: 419 SLQPIHNQLSTTRRCLLALKRMGGVNSPRELYPYQLKLASLDELRIDGKFYDSSGEIPEG 478

Query: 491 QATLNALLAECFDIIHEMKIEAEEKT--ESETQSEAEGDGDDLR 532
           Q TLNALLAECFD++HE++IE+EE    E++T    + D +D R
Sbjct: 479 QGTLNALLAECFDMLHELEIESEESVDNENDTADSIQDDNEDYR 522

>KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.125
           YPL260W
          Length = 511

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/498 (55%), Positives = 343/498 (68%), Gaps = 29/498 (5%)

Query: 17  QHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDVRKSNH- 75
           Q VP+EEE  L+Y L++R  LS LKQNR+++L+SK +Q TY++VLT+VRELD++R+  H 
Sbjct: 10  QAVPKEEEVFLDYLLKVRQNLSDLKQNRSQFLNSKDIQFTYQRVLTKVRELDEIRRQKHG 69

Query: 76  ETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQRLLEH 135
            +  +   T +H+ ELHNRVD+VLDDVFQLLSLCF+T GLKNSAPA Y+SLSTVQ LLEH
Sbjct: 70  NSQETEIKTFVHSPELHNRVDNVLDDVFQLLSLCFITCGLKNSAPATYASLSTVQSLLEH 129

Query: 136 LNESNVFTMHDLRPIKERLIEIKKIVXXXXXXXXXXXXXXXXYLKNAPDLDEADRNLS-- 193
           L ES ++T HDL+PIKERL EI KIV                  ++A  LD+ D  +S  
Sbjct: 130 LIESKIYTHHDLKPIKERLDEIAKIVDQNCESNT---------YQDASTLDDDDNEVSRI 180

Query: 194 -EETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRRXXXXXXXX 252
             E  +NKIE++LLL+AKL HCL EY   E+++E VDPS +++++KLFQIRR        
Sbjct: 181 DNERNKNKIEQNLLLQAKLNHCLHEYNYIESQLEEVDPSSNSLVEKLFQIRRNLVSLVE- 239

Query: 253 XXXXXXXXXXXXXLENKHVLAPESVNTRVELLQKELNEIESYRDETGKFKSPESEQSAEK 312
                        +   +    + ++ +++ LQ +LNEIE+ RD  G F S ES     K
Sbjct: 240 -------------ISKSNTGVQDQIDKKLKHLQLQLNEIENNRDPDGNFVSIESGNPIIK 286

Query: 313 GQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKTTLENLLITRRWTLRE 372
           G NVLNGL  DC+DL+ DL+H       LDP LQ +Y  LID+K +LENL++TRRWTLRE
Sbjct: 287 GSNVLNGLSDDCHDLISDLTHHTKTF--LDPDLQNVYDNLIDVKGSLENLMVTRRWTLRE 344

Query: 373 TDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAIIYKXXXXXXXXXXXX 432
           TDLF+Y K+L EID+LRV+ KFPT SG  KGQ ILLYLLRRCY +IYK            
Sbjct: 345 TDLFSYLKKLNEIDNLRVDGKFPTKSGSTKGQAILLYLLRRCYTLIYKLLESSEPVSEAL 404

Query: 433 XXXHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVDGKFYDLDGNIPEGQA 492
              HNQLSTVRRCLL L+RMGG+NN RELYPYQMKLASLD LR DGKFYD  GNIPEGQ 
Sbjct: 405 QPIHNQLSTVRRCLLDLKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSKGNIPEGQG 464

Query: 493 TLNALLAECFDIIHEMKI 510
            LNALLA CFDI+HE+KI
Sbjct: 465 ILNALLAGCFDILHELKI 482

>ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL260W
          Length = 525

 Score =  509 bits (1312), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 268/477 (56%), Positives = 330/477 (69%), Gaps = 16/477 (3%)

Query: 55  ATYEQVLTRVRELDDVRKSNHETP-SSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTV 113
           ATY+ VLT+VR LD VRK  H    ++   TLIH+A LHNRVDSVLDDVFQLLSL FLTV
Sbjct: 2   ATYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLTV 61

Query: 114 GLKNSAPAAYSSLSTVQRLLEHLNESNVFTMHDLRPIKERLIEIKKIVXXXXXXXXXXXX 173
           GLKN+APA Y+SLSTVQRLLEH+ E+NV+T  DLRPIKERL EI +IV            
Sbjct: 62  GLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSM---- 117

Query: 174 XXXXYLKNAPDLDEADRNLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLS 233
                +++   LDE    L+EE R NK+EEDLL+RAKLQHC+D Y   ++K  T+ P L 
Sbjct: 118 -----VEDEAPLDE----LAEEKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQ 168

Query: 234 NIMDKLFQIRRXXXXXXXXXXXXXXXXXXXXXLENKHVLAPESVNTRVELLQKELNEIES 293
            + DKLF IRR                            +P ++ +R++ L+  + E+ES
Sbjct: 169 PLSDKLFHIRRELLSLAASAKTDRAAGEGSTERSTTPA-SPNTLASRLKDLESMILEVES 227

Query: 294 YRDETGKFKSPESEQSA-EKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKL 352
           +RD++GKF SP+   +  +KGQ+ LNGLL DC +L GDLSHQ +G + LDP+LQPIY +L
Sbjct: 228 HRDDSGKFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEEL 287

Query: 353 IDIKTTLENLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLR 412
           ++IKTTLENLL+TRRWTLRETDLF YQK L E+D+LRVN K P+ S  +KGQ ++LYLLR
Sbjct: 288 LEIKTTLENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKSPSSSSASKGQALILYLLR 347

Query: 413 RCYAIIYKXXXXXXXXXXXXXXXHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLD 472
           RCYA IYK               HNQLSTVRRCL  L+RMGG+++ R+LYPYQMKLASLD
Sbjct: 348 RCYATIYKLLESSEPVSESLQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLD 407

Query: 473 GLRVDGKFYDLDGNIPEGQATLNALLAECFDIIHEMKIEAEEKTESETQSEAEGDGD 529
            +RVDGKFYD DGNIPEGQ TLNALLAECFDI+HEMKIEAE + E   Q   +  G+
Sbjct: 408 NMRVDGKFYDADGNIPEGQGTLNALLAECFDILHEMKIEAEVREEQLPQVNEDDAGE 464

>Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [1476
           bp, 491 aa] {ON}
           complement(129362..129739,129741..130838) [1476 nt, 492
           aa]
          Length = 491

 Score =  139 bits (351), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 111/418 (26%), Positives = 201/418 (48%), Gaps = 27/418 (6%)

Query: 121 AAYSSLSTVQRLLEHLNESNVFTMHDLRPIKERLIEIKKIVXXXXXXXXXXXXXXXXYLK 180
           + YSS+  ++ LL  LN+SN+FT +DL P+K RL EI  I+                  +
Sbjct: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECEENDNEDNE 132

Query: 181 -----------------NAPDLDEADRNLSEETRRNKIEEDLLLRAKLQHCLDEYYST-- 221
                            N+ D+     +   E  + +  +D  L+  +   LD+ Y    
Sbjct: 133 DNEDNDENIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYIFQELDDCYKVHN 192

Query: 222 --EAKVETVDPSLSNIMDKLFQIRRXXXXXXXXXXXXXXXXXXXXXLENKHVLAPESVNT 279
             E K + +D +LS+++DK+  +R+                     L++ + ++  + + 
Sbjct: 193 VIELKTDNIDVNLSSLLDKVLVVRK--DLLYIVFSRVKSVFPQCFVLKDPNHMSNSTFDK 250

Query: 280 RVELLQKELNEIESYRDETGKFKSPESEQSAE-KGQNVLNGLLSDCYDLLGDLSHQKNGG 338
           ++  +Q+ L+ I+    E  + +S  ++      GQ +LNGL+  C +++ D+       
Sbjct: 251 KLNEIQRNLDVIKEKNTEYDEGQSQRNKNEGNINGQRILNGLVDYCQEVIHDVKLLAIDK 310

Query: 339 IELDPRLQPIYAKLIDIKTTLENLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDS 398
           I+ D +   ++ K + +K  LE +L+T R +L+  DLF   KEL +++   +      DS
Sbjct: 311 ID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHKELSKLEKRTIRHYNIEDS 369

Query: 399 GDNKGQTILLYLLRRCYAIIYKXXXXXXXXXXXXXXXHNQLSTVRRCLLSLQRMGGINNS 458
              + ++I+++ LRRC+ IIYK               +NQLST+ R LL L+  GG+   
Sbjct: 370 F--QAKSIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARYLLKLKIAGGVEKM 427

Query: 459 RELYPYQMKLASLDGLRVDGKFYDLDGNIPEGQATLNALLAECFDIIHEMKIEAEEKT 516
            +L P ++KL ++   R++  F D  GNIP GQ  LNALL EC +++  ++I+ E +T
Sbjct: 428 DDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHECMELLKILEIDFEGRT 485

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 26/39 (66%), Gaps = 1/39 (2%)

Query: 484 DGNIPEGQATLNALLAECFDIIHEMKIEAEEKTESETQS 522
           +GNI  GQ  LN L+  C ++IH++K+ A +K + E ++
Sbjct: 280 EGNI-NGQRILNGLVDYCQEVIHDVKLLAIDKIDDEKKA 317

>KLLA0A04884g Chr1 (433581..436760) [3180 bp, 1059 aa] {ON} similar
           to uniprot|P32767 Saccharomyces cerevisiae YGL016W
           KAP122 Karyopherin beta responsible for import of the
           Toa1p-Toa2p complex into the nucleus binds to
           nucleoporins Nup1p and Nup2p may play a role in
           regulation of pleiotropic drug resistance
          Length = 1059

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 31/57 (54%), Gaps = 7/57 (12%)

Query: 106 LSLCFLTVGL------KNSAPAAYSSLSTVQRLLEHLNESNVFTMH-DLRPIKERLI 155
           LSL FLT+         N  PA  + ++T  +LL+H NESN+F    D   I ERL+
Sbjct: 116 LSLIFLTINSDAIGADSNKIPAWRNPVNTCIKLLQHCNESNLFEWRTDNSEIAERLV 172

>TBLA0G00180 Chr7 complement(28577..31627) [3051 bp, 1016 aa] {ON}
           Anc_2.16 YNL225C
          Length = 1016

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 57/118 (48%), Gaps = 23/118 (19%)

Query: 283 LLQKELNEIE-SYRDETGKFKSPESEQSA-----EKGQNVLNGLLSDCYDLLGDLSHQKN 336
           +++KE+  ++ S R+     K  E E++A     EK Q++L  + ++ Y       H K 
Sbjct: 433 MMRKEITTLKTSKRELNANLKKLEEEKNAYKSKYEKSQDILKSVNNELY-------HLKR 485

Query: 337 GGIELDPRLQPIYAKLIDIKTTLENLLITRRWTLRETDLFTYQKELGEIDS-LRVNSK 393
                + +L+ I          LEN ++T R  L E D  TY KEL  I S L++N+K
Sbjct: 486 QNENTEEKLKNIL---------LENKILTDRLELLEKDKLTYSKELQMISSKLKINNK 534

>NDAI0E04850 Chr5 (1100709..1102691) [1983 bp, 660 aa] {ON}
           Anc_7.249 YER068W
          Length = 660

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 25/38 (65%)

Query: 266 LENKHVLAPESVNTRVELLQKELNEIESYRDETGKFKS 303
           +EN++V   +++N  V+ L   LN  ++Y++ET K KS
Sbjct: 431 IENEYVDPYDALNVAVKFLDSRLNSFDNYKNETFKLKS 468

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,909,356
Number of extensions: 2104418
Number of successful extensions: 8649
Number of sequences better than 10.0: 47
Number of HSP's gapped: 8715
Number of HSP's successfully gapped: 64
Length of query: 588
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 473
Effective length of database: 40,294,809
Effective search space: 19059444657
Effective search space used: 19059444657
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)