Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C01848g8.254ON64764730720.0
YLR083C (EMP70)8.254ON66766323230.0
Suva_10.1678.254ON68468023150.0
Smik_12.1428.254ON66365123110.0
NDAI0B023708.254ON72266922850.0
Skud_12.1518.254ON66466022740.0
KAFR0B026808.254ON66464922490.0
YDR107C (TMN2)8.254ON67266722450.0
NCAS0B049708.254ON66666822360.0
Suva_2.2678.254ON67266222260.0
KNAG0G019908.254ON66767022200.0
Smik_4.3538.254ON69065822030.0
Skud_4.3688.254ON67265821820.0
Kpol_543.358.254ON65865421580.0
SAKL0H17248g8.254ON66065121440.0
KLLA0F18931g8.254ON66566221220.0
TBLA0E043708.254ON67666821030.0
KLTH0G13882g8.254ON68768820920.0
CAGL0B01683g8.254ON69169120650.0
Kwal_56.235778.254ON68367120370.0
TPHA0A018408.254ON68568719950.0
TBLA0H014508.254ON67365319670.0
TDEL0F038108.254ON65665019610.0
NCAS0B038908.254ON66366019430.0
AGR097W8.254ON65364518900.0
NDAI0J014208.254ON61961917390.0
Ecym_43178.254ON60564014720.0
NCAS0A145207.411ON6706173951e-39
KNAG0C034307.411ON6807103791e-37
NDAI0A015107.411ON6796543746e-37
YER113C (TMN3)7.411ON7067063587e-35
Skud_5.2667.411ON7076943472e-33
ZYRO0B03784g7.411ON6586113453e-33
Smik_5.2587.411ON7066413437e-33
TDEL0C027107.411ON6786763312e-31
Suva_5.2347.411ON7066953285e-31
KAFR0K019507.411ON6646563196e-30
KLLA0E20835g7.411ON6766173188e-30
SAKL0F12914g7.411ON7077153171e-29
CAGL0G03487g7.411ON7046443072e-28
KLTH0C06226g7.411ON6945522547e-22
Kwal_27.107467.411ON6902732145e-17
Ecym_71437.411ON6762651895e-14
TBLA0I003307.411ON7132251851e-13
AGL295C7.411ON6572011653e-11
TPHA0K007307.411ON7332651654e-11
Kpol_1045.287.411ON6812581484e-09
NCAS0B075601.303ON49558820.23
KLTH0E09702g2.390ON607103820.28
Skud_7.1746.159ON34954732.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C01848g
         (647 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} simila...  1187   0.0  
YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON} ...   899   0.0  
Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {...   896   0.0  
Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {...   894   0.0  
NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {O...   884   0.0  
Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {...   880   0.0  
KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...   870   0.0  
YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}  ...   869   0.0  
NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {O...   865   0.0  
Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...   862   0.0  
KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {O...   859   0.0  
Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON...   853   0.0  
Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON...   845   0.0  
Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}...   835   0.0  
SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} simi...   830   0.0  
KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]...   822   0.0  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...   814   0.0  
KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} simi...   810   0.0  
CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {...   800   0.0  
Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {...   789   0.0  
TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...   773   0.0  
TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {O...   762   0.0  
TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {O...   759   0.0  
NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254    753   0.0  
AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic ho...   732   0.0  
NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8....   674   0.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...   571   0.0  
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...   156   1e-39
KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.4...   150   1e-37
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...   148   6e-37
YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}  ...   142   7e-35
Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C ...   138   2e-33
ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {...   137   3e-33
Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON...   136   7e-33
TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {O...   132   2e-31
Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON...   130   5e-31
KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {...   127   6e-30
KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]...   127   8e-30
SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]...   126   1e-29
CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {...   122   2e-28
KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} simila...   102   7e-22
Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113...    87   5e-17
Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar t...    77   5e-14
TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411...    76   1e-13
AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON} S...    68   3e-11
TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7....    68   4e-11
Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON} (64237....    62   4e-09
NCAS0B07560 Chr2 complement(1426000..1427477,1427593..1427602) [...    36   0.23 
KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} simila...    36   0.28 
Skud_7.174 Chr7 (317467..318516) [1050 bp, 349 aa] {ON} YGL100W ...    33   2.6  

>ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 647

 Score = 1187 bits (3072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/647 (90%), Positives = 585/647 (90%)

Query: 1   MLSHSLLFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKG 60
           MLSHSLLFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKG
Sbjct: 1   MLSHSLLFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKG 60

Query: 61  DKEHXXXXXXXXXXKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCS 120
           DKEH          KFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCS
Sbjct: 61  DKEHYLYSYDYYYSKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCS 120

Query: 121 SRIPGEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFS 180
           SRIPGEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFS
Sbjct: 121 SRIPGEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFS 180

Query: 181 DSNDEEKKIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQYNS 240
           DSNDEEKKIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQYNS
Sbjct: 181 DSNDEEKKIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQYNS 240

Query: 241 GSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCXXXXXXXXX 300
           GSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINC         
Sbjct: 241 GSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCSVIVVALSS 300

Query: 301 XXXHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRXXXXXXXXXXXXXXF 360
              HMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPR              F
Sbjct: 301 VVLHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRSLLLSILVGSGVQLF 360

Query: 361 LMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKVNLLL 420
           LMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKVNLLL
Sbjct: 361 LMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKVNLLL 420

Query: 421 TPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHKRC 480
           TPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHKRC
Sbjct: 421 TPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHKRC 480

Query: 481 RLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKIXXXX 540
           RLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKI    
Sbjct: 481 RLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKIFYMF 540

Query: 541 XXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILFTKFK 600
                                 YHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILFTKFK
Sbjct: 541 GFLLFSFLLLTFTTALVTILTTYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILFTKFK 600

Query: 601 LGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647
           LGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD
Sbjct: 601 LGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647

>YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON}
           EMP70Protein with a role in cellular adhesion,
           filamentous growth, and endosome-to-vacuole sorting;
           similar to Tmn2p and Tmn3p; member of Transmembrane Nine
           family of proteins with 9 transmembrane segments
          Length = 667

 Score =  899 bits (2323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/663 (66%), Positives = 498/663 (75%), Gaps = 16/663 (2%)

Query: 1   MLSHSLLFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKG 60
           M    LL +    S VKAFYLPGVAPTTY  ND I LLVNHLTPSMN+QH+DEDGN V G
Sbjct: 5   MAHVQLLLLYFFVSTVKAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSG 64

Query: 61  DKEHXXXXXXXXXXKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCS 120
           DKE+          +FHFC+PE V +QP SLGSVIFGDRI+NSPF+LNML+EKEC  LC 
Sbjct: 65  DKENFLYSYDYYYNRFHFCQPEKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCK 124

Query: 121 SRIPGEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGF- 179
           + IPG+DAKF+NKLIKNGF QNWLIDGLPA RE++D RT ++FYG GF LGFV VT+G  
Sbjct: 125 TVIPGDDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQVTQGTD 184

Query: 180 -------SDSNDEE--------KKIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVD 224
                  +++ D++        + ++KT E+PY ANH+DI IEYHDRG  NYRVVGV V+
Sbjct: 185 IEATPKGAETTDKDVELETRNDRNMVKTYELPYFANHFDIMIEYHDRGEGNYRVVGVIVE 244

Query: 225 PVSIKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQ 284
           PVSIKRSS  +C+     L L E  +NEV+FTYSVKF +S T WATRWDKYLHVYDP+IQ
Sbjct: 245 PVSIKRSSPGTCETTGSPLMLDEGNDNEVYFTYSVKFNESATSWATRWDKYLHVYDPSIQ 304

Query: 285 WFSLINCXXXXXXXXXXXXHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPP 344
           WFSLIN             H LLRALK+D +RYNE NLD++F EDSGWKL+HGDVFR P 
Sbjct: 305 WFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNHGDVFRSPS 364

Query: 345 RXXXXXXXXXXXXXXFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMA 404
           +              FLM+ CSI FAALGFLSPSSRGSL TVMF+LYALFGFVGSYTSM 
Sbjct: 365 QSLTLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMG 424

Query: 405 IYKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVF 464
           IYKFF GP WK NL+LTP+LVPG I + II LNFFL+FV SSG IPA TLF ++ LWF+F
Sbjct: 425 IYKFFNGPYWKANLILTPLLVPGAILLIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLF 484

Query: 465 SIPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVEL 524
           SIPLSFAGSLIA KRC  D HPTKTNQIARQIP QPWYLKTIP +LIAG+FPF SIAVEL
Sbjct: 485 SIPLSFAGSLIARKRCHWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVEL 544

Query: 525 YFIYTSLWFNKIXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRSFIIGGCG 584
           YFIYTSLWFNKI                          YHSLCLENWKWQWR FIIGG G
Sbjct: 545 YFIYTSLWFNKIFYMFGFLFFSFLLLTLTSSLVTILITYHSLCLENWKWQWRGFIIGGAG 604

Query: 585 CAIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSV 644
           CA+YVFIHSILFTKFKLGGFTT+VLY+GYS +IS+LCC+VTGSIGFISSM F+RKIYSS+
Sbjct: 605 CALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMLFVRKIYSSI 664

Query: 645 KVD 647
           KVD
Sbjct: 665 KVD 667

>Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {ON}
           YLR083C (REAL)
          Length = 684

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/680 (63%), Positives = 496/680 (72%), Gaps = 37/680 (5%)

Query: 5   SLLFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEH 64
            L  +  + S  +AFYLPGVAPTTY  NDEI LLVNHLTPSM +QH+DEDGN V GDKEH
Sbjct: 5   QLFLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEH 64

Query: 65  XXXXXXXXXXKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIP 124
                     KFHFCKPE+V +QP SLGS+IFGDRI+NSPF+LNML+EKECV LC + IP
Sbjct: 65  FLYSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIP 124

Query: 125 GEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVT-------- 176
           G+DAKF+NKLIKNGF QNWLIDGLPA RE+HD RT ++FYG GF LGFV+V         
Sbjct: 125 GDDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETE 184

Query: 177 ----------------------------EGFS-DSNDEEKKIMKTLEVPYLANHYDINIE 207
                                       EG   D+ D+ K ++KT E PY ANH+DI IE
Sbjct: 185 QVQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIE 244

Query: 208 YHDRGNDNYRVVGVTVDPVSIKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTV 267
           YHDRG  NYRVVGV V+P+SIKRSS  +C+ N   L L E  +NEV+FTYSVKF +S T 
Sbjct: 245 YHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTS 304

Query: 268 WATRWDKYLHVYDPTIQWFSLINCXXXXXXXXXXXXHMLLRALKNDLSRYNEFNLDNEFH 327
           WATRWDKYLHVYDP+IQWFSLIN             H LLRALK+D +RYNE NLD++F 
Sbjct: 305 WATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQ 364

Query: 328 EDSGWKLSHGDVFRIPPRXXXXXXXXXXXXXXFLMIACSIIFAALGFLSPSSRGSLPTVM 387
           EDSGWKL+HGDVFR P +              FLM+ CSI FAALGFLSPSSRGSL TVM
Sbjct: 365 EDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVM 424

Query: 388 FLLYALFGFVGSYTSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSG 447
           F+LYALFGFVGSYTSM IYKFF GP WK N+++TP+L+PG I + II LNFFL+FV SSG
Sbjct: 425 FILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSG 484

Query: 448 AIPAGTLFTIILLWFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIP 507
            IPA TLF ++ LWF+FSIPLSFAGSL+A K+C  D HPTKTNQIARQIP QPWYLKT+P
Sbjct: 485 VIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLP 544

Query: 508 VSLIAGVFPFASIAVELYFIYTSLWFNKIXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLC 567
            +LIAG+FPF SIAVELYFIYTSLWFNKI                          YHSLC
Sbjct: 545 ATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTVMITYHSLC 604

Query: 568 LENWKWQWRSFIIGGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGS 627
           LENWKWQWR F +GG GCA+YVFIHSILFTKFKLGGFTT+VLYLGYS +IS+LCC+VTGS
Sbjct: 605 LENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGS 664

Query: 628 IGFISSMFFIRKIYSSVKVD 647
           IGFISSMFFIRKIYSS+KVD
Sbjct: 665 IGFISSMFFIRKIYSSIKVD 684

>Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {ON}
           YLR083C (REAL)
          Length = 663

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/651 (66%), Positives = 489/651 (75%), Gaps = 18/651 (2%)

Query: 14  SLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHXXXXXXXXX 73
           S  KAFYLPGVAPTTY  NDEI LLVNHLTPSM +QH+DE+GN V GDKE+         
Sbjct: 14  STAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYN 73

Query: 74  XKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNK 133
            +FHFCKPE V +QP SLGS+IFGDRI+NSPF+L MLEEKECV LC   IPG DAKF+NK
Sbjct: 74  SRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINK 133

Query: 134 LIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFS------------- 180
           LIKNGF QNWLIDGLPA R + D RT ++FYG GF+LGFV+VT+G +             
Sbjct: 134 LIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQ 193

Query: 181 ----DSNDEEKKIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSC 236
               D+ D    +++T E PY  NHYDI IEYHDRG  NYRVVGV V+PVSIKRS  ++C
Sbjct: 194 GVELDTRDGHN-MVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETC 252

Query: 237 QYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCXXXXX 296
           + +   L L E  +NEV+FTYSVKF++S+T WATRWDKYLHVYDP+IQWFSLIN      
Sbjct: 253 ETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWFSLINFSLVVV 312

Query: 297 XXXXXXXHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRXXXXXXXXXXX 356
                  H LLRALK+D +RYNE NLD++F EDSGWKLSHGDVFR P R           
Sbjct: 313 LLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSG 372

Query: 357 XXXFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKV 416
              F M+ CSI FAALGFLSPSSRGSL TVMF+LYALFGFVGSYTSM IYKFF GP WK 
Sbjct: 373 VQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKA 432

Query: 417 NLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIA 476
           NL+LTP+LVPG I + II LNFFL+FV SSG IPA TLF ++ LWF+FSIPLSFAGSL+A
Sbjct: 433 NLILTPLLVPGTILIIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVA 492

Query: 477 HKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKI 536
            K+C  D HPTKTNQIARQIP QPWYLKT+P +LIAGVFPF SIAVELYFIYTSLWFNKI
Sbjct: 493 RKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKI 552

Query: 537 XXXXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILF 596
                                     YHSLCLENWKWQWR FI+GG GCA+YVFIHSILF
Sbjct: 553 FYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGAGCALYVFIHSILF 612

Query: 597 TKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647
           TKFKLGGFTT+VLY+GYS +IS+LCC+VTGSIGFISSMFFIRKIYSS+KVD
Sbjct: 613 TKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663

>NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {ON}
           Anc_8.254
          Length = 722

 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/669 (63%), Positives = 504/669 (75%), Gaps = 22/669 (3%)

Query: 1   MLSHSL-LFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVK 59
           M++ SL L      SL +AFYLPGVAPTTYH +DEI LLVNHLTPSM FQH++EDG  +K
Sbjct: 54  MIAPSLVLLFAFCLSLTRAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDGKTMK 113

Query: 60  GDKEHXXXXXXXXXXKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLC 119
            DKE           +FHFC+PE++ +QP SLGS+IFGDRI+NSPF++NML++K CV LC
Sbjct: 114 SDKERFLYSYDYYYDRFHFCQPEHIEKQPESLGSIIFGDRIYNSPFQINMLQDKTCVSLC 173

Query: 120 SSRIPGEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGF 179
            + IPG+DAKF+NKLIKNGF QNWLIDGLPA R+++DSRT + FYGTGF+LGFVDV +G 
Sbjct: 174 KTTIPGKDAKFINKLIKNGFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFVDVVQGT 233

Query: 180 S--------------------DSNDEEK-KIMKTLEVPYLANHYDINIEYHDRGNDNYRV 218
           +                    D+ D +  +++K  E+PY ANH+DI +EYHDRG +NYRV
Sbjct: 234 TTGDNANTVAKKPTTNEGLELDTRDAKNVQMLKNFELPYFANHFDIQVEYHDRGENNYRV 293

Query: 219 VGVTVDPVSIKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHV 278
           VGV V+PVSIKRS+  +C+ +   L LSE ++N+V+FTYSVKFI S+T+WATRWDKYLH+
Sbjct: 294 VGVIVNPVSIKRSTPGTCETSGAPLMLSEDQDNDVYFTYSVKFIPSETIWATRWDKYLHI 353

Query: 279 YDPTIQWFSLINCXXXXXXXXXXXXHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGD 338
           YDP IQWFSLIN             H LL+ALK+D +RYNE NLD++F E++GWKL HGD
Sbjct: 354 YDPAIQWFSLINFSVVVLLLSSVVIHSLLKALKSDFARYNELNLDDDFQEEAGWKLGHGD 413

Query: 339 VFRIPPRXXXXXXXXXXXXXXFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVG 398
           VFRIP R              FLMI CSI FAALGFLSPSSRGSL TVMF+LYALFGFVG
Sbjct: 414 VFRIPHRSLLLSVLVGSGVQLFLMIICSIFFAALGFLSPSSRGSLATVMFILYALFGFVG 473

Query: 399 SYTSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTII 458
           SYTSM +YKFF GP WKVN+LLTP+LVPG IF  I+ LN FL+FV SSG IPA TLF +I
Sbjct: 474 SYTSMGVYKFFGGPYWKVNMLLTPILVPGLIFCGIVALNIFLLFVHSSGVIPAVTLFFMI 533

Query: 459 LLWFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFA 518
           LLWFVFSIPL+ AGSLIAHK+C  D HPTKTNQIARQIP QPWYLKT P +LIAG+FPF 
Sbjct: 534 LLWFVFSIPLALAGSLIAHKKCNWDEHPTKTNQIARQIPFQPWYLKTWPATLIAGIFPFG 593

Query: 519 SIAVELYFIYTSLWFNKIXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRSF 578
           SIAVELYFIY+SLWFNKI                          YHSLCLENW WQWR F
Sbjct: 594 SIAVELYFIYSSLWFNKIFYMFGFLLFSFFLLTLTTSLVTILITYHSLCLENWMWQWRGF 653

Query: 579 IIGGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIR 638
           IIGG GCAIYVFIHSILFTKFKLGGFTT+VLY+GYS +IS+L CIVTG+IGF+SSMFFIR
Sbjct: 654 IIGGVGCAIYVFIHSILFTKFKLGGFTTIVLYVGYSTIISLLFCIVTGAIGFLSSMFFIR 713

Query: 639 KIYSSVKVD 647
           KIYSS+KV+
Sbjct: 714 KIYSSIKVE 722

>Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {ON}
           YLR083C (REAL)
          Length = 664

 Score =  880 bits (2274), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/660 (64%), Positives = 492/660 (74%), Gaps = 17/660 (2%)

Query: 5   SLLFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEH 64
            LL +    S  KAFYLPGVAPTTY  NDEI LLVNHLTPSM +QHEDE GN V GDKE+
Sbjct: 5   QLLLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKEN 64

Query: 65  XXXXXXXXXXKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIP 124
                     +FHFC+P++V +QP SLGSVIFGDRI+NSPF+LNML+EKECVPLC++ IP
Sbjct: 65  FLYSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIP 124

Query: 125 GEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSD--- 181
           G DAKF+NKLIKNGF QNWLIDGLPA RE++D RT +NFYG GF+LG V+V++G      
Sbjct: 125 GNDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTA 184

Query: 182 --------------SNDEEKKIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVS 227
                         +  E+  I++T E PY ANH+DI IEYHDRG  +YRVVGV V+P+S
Sbjct: 185 PKQAETTNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEYHDRGGGDYRVVGVIVNPLS 244

Query: 228 IKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFS 287
           IKRS + +C+ ++  L L E  +NEV FTYSVKF +S T WATRWDKYLHVYDP+IQWFS
Sbjct: 245 IKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSIQWFS 304

Query: 288 LINCXXXXXXXXXXXXHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRXX 347
           LIN             H LLRALK+D +RYNE NL+++F EDSGWKL+HGDVFR P    
Sbjct: 305 LINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPPSHSL 364

Query: 348 XXXXXXXXXXXXFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYK 407
                       FLM+ CSI FAALGFLSPSSRGSL TVMF+LYALFGFVGSYTSM IYK
Sbjct: 365 LLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYK 424

Query: 408 FFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIP 467
           FF GP WK NLLLTP+LVPG I + I+ LNFFL+ V SSG IPA TLF ++ LWF+FSIP
Sbjct: 425 FFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIP 484

Query: 468 LSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFI 527
           LSF GSLIA K+C  D HPTKTNQIARQIP QPWYLKTIP +LIAG+FPF SIAVELYFI
Sbjct: 485 LSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFI 544

Query: 528 YTSLWFNKIXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRSFIIGGCGCAI 587
           YTSLWFNKI                          YHSLCLENWKWQWR FI+GG GCA+
Sbjct: 545 YTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGVGCAL 604

Query: 588 YVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647
           YVFIHSILFTKFKLGGF T+VLY+GYS +IS+LCC+VTGSIGFISSMFF+R+IYSS+KVD
Sbjct: 605 YVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSSIKVD 664

>KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {ON}
           Anc_8.254 YLR083C
          Length = 664

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/649 (63%), Positives = 486/649 (74%), Gaps = 18/649 (2%)

Query: 17  KAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHXXXXXXXXXXKF 76
           +AFYLPGVAPTTYH  DEI LLVNHL+PSM +QH++++G  V  DK            +F
Sbjct: 16  RAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSDKNKYLYSYDYYYDRF 75

Query: 77  HFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLIK 136
           HFC+PE + +QP SLGS++FGDRI+NSPF+LNMLEEK+C  LC S IPG DAKF+NKLIK
Sbjct: 76  HFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIK 135

Query: 137 NGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEK--------- 187
           NGF QNWLIDGLPA  E HD+RT ++FYG+GF+LG VDV +   ++    K         
Sbjct: 136 NGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGAE 195

Query: 188 ---------KIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQY 238
                    K +K +E+ Y  NHYDI IEYHDRGN +YRVVGV V+PVSI+RSS  SC+ 
Sbjct: 196 LDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCES 255

Query: 239 NSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCXXXXXXX 298
               LTL E E+N+V+FTYSV F+ S+T WATRWDKYLHVYDPTIQWFSL+N        
Sbjct: 256 TGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFSLIVLLL 315

Query: 299 XXXXXHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRXXXXXXXXXXXXX 358
                H LL+ALKND +RYNEFNLD+EF ED+GWKL HGDVFRIP +             
Sbjct: 316 STVVLHSLLKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMLLSVLVGSGVQ 375

Query: 359 XFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKVNL 418
            F+MI+ +I FAALGFLSPSSRG L TVMF+LYALFGFVGSYTSM +YKFF+GP WK N+
Sbjct: 376 LFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKANM 435

Query: 419 LLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHK 478
           +LTP+LVPG IF+TII +NFFL++V SSG IPA TLF ++LLWFVFSIP +FAGSL+A+K
Sbjct: 436 VLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVANK 495

Query: 479 RCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKIXX 538
           +C  + HPTKT QIARQIP QPWYLKTIP + IAG+FPF SIAVE+YFIYTSLW+NKI  
Sbjct: 496 KCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKIFY 555

Query: 539 XXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILFTK 598
                                   YHSLCLENW WQWRSFI+GG GCAIYVFIHSILFTK
Sbjct: 556 MFGFLFVSLLLLALTTSLVTVLITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILFTK 615

Query: 599 FKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647
           FKLGGFTTVVLYLGYS +IS+LCCIVTGSIGF+SSMFF+RKI+SS+KVD
Sbjct: 616 FKLGGFTTVVLYLGYSSIISLLCCIVTGSIGFLSSMFFVRKIFSSIKVD 664

>YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}
           TMN2Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn3p; member
           of the evolutionarily conserved Transmembrane Nine
           family of proteins with nine membrane-spanning segments
          Length = 672

 Score =  869 bits (2245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/667 (62%), Positives = 494/667 (74%), Gaps = 26/667 (3%)

Query: 6   LLFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHX 65
           LL  C  T L K F LPG++PTTYHS DEI LLVN LTPS+ FQH+DE+GN V GDKEH 
Sbjct: 7   LLIYCYAT-LTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHF 65

Query: 66  XXXXXXXXXKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPG 125
                    +FHFC+PE+V +QP SLGSVIFGDRI+NSPF+LNMLEEKECV LC S IPG
Sbjct: 66  LYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPG 125

Query: 126 EDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGF------ 179
           +DAKF+N LIK+GF QNWL+DGLPA R+ +DSRT +N+YGTGF+LGF DV +        
Sbjct: 126 KDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVP 185

Query: 180 -------SDSNDEE------------KKIMKTLEVPYLANHYDINIEYHDRGNDNYRVVG 220
                  S++++E+              ++KT+E+PY  NH+DI +E+HDRGNDNYRVVG
Sbjct: 186 STMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVG 245

Query: 221 VTVDPVSIKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYD 280
           V V+PVSI+RSS  +C      L L E ++NEV+FTYSVKF+ SDTVWATRWDKYLH+YD
Sbjct: 246 VIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYD 305

Query: 281 PTIQWFSLINCXXXXXXXXXXXXHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVF 340
           P IQWFSLIN             H LLRALK+DL+RYNE NLDNEFHEDSGWKL HGDVF
Sbjct: 306 PQIQWFSLINFSVIVILLSSVVMHSLLRALKSDLARYNELNLDNEFHEDSGWKLGHGDVF 365

Query: 341 RIPPRXXXXXXXXXXXXXXFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSY 400
           R P +              FLM+ CSI FAA+G +SP SRGSLPTVMF+LYALFGFVGSY
Sbjct: 366 RTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSY 425

Query: 401 TSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILL 460
            SM +YKFF+GP WK N++LTP+L+PG IF+ I+++NFFL+F  SSG IPA +LF IILL
Sbjct: 426 ASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILL 485

Query: 461 WFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASI 520
           WF+ S+PLSFAGS++AHK+C  D HPTKTNQIARQIP QPWYL+T   +LIAG+F F SI
Sbjct: 486 WFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSI 545

Query: 521 AVELYFIYTSLWFNKIXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRSFII 580
           AVELYFIY+SLWFNKI                          Y+SLCLENW WQWRSFII
Sbjct: 546 AVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYYSLCLENWLWQWRSFII 605

Query: 581 GGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKI 640
           GG GC+IY FIHSILFTKFKLGG  TVVLYLGYS +IS LCC+VTG+IGF SSMFFIRKI
Sbjct: 606 GGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKI 665

Query: 641 YSSVKVD 647
           YS++KV+
Sbjct: 666 YSAIKVE 672

>NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {ON} 
          Length = 666

 Score =  865 bits (2236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/668 (62%), Positives = 492/668 (73%), Gaps = 23/668 (3%)

Query: 1   MLSHSL-LFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVK 59
           MLS  L LF     SL +AFYLPGVAPTTYH  DEI LLVNHLTPS+ FQ  D +G    
Sbjct: 1   MLSPRLVLFFTFFLSLTRAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK--S 58

Query: 60  GDKEHXXXXXXXXXXKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLC 119
            +KEH          + HFCKPE++ +QP SLGS+IFGDRI+NSPF+L MLEEK CV LC
Sbjct: 59  KNKEHFLYSFDYYFDRLHFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLC 118

Query: 120 SSRIPGEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVD----- 174
            S IPG+DAKF+NKLIKNGF QNWLIDGLPA  +++D +T S FYGTGF+LGFV+     
Sbjct: 119 KSTIPGKDAKFINKLIKNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAI 178

Query: 175 -------------VTEGFSDSNDEEK--KIMKTLEVPYLANHYDINIEYHDRGNDNYRVV 219
                          EG      E K  +++K +E+ Y  NHYDI +EYHDRG   YRVV
Sbjct: 179 DGQAPATTKPKQTTNEGLELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVV 238

Query: 220 GVTVDPVSIKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVY 279
           GV V+PVSIKRS+  +C+     L LSE  +N+V+FTYSVKF+ S+TVWATRWDKYLH Y
Sbjct: 239 GVIVNPVSIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTY 298

Query: 280 DPTIQWFSLINCXXXXXXXXXXXXHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDV 339
           DPTIQWFSL+N             H L++ALK+D +RYNEFNL+++F ED+GWKL HGDV
Sbjct: 299 DPTIQWFSLVNFSIIVLLLSSVVIHSLMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDV 358

Query: 340 FRIPPRXXXXXXXXXXXXXXFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGS 399
           FRIP +              FLMI+CSI FAALGFLSPSSRGSL TVMF+LYALFGFVGS
Sbjct: 359 FRIPHKSMLLSVLVGSGVQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGS 418

Query: 400 YTSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIIL 459
           YTSMA+YKFFKGP WKVN+LLTP ++PG IF+TI+ LNFFL+F  SSG +PAGTLF +IL
Sbjct: 419 YTSMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMIL 478

Query: 460 LWFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFAS 519
           LWF+FSIPL+FAGSLIAHK+C  D HPTKTNQIARQIP QPWYLKT P ++IAG+FPF S
Sbjct: 479 LWFIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGS 538

Query: 520 IAVELYFIYTSLWFNKIXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRSFI 579
           IAVELYFIYTSLWFNKI                          YHSLCLENW+WQWR FI
Sbjct: 539 IAVELYFIYTSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYHSLCLENWQWQWRGFI 598

Query: 580 IGGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRK 639
           +GG GCAIYVF+HSILFTKFKLGGF T+VLY+GYS +IS+L C+VTG+IGF+SS+ F+RK
Sbjct: 599 VGGVGCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRK 658

Query: 640 IYSSVKVD 647
           IYS++KVD
Sbjct: 659 IYSAIKVD 666

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  862 bits (2226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/662 (62%), Positives = 486/662 (73%), Gaps = 25/662 (3%)

Query: 11  LLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHXXXXXX 70
           L  +L KAF LPGV+PTTY +NDEI LLVN LTPS+ FQH+DE+G  V  DKEH      
Sbjct: 11  LYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYD 70

Query: 71  XXXXKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKF 130
               KFHFCKPE+V +QP SLGSVIFGDRI+NSPF+L MLE+KECV LC S IPG+DAKF
Sbjct: 71  YYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKF 130

Query: 131 VNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFS---------- 180
           +N LIKNGF QNWL+DGLPA R ++DSRT +N+YGTGF+LGF DV +             
Sbjct: 131 INTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEE 190

Query: 181 -DSNDEEK--------------KIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDP 225
            DS D +                +++T+E+ +  NH++I +EYHDRGN NYRVVGVTV+P
Sbjct: 191 LDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNP 250

Query: 226 VSIKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQW 285
           +SI+RSS  +C      LTL E ++N+V+FTYSVKFI SDTVWATRWDKYLHVYDP IQW
Sbjct: 251 LSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDPQIQW 310

Query: 286 FSLINCXXXXXXXXXXXXHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPR 345
           FSLIN             H +LRA+++D +RYNE NLDNEFHED+GWKL HGDVFRIPP+
Sbjct: 311 FSLINFSIIVILLSSVVIHSILRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRIPPK 370

Query: 346 XXXXXXXXXXXXXXFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAI 405
                         FLMI CSI FAALG +SP+SRGSLPTVMF+LYALFGFVGSYTSM +
Sbjct: 371 SMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTSMGV 430

Query: 406 YKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFS 465
           YKFF GP WK NL++TP+L+PG IF+ I+ +NFFL+F  SSG IPA TLF II LWF  S
Sbjct: 431 YKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSVS 490

Query: 466 IPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELY 525
           IPLSFAGS IAHKRC+ D HPTKTNQIARQ P QPWYL+TI  +LIAG+F F SIAVELY
Sbjct: 491 IPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAVELY 550

Query: 526 FIYTSLWFNKIXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRSFIIGGCGC 585
           FIY+SLWFNKI                          YHSLCLENW WQWRSFIIGG GC
Sbjct: 551 FIYSSLWFNKIFYMFGFLLFSFLLLTLATSLVTVFITYHSLCLENWSWQWRSFIIGGLGC 610

Query: 586 AIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVK 645
           ++Y+FIH+ILFTKFKLGGF TVVLY+GYS +IS LCC+VTG+IGF SSM FIRKIYS +K
Sbjct: 611 SVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIYSRIK 670

Query: 646 VD 647
           V+
Sbjct: 671 VE 672

>KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {ON}
           Anc_8.254 YLR083C
          Length = 667

 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/670 (61%), Positives = 495/670 (73%), Gaps = 26/670 (3%)

Query: 1   MLSH------SLLFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDED 54
           M+SH      +LL+ C     V AFYLPGVAPTTY +NDEI LLVNHL+PSM +QHE ED
Sbjct: 1   MISHTVHLGLALLWAC---GQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETED 57

Query: 55  GNMVKGDKEHXXXXXXXXXXKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKE 114
           G  +KGDK            +FHFC+PE +V++P SLGS+IFGDRI+NSP+++ MLEEK 
Sbjct: 58  GENMKGDKSRYLYSYDYYYDRFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKT 117

Query: 115 CVPLCSSRIPGEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVD 174
           CVPLC++ IPG+DA+F+NKLIKNGF QNWLIDGLPA R +HD  TNS+FYG GF+LG V+
Sbjct: 118 CVPLCNTIIPGKDAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVE 177

Query: 175 VTEGFSDSNDEEK-----------------KIMKTLEVPYLANHYDINIEYHDRGNDNYR 217
           V +  + +    K                 +++K +E+PY ANH+DI +EYHDRG  N R
Sbjct: 178 VVQAVAQAKTHPKEDDSGSAKLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLR 237

Query: 218 VVGVTVDPVSIKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLH 277
           VVGVTVDP+SIKRSS  +CQ +   L L E  +NEV+FTYSV+F+ SDTVWATRWDKYLH
Sbjct: 238 VVGVTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLH 297

Query: 278 VYDPTIQWFSLINCXXXXXXXXXXXXHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHG 337
            YDPTIQWFSL+N             HMLL+AL++D +RYNE NLDNEF EDSGWKL+HG
Sbjct: 298 TYDPTIQWFSLVNFSIVVVLLSSVVIHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHG 357

Query: 338 DVFRIPPRXXXXXXXXXXXXXXFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFV 397
           DVFRIP +              FLMI+ SI FAALGFLSPSSRGSL TVMF+LYALFGFV
Sbjct: 358 DVFRIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFV 417

Query: 398 GSYTSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTI 457
           GSYTSM +YKFF+GP WK N++LTP+LVPG + ++I+ LN FL+   SSG IPA TLF I
Sbjct: 418 GSYTSMGVYKFFRGPYWKANMILTPLLVPGCLLLSIVGLNMFLLGAHSSGTIPAKTLFFI 477

Query: 458 ILLWFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPF 517
           +LLWFV S+P + AGSLIAHK+C  D HPTKTNQ+ARQ+P QPWYLKT+  + IAG+FPF
Sbjct: 478 VLLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPF 537

Query: 518 ASIAVELYFIYTSLWFNKIXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRS 577
            SIAVELYFIYTSLW+NKI                          YHSL LENW+WQWRS
Sbjct: 538 GSIAVELYFIYTSLWYNKIFYMFGFLFVSFLLLTLTTVLVTILITYHSLSLENWQWQWRS 597

Query: 578 FIIGGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFI 637
           FI+GG GCAIY+F+HSILFTK KLGGF T+VLY+GYS +IS+LCC+VTGSIGF+SSMFF+
Sbjct: 598 FIVGGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFV 657

Query: 638 RKIYSSVKVD 647
           R+IYSS+KV+
Sbjct: 658 RRIYSSIKVE 667

>Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON}
           YDR107C (REAL)
          Length = 690

 Score =  853 bits (2203), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/658 (62%), Positives = 479/658 (72%), Gaps = 25/658 (3%)

Query: 15  LVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHXXXXXXXXXX 74
           L KAF LPG++PTTYH NDEI LLVN LTPS+ FQH+DE+G  +  DKEH          
Sbjct: 33  LTKAFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDISSDKEHYLYSYDYYNE 92

Query: 75  KFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKL 134
           +FHFC+PE+V RQP SLGS+IFGDRI+NSPF+L MLE KECV LC + IPG+DAKF+NKL
Sbjct: 93  RFHFCRPEHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALCENTIPGKDAKFINKL 152

Query: 135 IKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTE----------------- 177
           IK+GF QNWL+DGLPA R++ DSRT +N+YGTGF+LG   V                   
Sbjct: 153 IKSGFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELGITAVKNTIDGKVIPSTMEELDSE 212

Query: 178 ----GFSDSNDEEKKI----MKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIK 229
               G +    E K I    +KT+E+PY  NH+DI +E+HDRG+DNYRVVGVTV+P+SI+
Sbjct: 213 TSNTGAALDAREPKNIKPNLVKTVELPYFVNHFDIEVEFHDRGDDNYRVVGVTVNPMSIE 272

Query: 230 RSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLI 289
           RSS DSC   +  L L E  +NE++FTYSVKF+ SDTVWATRWDKYLH+YDP IQWFSLI
Sbjct: 273 RSSPDSCSKATKPLILDEEGDNEIYFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFSLI 332

Query: 290 NCXXXXXXXXXXXXHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRXXXX 349
           N             H LLRAL +DLSRYNE NLDNEFHEDSGWKL HGDVFR P +    
Sbjct: 333 NFSVIIVLLSSVVMHSLLRALNSDLSRYNELNLDNEFHEDSGWKLGHGDVFRTPTKSMLL 392

Query: 350 XXXXXXXXXXFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFF 409
                     FLMI CSI  AALG +SP SRGSLPTVMF+ YALFGFVGSYTSM +YKFF
Sbjct: 393 SVLVGSGVQLFLMIICSIFLAALGLVSPVSRGSLPTVMFVFYALFGFVGSYTSMGVYKFF 452

Query: 410 KGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLS 469
            GP WK NL+LTP+L+PGGIFV I+ +NFFL+F  SSG IPA TLF II LWF  SIPLS
Sbjct: 453 HGPYWKANLILTPILLPGGIFVLIVAMNFFLLFAHSSGVIPASTLFFIIFLWFAVSIPLS 512

Query: 470 FAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYT 529
           FAGS+IAHK C  D HPTKTNQIARQ+P QPWYL+TI  +LIAG+F F SIAVELYFIY+
Sbjct: 513 FAGSMIAHKWCNWDEHPTKTNQIARQVPYQPWYLRTIQATLIAGIFCFGSIAVELYFIYS 572

Query: 530 SLWFNKIXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRSFIIGGCGCAIYV 589
           SLWFNKI                          YHSLCLENW+WQWRSFIIGG GC++Y+
Sbjct: 573 SLWFNKIFYMFGFLLFSFLLLTLTTSLVTVLITYHSLCLENWQWQWRSFIIGGLGCSVYM 632

Query: 590 FIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647
           FIHSILFTKFKLGGF T+VLY GYS +IS LCC+VTG+IGF S M FIRKIYS+VK++
Sbjct: 633 FIHSILFTKFKLGGFITIVLYFGYSFIISALCCVVTGAIGFFSCMLFIRKIYSAVKIE 690

>Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  845 bits (2182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/658 (61%), Positives = 479/658 (72%), Gaps = 25/658 (3%)

Query: 15  LVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHXXXXXXXXXX 74
           + KAF LPG++PTTYHSNDEI LLVN LTPS+ FQH+DE+GN +  DKEH          
Sbjct: 15  VAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNE 74

Query: 75  KFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKL 134
           +FHFC+PE+V +QP SLGSVIFGDRI+NSPF+L MLEEKECV LC   IPG DA+F+N+L
Sbjct: 75  RFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRL 134

Query: 135 IKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDS---NDEEKKIM- 190
           I +GF QNWL+DGLPA R ++DSRT +N+YGTGF+LGF DV +   D    N  E+  M 
Sbjct: 135 IISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMD 194

Query: 191 ---------------------KTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIK 229
                                KT+E+PY  NH++I +E+H+RGND+YR+VGVTV+PVSI+
Sbjct: 195 ASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIE 254

Query: 230 RSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLI 289
           RSS  SC      LTL E  +NEV+FTYSVKF+ S TVWATRWDKYLH+YDP IQWFSLI
Sbjct: 255 RSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDPQIQWFSLI 314

Query: 290 NCXXXXXXXXXXXXHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRXXXX 349
                         H LLRALK+DL+RYNE NL+NEFHED+GWKLSHGDVFR PP+    
Sbjct: 315 GFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSMLL 374

Query: 350 XXXXXXXXXXFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFF 409
                     FLMI CSI FAA G +SP SRGSL TVMFLLYALFGFVGSYTSM +YKFF
Sbjct: 375 SVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYTSMGVYKFF 434

Query: 410 KGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLS 469
            GP WK NL++TP+L+PG I + I+ +N FL+F  SSG IPA +LF II LWFV SIPLS
Sbjct: 435 HGPYWKANLIITPILLPGAILLLIVAMNIFLLFAHSSGVIPAKSLFFIIFLWFVVSIPLS 494

Query: 470 FAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYT 529
           F GS++AHKRC  + HPTKTNQIARQIP QPWYL+T   +++AG+F F SIAVELYFIY+
Sbjct: 495 FVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIAVELYFIYS 554

Query: 530 SLWFNKIXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRSFIIGGCGCAIYV 589
           SLWFNKI                          YHSLCLENW WQWRSFIIGG GC+IY+
Sbjct: 555 SLWFNKIFYMFGFLLFSFLLLTLTTSLITVLITYHSLCLENWLWQWRSFIIGGLGCSIYM 614

Query: 590 FIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647
           FIHSILFTKFKLGGF TVVLYLGYS ++SVLCC+VTG+IGF SSM FIRKIY +VKV+
Sbjct: 615 FIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYYAVKVE 672

>Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}
           complement(78246..80222) [1977 nt, 659 aa]
          Length = 658

 Score =  835 bits (2158), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/654 (61%), Positives = 480/654 (73%), Gaps = 19/654 (2%)

Query: 10  CLLT---SLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHXX 66
           CLL+   +L  AFYLPGVAPTTY   DEI LLVNHLTPS+NFQH+D+ GN +KG+KEH  
Sbjct: 8   CLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFL 67

Query: 67  XXXXXXXXKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGE 126
                   K HFCKPE+V +QP SLGS++FGDRI+NSPF + MLE +EC  LC   IP +
Sbjct: 68  YSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPAD 127

Query: 127 DAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTE---GFSDSN 183
           DAKF+NKLIKNGF QNWLIDGLPA R++HD +T S+FYGTGF LG V V +   G + S 
Sbjct: 128 DAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSK 187

Query: 184 -------DEEKKI---MKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSS 233
                   E K +   +  +E+P+L NHYDIN+EYHDRG  NYRVVGVTVDP   K S+ 
Sbjct: 188 LNLENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDP---KSSTG 244

Query: 234 DSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCXX 293
           D C   SG L L ETE+NEV F+YSV+FI S+TVWATRWDKYLHVYDPTIQWFSLIN   
Sbjct: 245 DICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLINFSV 304

Query: 294 XXXXXXXXXXHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRXXXXXXXX 353
                     H L+RALK+D +RY EFNLD+ F +DSGWKL HGDVFRIP +        
Sbjct: 305 VVILLSMVVIHSLMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILV 364

Query: 354 XXXXXXFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPL 413
                 FLM+A SI FAA+G LSPSSRGSLP+ MF+LYALFGF GSY SM +YKFF GP 
Sbjct: 365 GSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPY 424

Query: 414 WKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGS 473
           WK N++LTP+LVPG +F++I+ LNFFL+F RSSG IP   L  +I+LWF+ SIPLS AGS
Sbjct: 425 WKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGS 484

Query: 474 LIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWF 533
           LIA+K+C    HPTKTN+IARQIP QPWYLKT+P +LIAG+FPF SIAVELYFIY+SLWF
Sbjct: 485 LIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYSSLWF 544

Query: 534 NKIXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRSFIIGGCGCAIYVFIHS 593
           NKI                          Y+SL LENW+WQWRSFI+GG GCA Y+F+HS
Sbjct: 545 NKIFYMFGFLFVSFLLLTLTTTLVTILITYYSLNLENWRWQWRSFIVGGVGCAFYIFVHS 604

Query: 594 ILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647
           I+FTKFKLGGFTT+VLY+GYS +IS LC +VTG+IGFISSM F++KIYSSVKVD
Sbjct: 605 IIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD 658

>SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 660

 Score =  830 bits (2144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/651 (61%), Positives = 470/651 (72%), Gaps = 18/651 (2%)

Query: 14  SLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHXXXXXXXXX 73
            +  AFYLPGVAPTTYH  DEI LLVNHLTPS  FQH D++G+ + GDKE          
Sbjct: 11  QIASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYY 70

Query: 74  XKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNK 133
            KFHFC+PEN+++QP SLGS+IFGDRI+NSPF+LNMLE K CVPLC S IP +DAKF+NK
Sbjct: 71  DKFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINK 130

Query: 134 LIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSN---------- 183
           LI+NGF  NWL+DGLPA RE+HD RTNS FYG GF+LGFVDV +   D +          
Sbjct: 131 LIRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYI 190

Query: 184 ---DEEKKI----MKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSC 236
              D +K++     K  E+ Y  NH+DI IEYHDRG DNYRVVGV+V P SIKR SSDSC
Sbjct: 191 EIADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSC 250

Query: 237 QYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCXXXXX 296
                 L LSE  +N VHFTYSV F+ S T+WATRWDKYLHVYDP IQWFSLI+      
Sbjct: 251 DTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFSLISFSLIVI 310

Query: 297 XXXXXXXHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRXXXXXXXXXXX 356
                  H L RALKNDLSRYNE NLD+EF E++GWKL HGDVFR P R           
Sbjct: 311 LLSSVMVHSLFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSG 370

Query: 357 XXXFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKV 416
              FLM   +I+FA LG LSPSSRGSL TVMF+LYALFG  GSYTSMA+YKFF G  WK+
Sbjct: 371 AQLFLMAGFTILFALLGLLSPSSRGSLTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKL 430

Query: 417 NLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIA 476
           N++LTP+L+P  IF++++ LN FLVFV SSGAIP GT+  I++LWFVFSIPLS AGS+I+
Sbjct: 431 NMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIIS 490

Query: 477 HKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKI 536
            K+ + D  PT TNQIARQIP QPWYLKT+P SLIAG FPF SI VELYFIY+SLWFNKI
Sbjct: 491 RKKSQWD-RPTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKI 549

Query: 537 XXXXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILF 596
                                     Y+SLC+ENWKWQWR F IGG GCA YVF+H+ILF
Sbjct: 550 FYMFGFLFFSFLLLTLTTTLVTVLLTYYSLCMENWKWQWRGFWIGGAGCAFYVFVHAILF 609

Query: 597 TKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647
           TKFKLGG TTVVLYLGYS +IS LCC++TG++GF+SS++F+RKIY S+KVD
Sbjct: 610 TKFKLGGLTTVVLYLGYSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660

>KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]
           {ON} similar to uniprot|P32802 Saccharomyces cerevisiae
           YLR083C EMP70 Protein whose 24kDa cleavage product is
           found in endosome-enriched membrane fractions predicted
           to be a transmembrane protein
          Length = 665

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/662 (61%), Positives = 477/662 (72%), Gaps = 17/662 (2%)

Query: 2   LSHSLLFVCLLTSL-VKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKG 60
           L  SLL   L+ SL V+AFYLPGVAPTTYH  D++ LLVNHLTPS  ++H D D +   G
Sbjct: 5   LWRSLLVSTLIGSLLVEAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYKHYDTDQHDT-G 63

Query: 61  DKEHXXXXXXXXXXKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCS 120
           DKE           KFHFC+P  + +QP SLGS+IFGDRI+NSPFKL +L+  EC  LC 
Sbjct: 64  DKEGFLYSYDYYYKKFHFCQPAELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCK 123

Query: 121 SRIPGEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFS 180
           S IPG+DAKF+NKLI NGF QNW+IDGLPA R++ D++TN  FYG GF+LG VDV   + 
Sbjct: 124 SVIPGKDAKFINKLILNGFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVDVLSDYE 183

Query: 181 DS----NDE-------EKKIM----KTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDP 225
                 +DE       +K ++    K  E+PY  NHYDI IEYHDRG +NYR+VGVTV+P
Sbjct: 184 PDTRSLHDELELQLNAKKNVLSPGDKVTEIPYFVNHYDIQIEYHDRGENNYRIVGVTVNP 243

Query: 226 VSIKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQW 285
            SIKR S DSC+    SL LSETE+NEV+FTYSVKFIKSDTVWATRWDKYLHVYDP IQW
Sbjct: 244 ASIKRDSPDSCESTGKSLVLSETEDNEVYFTYSVKFIKSDTVWATRWDKYLHVYDPKIQW 303

Query: 286 FSLINCXXXXXXXXXXXXHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPR 345
           FSLIN             H L  ALKNDL+RYNE NLD +F E++GWKL HGDVFR P +
Sbjct: 304 FSLINFSTIVVLLSSVMLHSLYSALKNDLARYNELNLDTDFEEETGWKLIHGDVFRSPNK 363

Query: 346 XXXXXXXXXXXXXXFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAI 405
                          LM+  +I+FA LGFLSPSSRGSL TVMFLLYA+FG  GS+TSMA 
Sbjct: 364 ALLLSVLVGSGGQLALMLTTTILFACLGFLSPSSRGSLSTVMFLLYAIFGSFGSFTSMAT 423

Query: 406 YKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFS 465
           YKFF G  W++NL+LTP+LVPG I   ++ LNFFL+FV SSGAIP  T+  ++LLWFV S
Sbjct: 424 YKFFNGKAWRLNLVLTPLLVPGSILTVVLGLNFFLIFVHSSGAIPFQTMLVLVLLWFVIS 483

Query: 466 IPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELY 525
           IPLS  GS+IA K+C  + HPTKTNQIARQIP QPWYLKTIPV+L+AG+FPF SIAVELY
Sbjct: 484 IPLSAIGSVIAWKKCNWNEHPTKTNQIARQIPFQPWYLKTIPVALLAGIFPFGSIAVELY 543

Query: 526 FIYTSLWFNKIXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRSFIIGGCGC 585
           FIY+SLWFNKI                          YHSLC+ENWKWQWRSF+IGGCGC
Sbjct: 544 FIYSSLWFNKIYYMFGFLFFSFILLALTTSLITVLLTYHSLCMENWKWQWRSFVIGGCGC 603

Query: 586 AIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVK 645
           A YVF HSILFTKF+LGG TT+VLYLGYS LIS LCC+VTG+IGF+SS+  +RKIYS VK
Sbjct: 604 AFYVFCHSILFTKFRLGGLTTIVLYLGYSILISGLCCLVTGAIGFLSSLILVRKIYSCVK 663

Query: 646 VD 647
           VD
Sbjct: 664 VD 665

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score =  814 bits (2103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/668 (58%), Positives = 481/668 (72%), Gaps = 30/668 (4%)

Query: 9   VCLLT-SLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHXXX 67
           +CL+T S+   FYLPGVAPTTYH  D I LLVNHLTPSM F+H+D DGN +  DKE+   
Sbjct: 10  ICLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLY 69

Query: 68  XXXXXXXKFHFCKP--ENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPG 125
                  K HFCKP    + +QP SLGS++FGDRI+NSPF+L ML ++ C  LCS+ IPG
Sbjct: 70  SYDYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPG 129

Query: 126 EDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVD----------- 174
           +DAKF+N LIK+GF+QNWLIDGLPA R+++D  T S+FYG+GF+LG V+           
Sbjct: 130 DDAKFINDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSH 189

Query: 175 -------VTEGFSDSNDEEKKIMK--------TLEVPYLANHYDINIEYHDRGNDNYRVV 219
                  V +  S   DEE+   K        ++E  Y ANH+DI+IEYHDRGN+ YR+V
Sbjct: 190 TTPKQPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIV 249

Query: 220 GVTVDPVSIKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVY 279
           GVTV+P+S+KR S+  C  N G L LSE  + +V FTYSV F KSDTVWATRWDKYLH+Y
Sbjct: 250 GVTVNPISMKRDSA-ICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIY 308

Query: 280 DPTIQWFSLINCXXXXXXXXXXXXHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDV 339
           DPTIQWFSLIN             H L +ALKND  RYNEFNL++ F EDSGWKL+HGDV
Sbjct: 309 DPTIQWFSLINFTVIVVVLSIIVVHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDV 368

Query: 340 FRIPPRXXXXXXXXXXXXXXFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGS 399
           FRIP +              F MI+  ++ AALGFLSPS+RGSLPT+MF+LYA+FGFVGS
Sbjct: 369 FRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGS 428

Query: 400 YTSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIIL 459
           YTSM +Y+FF GP WK N++LTP++VPGGIF+ II +N FLVFV SS  +P GTL  ++L
Sbjct: 429 YTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVL 488

Query: 460 LWFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFAS 519
           LW V S+PLSFAGSLI+ KRC   +HPTKTN++ RQIP QPWYLKT+P +LI G+FPF S
Sbjct: 489 LWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGS 548

Query: 520 IAVELYFIYTSLWFNKIXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRSFI 579
           IAVELYFIY+SLWFNKI                          YHSLCLENW+WQWRSFI
Sbjct: 549 IAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFI 608

Query: 580 IGGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRK 639
           IGG GC+IY+FIHSILFT+FKLGGF T+VLY+GYS LI++LC +VTG+IGFIS+MFF++K
Sbjct: 609 IGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKK 668

Query: 640 IYSSVKVD 647
           IYSS+KV+
Sbjct: 669 IYSSIKVE 676

>KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 687

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/688 (58%), Positives = 473/688 (68%), Gaps = 42/688 (6%)

Query: 1   MLSHSLLFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKG 60
           M+S  LL   L  S V  FYLPGVAPTTYH  D I LLVNHLTP+M +QH DEDGN + G
Sbjct: 1   MVSAILLLSILWASQVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-G 59

Query: 61  DKEHXXXXXXXXXXKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCS 120
           DKE           KFHFC+PE + +Q  SLGS+IFGDRI+NSPF++ ML+ KEC  LCS
Sbjct: 60  DKESLLYSYDYYYPKFHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCS 119

Query: 121 SRIPGEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVT---- 176
             IP +DAKF+NKLI NGF QNWL+DGLPA R+  D RT S FY  GF+LG+V +     
Sbjct: 120 ESIPADDAKFINKLITNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSEL 179

Query: 177 ----EGFSDSNDEE---------------------------------KKIMKTLEVPYLA 199
               +G S   D+                                  K+++K LE PY A
Sbjct: 180 RMNGQGGSQDGDDSGSHGSTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFA 239

Query: 200 NHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQYNSGSLTLSETEENEVHFTYSV 259
           NH++I ++YHDRGN NYRVVGV V+P SIKR S D+C      L LSETE  EVHF+YSV
Sbjct: 240 NHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSV 299

Query: 260 KFIKSDTVWATRWDKYLHVYDPTIQWFSLINCXXXXXXXXXXXXHMLLRALKNDLSRYNE 319
           KF  S+TVWATRWDKYLHVYDP IQWFSLIN             H L   L +DLSRYN+
Sbjct: 300 KFTPSETVWATRWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQ 359

Query: 320 FNLDNEFHEDSGWKLSHGDVFRIPPRXXXXXXXXXXXXXXFLMIACSIIFAALGFLSPSS 379
            NLD++F E++GWKL HGDVFR P R              FLM AC+I FA LG LSPSS
Sbjct: 360 INLDDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFALLGLLSPSS 419

Query: 380 RGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFF 439
           RGSL TVMF+LYALFG  GSYTSMA YKFF GP WKVN+LLTP+LVPG +F  ++ LNFF
Sbjct: 420 RGSLTTVMFILYALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFF 479

Query: 440 LVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQ 499
           LV V S+GAIP GT+  I+LLWF+FSIPLS AGSLIA K+C+ D HPTKT QI RQIP Q
Sbjct: 480 LVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQ 539

Query: 500 PWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKIXXXXXXXXXXXXXXXXXXXXXXX 559
           PWYLKT+P SLIAG+FPF SIAVELYFIY+SLWFNKI                       
Sbjct: 540 PWYLKTVPASLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTSLITV 599

Query: 560 XXXYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISV 619
              Y+SLCLENWKWQWR F IGG GCA+Y+FIH+ILFTKF+LGGFTT+VLY+GYS ++S+
Sbjct: 600 LLTYYSLCLENWKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSL 659

Query: 620 LCCIVTGSIGFISSMFFIRKIYSSVKVD 647
           L C++TG++GF+SS++F+R+IYSSVKVD
Sbjct: 660 LSCLITGTVGFLSSLWFVRRIYSSVKVD 687

>CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {ON}
           highly similar to uniprot|Q04562 Saccharomyces
           cerevisiae YDR107c or uniprot|P32802 Saccharomyces
           cerevisiae YLR083c EMP70
          Length = 691

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/691 (57%), Positives = 470/691 (68%), Gaps = 45/691 (6%)

Query: 2   LSHSLLFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGD 61
           +   LL + L  +    FYLPG AP TY   D I LLVNHLTPS+NFQH D+DGN +KGD
Sbjct: 1   MVRQLLVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGD 60

Query: 62  KEHXXXXXXXXXXKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSS 121
           K            K HFC+PE + +QP SLGSVIFG++I+NSPF + MLE+ ECV LCS+
Sbjct: 61  KARMLYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCST 120

Query: 122 RIPGEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEG--- 178
            IPG+DAKF+NKLIKNGFMQNWLIDGLPA R++HDSRTN+ FYG GF+LGFV+V +    
Sbjct: 121 TIPGKDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGG 180

Query: 179 ----------------------FSD------------SNDEEKK-------IMKTLEVPY 197
                                 F+D            SN E ++       I+  +EVP 
Sbjct: 181 KIVSESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPV 240

Query: 198 LANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQY-NSGSLTLSETEENEVHFT 256
            ANH+DI +EYHDRGN ++RVVGV V+PVS+    S SC   N   L L E ++NEV FT
Sbjct: 241 FANHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFT 300

Query: 257 YSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCXXXXXXXXXXXXHMLLRALKNDLSR 316
           YSVKF  SDT WATRWDKYLH+YDP IQWFSLIN             H LLRALK+D+SR
Sbjct: 301 YSVKFTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISR 360

Query: 317 YNEFNLDNEFHEDSGWKLSHGDVFRIPPRXXXXXXXXXXXXXXFLMIACSIIFAALGFLS 376
           YNEFNL +EF EDSGWKL HGDVFR P                FLMI  SII +ALG LS
Sbjct: 361 YNEFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALGILS 420

Query: 377 PSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTIILL 436
           PSSRGSLPT MF+ YA+FGFVGSYTSM IYKFFKGP WK N++LTPVL+PG IF+T+I +
Sbjct: 421 PSSRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFM 480

Query: 437 NFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIARQI 496
           N  L FV SS  IP  TL  ++ LW +FSIPL+FAGSLI++K+C  D HPTKTN+I RQI
Sbjct: 481 NVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQI 540

Query: 497 PIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKIXXXXXXXXXXXXXXXXXXXX 556
           P QPW+LKT+P +LI G+  F SIAVELYFIY+SLWFNKI                    
Sbjct: 541 PFQPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGL 600

Query: 557 XXXXXXYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSGL 616
                 Y +LC ENW WQWRSF IGG GC+IY+FIHSILFT+FKLGGF T+VLY+GYS L
Sbjct: 601 INVIITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFL 660

Query: 617 ISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647
           IS L CIVTG+IGFI SMFF+R+I++S+KVD
Sbjct: 661 ISFLTCIVTGAIGFICSMFFVRRIFASIKVD 691

>Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {ON}
           YLR083C (EMP70) - endosomal membrane protein [contig
           176] FULL
          Length = 683

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/671 (58%), Positives = 470/671 (70%), Gaps = 37/671 (5%)

Query: 13  TSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHXXXXXXXX 72
            S V+ FYLPGVAPTTYH  D I LLVNHLTPSM F+H D+DG    GD+E         
Sbjct: 14  ASRVEGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDT-GDRESFLYSYDYY 72

Query: 73  XXKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVN 132
             KFHFCKPE + +Q  SLGS+IFGDRI+NSPFKL ML++KEC  LCSS+IP  DAKF+N
Sbjct: 73  YDKFHFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFIN 132

Query: 133 KLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVT--------EGFSDS-- 182
           KLI NGF QNWL+DGLPA R+  D RT S FY  GF+LGF+DV         +G  D+  
Sbjct: 133 KLIANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHP 192

Query: 183 --------------------NDEEKKIM------KTLEVPYLANHYDINIEYHDRGNDNY 216
                               N++ KKI+      K LE  Y ANH++I ++YHDRGN +Y
Sbjct: 193 KGATKPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDY 252

Query: 217 RVVGVTVDPVSIKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYL 276
           RVVGV V+P SIKR SS+SC      L LSE EE  VHF+YSVKF  SDTVWATRWDKYL
Sbjct: 253 RVVGVIVNPQSIKRDSSNSCAATGELLKLSEEEETTVHFSYSVKFTPSDTVWATRWDKYL 312

Query: 277 HVYDPTIQWFSLINCXXXXXXXXXXXXHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSH 336
           HVYDP IQW+SLIN             H L R L++DLSRYN+ NLD++F E++GWKL H
Sbjct: 313 HVYDPKIQWYSLINFSIVVIVLSSVVIHSLYRTLRDDLSRYNQLNLDDDFQEETGWKLVH 372

Query: 337 GDVFRIPPRXXXXXXXXXXXXXXFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGF 396
           GDVFR P +              F+M AC+I FA LG LSPSSRGSL TVMF+LYALFG 
Sbjct: 373 GDVFRTPTKSLLLSVLVGSGTQLFVMAACTIAFALLGLLSPSSRGSLTTVMFILYALFGS 432

Query: 397 VGSYTSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFT 456
           +GSYTSMA YKFF G  WKVN++LTP+LVPG +F  ++ LNFFL+ V S+GAIP GT+  
Sbjct: 433 LGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCA 492

Query: 457 IILLWFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFP 516
           I+LLWFVFSIPLS AGSLIA K+CR + HPTKT QI RQIP QPWYLKT P +LIAG+FP
Sbjct: 493 IVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFP 552

Query: 517 FASIAVELYFIYTSLWFNKIXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWR 576
           F SIAVELYF+Y+SLWFNKI                          Y+SLCLENWKWQWR
Sbjct: 553 FGSIAVELYFVYSSLWFNKIFYMFGFLFVSFLLLTLTTALVTVLLTYYSLCLENWKWQWR 612

Query: 577 SFIIGGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFF 636
            F IGG GCA+YVF+H+ILFTKFKLGGF T+VLY+GYS +IS+L C++TG++GF+SS++F
Sbjct: 613 GFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWF 672

Query: 637 IRKIYSSVKVD 647
           +R+IYSS+KVD
Sbjct: 673 VRRIYSSIKVD 683

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/687 (56%), Positives = 468/687 (68%), Gaps = 49/687 (7%)

Query: 5   SLLFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEH 64
           S L +  L S   AFYLPGVAP+TY+  DE+ LLVNHLTPS+N+Q +D+ G  V+  +E 
Sbjct: 4   SYLLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVE-SREK 62

Query: 65  XXXXXXXXXXKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIP 124
                     K HFCKPE +V+QP SLGS++FGDRI+NSPF + ML+ +  V LCS  IP
Sbjct: 63  MLYSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIP 122

Query: 125 GEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGF----- 179
           G DAKF+NKLIKNGF QNWLIDGLPA R+I+DS T++ FY  GF LGFV++ +       
Sbjct: 123 GSDAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGI 182

Query: 180 -------------------------------SDSNDEEK-------KIMKTLEVPYLANH 201
                                           DSN +EK       K++  +E PYLANH
Sbjct: 183 PMDAKTKDSGKKNSNSDKKKDSKKKDDSQKKEDSNKKEKREPKRISKLVHNVEFPYLANH 242

Query: 202 YDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQYNSGS-LTLSETEENEVHFTYSVK 260
           Y IN+E HDRG  NYRVVGVTVDP     S++DS     G+ L L E ++NEV F+YSV 
Sbjct: 243 YVINVEVHDRGEGNYRVVGVTVDP----YSTTDSANPEKGNKLFLDEKKDNEVTFSYSVN 298

Query: 261 FIKSDTVWATRWDKYLHVYDPTIQWFSLINCXXXXXXXXXXXXHMLLRALKNDLSRYNEF 320
           FI+S+TVWATRWDKYLH Y+PTIQWFSL+N             + LL+ALK+D +RY EF
Sbjct: 299 FIESETVWATRWDKYLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSDFARYEEF 358

Query: 321 NLDNEFHEDSGWKLSHGDVFRIPPRXXXXXXXXXXXXXXFLMIACSIIFAALGFLSPSSR 380
           NLDN F+EDSGWKL HGDVFRIP +              FLMI  SI  AA+G +SPSSR
Sbjct: 359 NLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSR 418

Query: 381 GSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFL 440
           GSLP+ MF  YALFGF GSY SM++YKFFKGP WK N++LTP+LVPG I V+I+ LNFFL
Sbjct: 419 GSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFL 478

Query: 441 VFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQP 500
           +FV SSG IP   L  I+++WFV S+PLSF GSL+A+KR     HPTKTNQIARQIP Q 
Sbjct: 479 LFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQS 538

Query: 501 WYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKIXXXXXXXXXXXXXXXXXXXXXXXX 560
           WYLKTIP  LIAG+FPF +IAVELYFIYTSLWFNKI                        
Sbjct: 539 WYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLTTSLVTVL 598

Query: 561 XXYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVL 620
             Y SLC+ENW WQWRSF IGG GC++Y+FIHSILFTKFKLGGFTT++LY+GY+ L+S+L
Sbjct: 599 ITYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSIL 658

Query: 621 CCIVTGSIGFISSMFFIRKIYSSVKVD 647
            CIVTG++GFISSM F+RKIYS+V+VD
Sbjct: 659 SCIVTGAVGFISSMIFVRKIYSNVRVD 685

>TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {ON}
           Anc_8.254 YLR083C
          Length = 673

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/653 (55%), Positives = 452/653 (69%), Gaps = 23/653 (3%)

Query: 17  KAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHXXXXXXXXXXKF 76
            AFY+PG++  TYH  D I+L VN LTPSM F+H DE+G  V  DKEH          KF
Sbjct: 20  NAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKF 79

Query: 77  HFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLIK 136
           HFC+PE V R+  SLGSV+FGDRI+NSPF+L MLE KECVPLC + IP +DAKF+NKLIK
Sbjct: 80  HFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLIK 139

Query: 137 NGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTE----------GFSDSNDEE 186
           NGF  NWLIDGLP+ R+I+DS+T S FY +GF LG V V            G S   +E 
Sbjct: 140 NGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNEA 199

Query: 187 KKIMK-------------TLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSS 233
            K  K               EV Y ANH++I+IEYHDRGN+NYRVVGVTVDP+SIKR   
Sbjct: 200 VKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDDF 259

Query: 234 DSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCXX 293
           +SC      L L+E  EN+V FTYSV FIKS+T WATRWDKYLH YDP+IQWFSLIN   
Sbjct: 260 ESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPSIQWFSLINFTI 319

Query: 294 XXXXXXXXXXHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRXXXXXXXX 353
                     H LLRALK D+SRY + NLDN F EDSGWKL+HGDVFR+P +        
Sbjct: 320 VVVLLSTIVIHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRKAMVLSIYV 379

Query: 354 XXXXXXFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPL 413
                 FLMI C +  AALGF+SPS RG+LPT MF+LYA+FGFVGSYTSM +YKFF GP 
Sbjct: 380 GSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTSMGVYKFFHGPY 439

Query: 414 WKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGS 473
           WK N++LTP+LVPG + + II LNFFL+ V SSG IPA T+  +I LW + S+PLSF GS
Sbjct: 440 WKANMILTPLLVPGSMLLLIIFLNFFLLGVHSSGTIPASTIILMICLWLLVSVPLSFLGS 499

Query: 474 LIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWF 533
            +A K+C  +++PT  N+I R+IPIQPWY+++IPV L++G+ PF +IAVELYFIY+SLW+
Sbjct: 500 FVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYSSLWY 559

Query: 534 NKIXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRSFIIGGCGCAIYVFIHS 593
           NKI                          YHSLCLENW+WQWRSF+ GG GCA Y+F++S
Sbjct: 560 NKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGGLGCAFYIFLYS 619

Query: 594 ILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKV 646
           I FT+FK  GF +++LY+GYS LI V+ C++TG++ F+ +MFF+++I++S+KV
Sbjct: 620 IAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFTSIKV 672

>TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {ON}
           Anc_8.254 YLR083C
          Length = 656

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/650 (55%), Positives = 456/650 (70%), Gaps = 12/650 (1%)

Query: 9   VCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHXXXX 68
           + LL ++ +A +LPG++PT Y +  EI L VNHLTPS +FQH+D+DGN +K DKEH    
Sbjct: 8   LSLLWAVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYS 67

Query: 69  XXXXXXKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDA 128
                 K HFCKPENV+ Q  SLGSV+FGDR++NSPFKLNMLE+K CV LC S IPGEDA
Sbjct: 68  YDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDA 127

Query: 129 KFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSD----SND 184
            F+NKLIKNGF+ NWL+DGLPAG  I++ R +S     GF LG V++ +G  +    +  
Sbjct: 128 AFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATPR 187

Query: 185 EE-------KKIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQ 237
           EE         ++  LE+P+L NHYDI I+YH+     YR+VGV V+P SIK++S +SC+
Sbjct: 188 EETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQTS-NSCE 246

Query: 238 YNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCXXXXXX 297
           +    ++LSE ++NEV +TYSV++++    WATRWD Y   YD T+QWFSLI+C      
Sbjct: 247 FTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFSLISCVIVVIG 306

Query: 298 XXXXXXHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRXXXXXXXXXXXX 357
                 HMLLRALK+D +RYNE NLD+EFHE+SGWKLSHGDVFR+P +            
Sbjct: 307 LSSVVLHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKSLLLSVLVGSGV 366

Query: 358 XXFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKVN 417
              L+    I+ AA+ F +  SR  LPT+ F+LYALFGFVGSY SM +Y+FFKGP  KVN
Sbjct: 367 QLLLLAVGGIVIAAIAFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKVN 426

Query: 418 LLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAH 477
           ++LTP L+PG I +TII LNFFL+   SS AIP   LF ++LLW + S+PLS AGSL A 
Sbjct: 427 MILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAI 486

Query: 478 KRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKIX 537
           K C  D HPTKTNQIARQIP QPWYLKT+P +L+AG+FPFASIAVELYFIY SLWF++  
Sbjct: 487 KTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQFF 546

Query: 538 XXXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILFT 597
                                    YHSLCLENW+WQWRSFI+GG G A+Y+FIHSI FT
Sbjct: 547 YMFGFSMVSLFLLVLTTALVTVMITYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFFT 606

Query: 598 KFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647
           +FKL GFTT+VLY+GYS LIS+LCC+ TG++GF SSMF +RKI+SSVKVD
Sbjct: 607 EFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656

>NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254
          Length = 663

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/660 (55%), Positives = 453/660 (68%), Gaps = 20/660 (3%)

Query: 5   SLLFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEH 64
           SLLF CL  S+V+AF LPG+ P TY   D+I LLVNHLTPSM+F H++E+G  +   K++
Sbjct: 7   SLLF-CL--SVVEAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKDISTAKKY 63

Query: 65  XXXXXXXXXXKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIP 124
                     KFHFC+P ++ +  +S+GS++FGDRI+NSPF+LNMLE K CVPLC S IP
Sbjct: 64  VVHSYDYYYEKFHFCQPVHIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVPLCESIIP 123

Query: 125 GEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTE------- 177
           G+DA+F+NKLIKNG+ QNW IDGLPA RE++D RT S+FYG GF+LG V++ +       
Sbjct: 124 GKDAEFINKLIKNGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLVEIRQTTGDKLL 183

Query: 178 ----------GFSDSNDEEKKIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVS 227
                        D+ +  + ++K +EVPY  NH+DI IEYH+RGN NYRVVG TV+PVS
Sbjct: 184 PDSVHDISDLAKRDAKNLVQNLIKEVEVPYFVNHFDIVIEYHERGNGNYRVVGATVNPVS 243

Query: 228 IKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFS 287
           I R S+  C     SLTL+E E+N VH TYSV F+ S T W TRWDKYLHVYDP IQWFS
Sbjct: 244 IARKSAGDCTPTGKSLTLNEEEDNNVHSTYSVTFVPSKTSWVTRWDKYLHVYDPKIQWFS 303

Query: 288 LINCXXXXXXXXXXXXHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRXX 347
           LIN             + LL+ALK+D +RYN  NLD++  E+SGWKL HG VFRIP    
Sbjct: 304 LINFSLIVILLSVILINSLLKALKSDFARYNNINLDDDVKEESGWKLVHGYVFRIPKNPM 363

Query: 348 XXXXXXXXXXXXFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYK 407
                       FL+I C++  AA+  LSP  RG+LPT M +LY LFGF+ SY SM +YK
Sbjct: 364 ILSILVGSGFQLFLVIVCTVFLAAIDILSPIYRGALPTAMIILYILFGFISSYVSMGVYK 423

Query: 408 FFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIP 467
           FFKGP WKVN+LLTP+LVPG I +T + LN FL+F  SS  +PA T+ T+ILLWF  SIP
Sbjct: 424 FFKGPYWKVNMLLTPILVPGLIIITFLALNLFLMFSESSSVVPAKTIMTLILLWFAVSIP 483

Query: 468 LSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFI 527
           LS AGSL+A K+C  D HPT TNQIA+ IP Q WYLKTIP SLI G+F F SI+V+LYFI
Sbjct: 484 LSVAGSLMAQKKCHWDEHPTVTNQIAKVIPPQKWYLKTIPASLIGGLFSFGSISVQLYFI 543

Query: 528 YTSLWFNKIXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRSFIIGGCGCAI 587
           YTSLWFN I                          YHSLC ENWKWQWR F IGG GC+I
Sbjct: 544 YTSLWFNNIFYMYGFLLFSICLFTMTITLVTILFTYHSLCQENWKWQWRGFFIGGLGCSI 603

Query: 588 YVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647
           YV +HS+ F + KLGGFT ++LY+GYS +++ L  +VTGS+GF+SSMFFI++I+SSVKVD
Sbjct: 604 YVLLHSLFFIELKLGGFTNILLYMGYSSVVTALIFLVTGSVGFLSSMFFIKRIFSSVKVD 663

>AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR083C (EMP70) and
           YDR107C
          Length = 653

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/645 (55%), Positives = 442/645 (68%), Gaps = 16/645 (2%)

Query: 15  LVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHXXXXXXXXXX 74
           L + FYLPG APTTY   D I LLVNH+TP++    +D  G   + DKE           
Sbjct: 13  LAQGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERYLYAYDYYYP 70

Query: 75  KFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKL 134
           + H C+P+ + +   SLGS+IFGDR+ NSPF+L MLEEK CV LC   +P EDAKF+N+L
Sbjct: 71  RLHMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQL 130

Query: 135 IKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEE-------- 186
           I++GF  NWL+DGLPAGRE+HD+RTN+ FYGTGF+LG   V  G  D N EE        
Sbjct: 131 IRSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG--RVIRGTEDRNQEEPGEIELQT 188

Query: 187 KKIMKTLE----VPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQYNSGS 242
           +++++  E    VPY  NH++I ++YH R  D  RVVGV+V P S++    D C  +   
Sbjct: 189 RRVLQPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGNG 248

Query: 243 LTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCXXXXXXXXXXX 302
           L LSET + +V FTYSV+F +SD  WATRW KYLHVYDP +QW+SLIN            
Sbjct: 249 LVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYSLINFSLVVLLLSSIM 308

Query: 303 XHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRXXXXXXXXXXXXXXFLM 362
            H L RALK DL RYN+FNLDNEF ED GWKL H DVFR P +              FLM
Sbjct: 309 VHSLFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQLFLM 368

Query: 363 IACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKVNLLLTP 422
            AC++  A LGFLSPSSRGSL T+MF+LYA+FG  GSY SM+ YK F G  WKVN++LTP
Sbjct: 369 SACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVNMVLTP 428

Query: 423 VLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHKRCRL 482
           +LVPG IF T++L+NFFLV V+SSGA+P GT+  I++LWFV SIP+S  GSL A K+   
Sbjct: 429 LLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARKKNTW 488

Query: 483 DNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKIXXXXXX 542
           D HPTKT+QIA+QIP QPWYL+T P + IAG+FPF +IAVELYFIYTS+WFN +      
Sbjct: 489 DQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWFNTMFYMFGF 548

Query: 543 XXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILFTKFKLG 602
                               Y+SLC+ENW WQWRSFIIGG GC+ YVFI+SILFTKF+LG
Sbjct: 549 LFFTFLLLTLTTALVTILLTYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILFTKFRLG 608

Query: 603 GFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647
           GF T+VLY+GYS LIS L C+VTG+IGF+SS++F+RKIYSS+KVD
Sbjct: 609 GFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653

>NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8.254
          Length = 619

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/619 (52%), Positives = 414/619 (66%), Gaps = 17/619 (2%)

Query: 46  MNFQHEDEDGNMVKGDKEHXXXXXXXXXXKFHFCKPENVVRQPASLGSVIFGDRIFNSPF 105
           M++ H++++G  +  D +           K HFCKPE+V +   S+GSV+FGDR++NSPF
Sbjct: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60

Query: 106 KLNMLEEKECVPLCSSRIPGEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYG 165
           +LNML+ K C  LC+S I G DAKF+NKLIKNG+ QNWLIDGLPA RE++D+RT SNFYG
Sbjct: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120

Query: 166 TGFQLGFVDV------------TEGFSDSNDEEKK-----IMKTLEVPYLANHYDINIEY 208
            GF+LG V++             + F D +  + K     +M+ +EVPY  NH+DI IEY
Sbjct: 121 NGFELGLVEIRQTTGEKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEY 180

Query: 209 HDRGNDNYRVVGVTVDPVSIKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVW 268
           HDRGNDNYRVVGVTV+PVSI RS    C+    +L+LSE+E N +HFTYSV+FI S+T W
Sbjct: 181 HDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSETAW 240

Query: 269 ATRWDKYLHVYDPTIQWFSLINCXXXXXXXXXXXXHMLLRALKNDLSRYNEFNLDNEFHE 328
            TRWDKYLHVYDPTIQW S++N               LL+ALK+D SRY E NLD    E
Sbjct: 241 VTRWDKYLHVYDPTIQWVSIVNFSIVVIILSCAVARSLLQALKSDFSRYGELNLDETIKE 300

Query: 329 DSGWKLSHGDVFRIPPRXXXXXXXXXXXXXXFLMIACSIIFAALGFLSPSSRGSLPTVMF 388
           D+ WKL HGDVFR P                FLMI C+I   A+G ++P SRG+LPTVMF
Sbjct: 301 DASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPTVMF 360

Query: 389 LLYALFGFVGSYTSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGA 448
           LLY  F F+ S+ SM +YKFF G  W +N +LTP LVPG + + II LN FL+FV SSG 
Sbjct: 361 LLYLGFSFISSFVSMGVYKFFNGQKWHINCILTPFLVPGLLLLVIIGLNIFLIFVHSSGV 420

Query: 449 IPAGTLFTIILLWFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPV 508
           IP  T  ++ILLWF   +PLS  GSL+A K C  D HPTKTN +++ IP Q WYL+TIP 
Sbjct: 421 IPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQTIPA 480

Query: 509 SLIAGVFPFASIAVELYFIYTSLWFNKIXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLCL 568
           SLI G+F F S++VELYF+YTSLWFNKI                          Y+SL  
Sbjct: 481 SLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAILFTLTVSLVTVLFTYYSLSA 540

Query: 569 ENWKWQWRSFIIGGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSI 628
           ENW+WQWRSF+I G GC+ YVF+HS+LFT+ KLGGFT  +LY+GYS +I+ L  +VTG++
Sbjct: 541 ENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVTGAL 600

Query: 629 GFISSMFFIRKIYSSVKVD 647
           GF+SSM F+R IYS+VKVD
Sbjct: 601 GFLSSMLFVRTIYSAVKVD 619

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/640 (45%), Positives = 394/640 (61%), Gaps = 46/640 (7%)

Query: 11  LLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQ---HEDEDGNMVKGDKEHXXX 67
           L   +   FY PGV+P TYH  DEI LLVN+L+    +    + D  G            
Sbjct: 9   LCAGVSYGFYFPGVSPVTYHIGDEIPLLVNYLSSDFLWNIDYYSDSIG------------ 56

Query: 68  XXXXXXXKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGED 127
                      CKP  +  Q  SLGSVIFGDR++NSPFK++ML+  ECV LC + I   D
Sbjct: 57  ----------LCKPNTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDTTI---D 103

Query: 128 AKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEK 187
               N      +  NWL+DGLP      D  +++N        G+ + +E F     +E+
Sbjct: 104 TALWNTFFGYRYSYNWLVDGLPVLGI--DGTSDAN--------GYHNNSELFMGYQADEQ 153

Query: 188 KIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQYNSGSLTLSE 247
           K        Y+ NH+DI I Y+DRG   YRVV     P+S+ R+ S+ C  ++  + +  
Sbjct: 154 K--------YIYNHFDIYIHYNDRGKGEYRVVFAEAKPISLPRTGSELCSKDAKPVPIGS 205

Query: 248 TEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCXXXXXXXXXXXXHMLL 307
                + FTYSV F KSD  W+TRWD+YLHVYD  IQ   LI+             H L 
Sbjct: 206 GNHENITFTYSVIFKKSDISWSTRWDQYLHVYDFDIQLAELISFSLVVLLLSSVLVHSLF 265

Query: 308 RALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRXXXXXXXXXXXXXXFLMIACSI 367
           R LK D++ Y+EFNLD+EF +D  WK+ HG+VFR P +              F M  C++
Sbjct: 266 RVLKRDIAAYSEFNLDDEFQQDYCWKIIHGEVFRSPSKALLLSVFVGSGSQLFFMALCTV 325

Query: 368 IFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKVNLLLTPVLVPG 427
           +  + GFLSPS+RGSL TVMF+LYALFG VGSYTSM+IYKFF G  WK+NL+LTP+L+P 
Sbjct: 326 LLGSCGFLSPSARGSLGTVMFVLYALFGGVGSYTSMSIYKFFGGQNWKLNLILTPLLIPV 385

Query: 428 GIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHKRCRLDNHPT 487
            +FVT +LLNFFL++ +SSGA+P GT+ TII+LWF+ S+P+S  GSL++ K  R D HP 
Sbjct: 386 FLFVTTVLLNFFLIYAKSSGAMPFGTMVTIIILWFILSVPVSIIGSLLSWKLNRWDEHPA 445

Query: 488 KTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKIXXXXXXXXXXX 547
           KTNQIARQ+P QPWY+KT   + +AG+FPF ++AVELY+IY S+W   I           
Sbjct: 446 KTNQIARQVPSQPWYIKTWVATFLAGMFPFGAMAVELYYIYASIWGEIIFFMYGFLFVAF 505

Query: 548 XXXXXXXXXXXXXXXYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILFTKFKLGGFTTV 607
                          Y+SLC+ENWKWQWRSFIIGG GC++YVF+HS+ F KFK  GF ++
Sbjct: 506 ILLTLTTSLVTILLTYYSLCMENWKWQWRSFIIGGVGCSVYVFLHSLFFIKFKFPGFVSM 565

Query: 608 VLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647
           VLYLGYS ++S++CC+VTGSIGF+++++F+RKIYS++KVD
Sbjct: 566 VLYLGYSAMVSIVCCLVTGSIGFLANLWFVRKIYSNIKVD 605

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa]
           {ON} Anc_7.411 YER113C
          Length = 670

 Score =  156 bits (395), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 164/617 (26%), Positives = 259/617 (41%), Gaps = 81/617 (13%)

Query: 78  FCKPENVVRQPA--SLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLI 135
           F  P  + ++P   SL  +I GDR + S + LN  E+ +C  LC+ +   E  K   +L+
Sbjct: 76  FTCPPTMHKKPLHLSLNEIIRGDRKWQSDYILNFGEDDQCHILCTRKTTKEGMKEAQELV 135

Query: 136 KNGFMQNWLIDG-LPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEKKIMKTLE 194
           KNG++  WLID  LPA      +  +  +Y +GF LGFVD   G            KT  
Sbjct: 136 KNGYVVQWLIDDELPAVTTFISTTDHKKYYASGFPLGFVDPETG------------KT-- 181

Query: 195 VPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIK--RSSSDSCQYNSGSLTLSETEENE 252
             YL  H  I I Y+    + + + G  + P S         S  Y    L + E +++ 
Sbjct: 182 --YLNTHVMIVIRYNTVDTNKHTIFGFELYPKSTVDFHCPGASKDYEQYELVVPENDDDL 239

Query: 253 --VHFTYSVKFIKSDTV-WATRWDKYLHVYD------PTIQWFSLINCXXXXXXXXXXXX 303
             + FTYSV + +   V W  RWD YL+  +          W SL N             
Sbjct: 240 TFIPFTYSVYWREEYLVDWEHRWDLYLNAGELSNDKSKQFHWISLANSFGIVFLISSITA 299

Query: 304 HMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPR-XXXXXXXXXXXXXXFLM 362
            +L R  K  +SR +  ++  E  ED       G ++ +  +               F+ 
Sbjct: 300 VILYRTFK--ISRRSFSDISKE--ED-----DKGSIYVVARKWLLNEQTPLANVLIIFVS 350

Query: 363 IACSIIFAALGFLSPSS--------RGSLPTVMFLLYALFGFVGSYTSMAIYKFFK---- 410
           +    +F  LG L  S         R S+ T+  L +    F+ S+T   + K  +    
Sbjct: 351 MGVQFLFTVLGSLIISCSLKKLHNVRDSVLTMGLLCFVTGAFMASFTGAHLLKSREEMCS 410

Query: 411 ------GPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVF 464
                    + V  LL   L+P  + +  +LLN  +    S+ A+P GT+  +I ++FV 
Sbjct: 411 ESQMKPTRYYPVFALLCGSLLPSFVMLVALLLNSIVWAHDSTHALPFGTVLFLISVYFVV 470

Query: 465 SIPLSFAGSLIAHKRCRLDNHPTKTNQIA---------RQIPIQPWYLKTIPVSLIA--- 512
            IPLS  G  IA K    ++ P+ +  I          + I + P  L   P+S +A   
Sbjct: 471 CIPLSLLGGYIAVKST--NSKPSFSFSIGNYSDRIFVYKTITMSPSVLINRPLSSLAILA 528

Query: 513 -GVFPFASIAVELYFIYTSLWFNKIXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENW 571
            G+FPF  I VEL ++Y SLW  K                              + L + 
Sbjct: 529 GGLFPFIIIYVELQYVYKSLWLEKTTFYYFYGFLLANILLLCIVICEISIIGTFILLNSA 588

Query: 572 -----KWQWRSFIIGGCGCAIYVFIHSILFTKFKLG--GFTTVVLYLGYSGLISVLCCIV 624
                 W+W SF IG   CA Y+ ++S+ +  F L   GF+++ + + Y  L +++C   
Sbjct: 589 DKNSNNWRWTSFQIGA-SCAFYMEVYSLYYVFFILNIRGFSSIFISVCYGTLFNIMCGCA 647

Query: 625 TGSIGFISSMFFIRKIY 641
           TGSI  ++S +F++KIY
Sbjct: 648 TGSIACLTSHWFVQKIY 664

>KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.411
           YER113C
          Length = 680

 Score =  150 bits (379), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 174/710 (24%), Positives = 296/710 (41%), Gaps = 110/710 (15%)

Query: 1   MLSHSLLFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKG 60
           +++  LLF+  L S V       + PT Y   D ++++VN +        E +   +  G
Sbjct: 10  VIASVLLFLRGLFSFVNTTNEGWLTPTIYRHGDPVEIIVNKI--------ESDATQLPYG 61

Query: 61  DKEHXXXXXXXXXXKFHFCKPENVVRQPA--SLGSVIFGDRIFNSPFKLNMLEEKECVPL 118
                            F  P  V ++P   SL  VI GDR + S ++L   ++ EC  L
Sbjct: 62  ------------YYDLPFTCPPTVDKKPLHLSLNEVIRGDRKWQSNYELEFGKDTECTVL 109

Query: 119 CSSRIPGEDAKFVNKLIKNGFMQNWLIDG-LPAGREIHDSRTNSNFYGTGFQLGFVDVTE 177
           C+ +   +  + ++K IK  ++  W ID  LPA      +     +YG+GF LGFVD   
Sbjct: 110 CARKTNPDGMRSLDKFIKQEYVVQWFIDKELPAATTFISTVDQKKYYGSGFPLGFVD--- 166

Query: 178 GFSDSNDEEKKIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKR-----SS 232
                 +E  K+       Y+ NH  + I YH   + N+ +VG  + P S+       +S
Sbjct: 167 ------EETGKV-------YVNNHVMMVIRYHAIDDYNFTIVGFEIYPKSVSDYHCPGAS 213

Query: 233 SDSCQYNSGSLTLSETEENEVHFTYSVKFIKS-DTVWATRWDKYLHVYDPT------IQW 285
            D  QY      ++  E+  + FTYSV + +  D  W  R++ +    + +        W
Sbjct: 214 KDYDQYEVVVPEIAN-EDTFIPFTYSVYWREEFDVEWKDRYNLFFDSGELSGSVSRKFHW 272

Query: 286 FSLINCXXXXXXXXXXXXHMLLR--ALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIP 343
            SL N              + ++   + N L    E    + F     W   + D   +P
Sbjct: 273 ISLANSASIAFLMTFIVSLIFIKITGIPNRLETKKESPKASIFVIARNW--FYDDRPVMP 330

Query: 344 PRXXXXXXXXXXXXXXFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSM 403
                           F +I    I  +L  L  + R S+ T+  L + L  F+ S+   
Sbjct: 331 --HLFICIVSMGVHFLFTVIGSLTISCSLNSLH-TIRNSVLTMALLFFVLGAFMASFVGG 387

Query: 404 AI------YKFFKGPLWKV--NLLLTPV----LVPGGIFVTIILLNFFLVFVRSSGAIPA 451
            +          +G L  V  N+LL  V    L+PG + +T I+LN  +    S+  +P 
Sbjct: 388 TLLIENNKLIMRRGSLKNVFSNILLFSVVCGSLLPGMVILTAIILNCIIWLHTSTNVLPF 447

Query: 452 GTLFTIILLWFVFSIPLSFAGSLIA-------HKRCRLDN----HPTKTNQI-------- 492
            T+  ++ ++F+  IPLS  G  IA       + R R D+      T+ N+I        
Sbjct: 448 ATIMKLLFIYFIVCIPLSVLGGSIAANKDSEEYSRLRSDSIKRISRTRANKIMDEDQGTD 507

Query: 493 ---ARQIPIQ-PWYLKTI------PVSLIA-GVFPFASIAVELYFIYTSLWFNKIXXXXX 541
               R++  +  W LK +       VSL+A G+FPF  I VEL F+Y S+W+ K      
Sbjct: 508 VRTTRKLKYKVRWQLKKMMLDTVTVVSLLASGIFPFIMIYVELQFVYKSVWYEKTTFYYY 567

Query: 542 XXXXXXXXXXXXXXXXXXXXXYHSLCL------ENWKWQWRSFIIGGCGCAIYVFIHSI- 594
                                   L +       +  W+W++F +    CA Y+  +SI 
Sbjct: 568 YGFLLANIILLCLVICDIAIICSYLMMTVSSKDNSDSWKWKTFQLSS-SCAWYMEAYSIY 626

Query: 595 -LFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSS 643
            +F    +  F+++++ + YS L + LC +  GSIG+++S++F++++Y S
Sbjct: 627 YVFKVLNMRDFSSILISVCYSLLFNALCGLAMGSIGYLASLWFVKRVYRS 676

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score =  148 bits (374), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 160/654 (24%), Positives = 263/654 (40%), Gaps = 86/654 (13%)

Query: 47  NFQHEDEDGNMVKGDKEHXXXXXXXXXXKFHFCKPENVVRQPA--SLGSVIFGDRIFNSP 104
           NF  + ++  ++    E              F  P  + ++P   SL  +I GDR + S 
Sbjct: 44  NFYFQGDEVELIVNKVESDLTQLPYAYYDLPFTCPPTMHKKPLHLSLNEIIRGDRKWQSD 103

Query: 105 FKLNMLEEKECVPLCSSRIPGEDAKFVNKLIKNGFMQNWLIDG-LPAGREIHDSRTNSNF 163
           + L   ++  C  LC+ +   E  K   KL+++G++  WLID  LPA      +     +
Sbjct: 104 YILKFGQDDTCHILCTRKTTKEGLKNAKKLVEDGYVVQWLIDEELPAATTFISTIDQKKY 163

Query: 164 YGTGFQLGFVDVTEGFSDSNDEEKKIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTV 223
           Y +GF LGFVD   G         K+       YL  H  + I Y+    + + +VG  V
Sbjct: 164 YASGFPLGFVDPDTG---------KV-------YLNTHVMLVIRYNTVDVNKHTIVGFEV 207

Query: 224 DPVSIK--RSSSDSCQYNSGSLTLSETEENE--VHFTYSVKFIKSDTV-WATRWDKYLHV 278
            P S+        S  Y    + + E +++   + FTYSV + +   V W  RWD YL+ 
Sbjct: 208 YPKSVSDFHCPGASKNYEPYEIVIPENDDDLTFIPFTYSVYWREEYLVDWDHRWDLYLNS 267

Query: 279 ----YDPTIQ--WFSLINCXXXXXXXXXXXXHMLLRALKNDLSRYNEFNLDNEFHEDSGW 332
                + T Q  W SL N              +LLR+ K+      + N   E      +
Sbjct: 268 GELSENKTTQFHWISLANSAGIVFLMSFVVSVILLRSFKSSRDISTDINKSEEHRNGLVY 327

Query: 333 KLSHGDVF--RIPPRXXXXXXXXXXXXXXFLMIACSIIFAALGFLSPSSR--------GS 382
           +++   +   R P                F+ +    +F  LG L+ S           S
Sbjct: 328 EVARNWIINERTP---------LANLLILFVSMGVQFLFTVLGSLTISCSLNKLHDIGDS 378

Query: 383 LPTVMFLLYALFGFVGSYTSMAIYKFF------KGPLWKVNLLLTPVL----VPGGIFVT 432
           + T+  L + L  F+ SY    + +        K P+ K   L   +L    +PG + + 
Sbjct: 379 VLTMAVLCFVLGAFMSSYIGSVLLRLKNKATMKKQPIKKGFHLFFAILCGSFLPGIVMIV 438

Query: 433 IILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHK-------------- 478
            +LLN  +    S+ A+P  T+   I ++F+  IPLS  G  +A+               
Sbjct: 439 TLLLNSIVWAHDSTHALPFKTVVMFITVYFIVCIPLSILGGYMANSSKTKGSLTDPKFHT 498

Query: 479 -RCRLDNHPTKTNQIARQIPIQPWYLKTIPVSL---IAGVFPFASIAVELYFIYTSLWFN 534
            R  L+    K     + I +    LK+I ++L   ++G+FPF  I VEL ++Y S+W  
Sbjct: 499 SRPELELFANKLKP-KKHIFLFGARLKSIKIALPILLSGIFPFVIIYVELQYVYKSVWLE 557

Query: 535 KIXXX-----XXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRSFIIGGCGCAIYV 589
           K                                 H     N  W+W SF +G   CA Y+
Sbjct: 558 KTAFYYFYGFLFANILLLCIVVGEIAIIGTYTMLHMADRNNTDWRWISFFMGS-SCAWYM 616

Query: 590 FIHSILFTKFKLG--GFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIY 641
            ++S+ +  F L   GF+++ + + Y  L + LC    GSI  ++S FF+ K+Y
Sbjct: 617 ELYSLYYVFFILNIRGFSSIFISVCYGALFNTLCGCAMGSIASLTSHFFVEKLY 670

>YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}
           TMN3Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn2p; member
           of Transmembrane Nine family with 9 transmembrane
           segments; localizes to Golgi; induced by
           8-methoxypsoralen plus UVA irradiation
          Length = 706

 Score =  142 bits (358), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 160/706 (22%), Positives = 277/706 (39%), Gaps = 119/706 (16%)

Query: 11  LLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHXXXXXX 70
           +++S  K  Y   + P  Y   D ++L+VN +                    E       
Sbjct: 39  VISSSQKNLYDGWITPNFYRKGDPLELIVNKV--------------------ESDLTQLP 78

Query: 71  XXXXKFHFCKPENVVRQPA--SLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDA 128
                  F  P  + ++P   SL  +I GDR + S +KL   E+  C  LC+ +   E  
Sbjct: 79  YAYYDLPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYKLKFGEDNPCETLCARKTTKEGM 138

Query: 129 KFVNKLIKNGFMQNWLIDG-LPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEK 187
           + ++KL++ G++  WLID  LPA      +  +  +Y +GF LGF+D         D +K
Sbjct: 139 QTLDKLVREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFID--------PDTDK 190

Query: 188 KIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIK--RSSSDSCQYNSGSLTL 245
                    YL NH  + I +H   ND   +VG  V P S+        S  Y    + +
Sbjct: 191 T--------YLHNHVMLVIRFHASDNDKNTIVGFEVYPRSVSDYHCPGASKNYEQYEIVI 242

Query: 246 SETEENEVH---FTYSVKFIKSDTV-WATRWDKYLHV----YDPTIQ--WFSLINCXXXX 295
            E +ENE+    FTYSV + +   V W  RWD +L+      + +IQ  W SL N     
Sbjct: 243 PE-DENELTYLPFTYSVYWREEFEVDWNHRWDYFLNAGELSDEQSIQFHWMSLANSVGIV 301

Query: 296 XXXXXXXXHMLLRALKNDLSRYNE---------FNLDNEFHEDSGWKLSHGDVFRIPPRX 346
                    + +R +  D S                +++  +D   K S   V +   + 
Sbjct: 302 LSISFITLIIYVRVMYTDKSNSKSPKYMINIEGIETEDDLDDDKYGKYSVYTVAKDWIQN 361

Query: 347 XXXXXXXXXXXXXFLMIACSIIFAALGFLSPSS--------RGSLPTVMFLLYALFGFVG 398
                         +      +F  +G L+ S         R S+ T+  L + L  F+ 
Sbjct: 362 GRPNLFGLKVLILLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLTMAILFFVLGAFMA 421

Query: 399 SYTSMAIYKFFKGPLWKVNLL-----------LTPVL-------VPGGIFVTIILLNFFL 440
           S+    +    K    K N L            +P+        +PG + V+  LLN  +
Sbjct: 422 SFVGTRLSMVTKTKRTKANYLDDNRYLKDYKKFSPIFTILCGSSLPGIVMVSTFLLNSIV 481

Query: 441 VFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHKRCRLDNHP-----------TKT 489
               S+ A+P  T+   + ++F+  IPLS  G ++A      +N P            ++
Sbjct: 482 WAHDSTSALPFKTIVFFMSIYFIVCIPLSLFGGIVA------NNIPLPQYWLSGITKDES 535

Query: 490 NQIARQIPIQPWYLKTIPVS----LIAGVFPFASIAVELYFIYTSLWFNKIXXXX----X 541
           N     + +     K  P+      + G+FP   I VE+ ++Y SLW  K          
Sbjct: 536 NSDGNGLFVPKSRAKFNPLVYCGIYLCGIFPLLVIYVEMQYVYKSLWLEKTTFYYFYGFL 595

Query: 542 XXXXXXXXXXXXXXXXXXXXXYHSLCLENW----KWQWRSFIIGGCGCAIYVFIHSI--L 595
                                    C E+      W+W+ F +G  G  +Y+ ++S+  +
Sbjct: 596 FLSIILLCVLTMEISIIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYMELYSLYYI 654

Query: 596 FTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIY 641
           F    + GF+++++ + YS + +V+C +  G++ ++++ +FI KIY
Sbjct: 655 FAVLNIHGFSSILISICYSLIFNVMCSLGLGALSYLTASWFINKIY 700

>Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C
           (REAL)
          Length = 707

 Score =  138 bits (347), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 159/694 (22%), Positives = 272/694 (39%), Gaps = 111/694 (15%)

Query: 19  FYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHXXXXXXXXXXKFHF 78
           +Y   + P  Y  ND ++L+VN +                    E              F
Sbjct: 48  YYDGWITPNFYKKNDFLELIVNKV--------------------ESDLTQLPYAYYDLPF 87

Query: 79  CKPENVVRQPA--SLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLIK 136
             P  + ++P   SL  +I GDR + S +KL   E+  C  LC+ +   +  + ++KL++
Sbjct: 88  TCPPTMHKKPLHLSLNEIIRGDRKWESDYKLRFGEDNACETLCARKTDKKGMQTLDKLVR 147

Query: 137 NGFMQNWLIDG-LPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEKKIMKTLEV 195
            G++  WLID  LPA      +  +  +Y +GF LGFVD         D +K        
Sbjct: 148 EGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFVD--------PDTDKT------- 192

Query: 196 PYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIK--RSSSDSCQYNSGSLTLSETEENEV 253
            YL NH  + I +H  G+D   VVG  V P S+        S  Y    + + E E +  
Sbjct: 193 -YLHNHVILVIRFHGGGDDKNTVVGFEVYPKSVSDYHCPGASKNYEQYEIVVPEDEHDLT 251

Query: 254 H--FTYSVKFIKSDTV-WATRWDKYLHVYD------PTIQWFSLINCXXXXXXXXXXXXH 304
           +  FTYSV + +   V W  RW+ +L+  +          W SL N              
Sbjct: 252 YLPFTYSVYWREEFEVDWNHRWNYFLNAGELSDEQSAQFHWMSLANSLGIVLSISFITFV 311

Query: 305 MLLRALKNDLSRYNE----FNLDNEFHEDS--GWKLSHGDVFRIPPRXXXXXXXXXXXXX 358
           + +R ++ D    +      N +    EDS    K     V+ +                
Sbjct: 312 IYIRVMRTDKKNTDSHKYLINTEGIEAEDSLDDDKYGKNSVYMVTKDWIQNGKPDLFGLK 371

Query: 359 XFLMI---ACSIIFAALGFLSPSS--------RGSLPTVMFLLYALFGFVGSYTSMAIYK 407
             +++       +F  +G L+ S         R S+ T+  L + L  F+ S+    +  
Sbjct: 372 VLIVLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLTMAILCFVLGAFMASFVGTRLGI 431

Query: 408 FFKGPLWKVNLL-----------LTPVL-------VPGGIFVTIILLNFFLVFVRSSGAI 449
             K     VN L            +P+        +PG + +   LLN  +    S+ A+
Sbjct: 432 VTKRRNINVNYLDHNKSFKNCREFSPIFAVICGSSLPGMVMIGTFLLNSVVGAHDSTNAL 491

Query: 450 PAGTLFTIILLWFVFSIPLSFAGSLIAHK------------RCRLDNHPTKTNQIARQIP 497
           P  T+   I ++FV  IPLS  G ++A+             +   D + +K  +   +  
Sbjct: 492 PFRTIVFFISIYFVVCIPLSLFGGIVANNIPLPKYWLSGITKDETDGNGSKLFKPKSRTR 551

Query: 498 IQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKIXXXXXXXXXXXXXXXXXXXXX 557
             P  L    V L  G+FP   I VE+ ++Y SLW  K                      
Sbjct: 552 FNP--LVHCGVYL-CGIFPLLVIYVEMQYVYKSLWLEKTTFYFFYGFLFLSIILLCVLTM 608

Query: 558 XXXXXYHSL----CLENWK----WQWRSFIIGGCGCAIYVFIHSI--LFTKFKLGGFTTV 607
                   L    C ++ +    W+WR F +G  G  +Y+ ++S+  +F    + GF+++
Sbjct: 609 EISIIGSYLLMRFCFDDKEVRNNWRWRCFEMGFSG-GVYMELYSLYYIFVVLNIHGFSSI 667

Query: 608 VLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIY 641
           ++ + YS L ++LC +  G++  +++ +FI +IY
Sbjct: 668 LISICYSLLFNILCGLGLGALSCLTASWFINRIY 701

>ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 658

 Score =  137 bits (345), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 147/611 (24%), Positives = 252/611 (41%), Gaps = 77/611 (12%)

Query: 78  FCKPENVVRQPA--SLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLI 135
           F  P    ++P   SL  +I GDR + S +KL + ++  C  LC+ +   E  +    LI
Sbjct: 75  FTCPPTPEKKPLHLSLNEIIKGDRKWESDYKLVVGQDNPCEILCARKTTREGLQTAKDLI 134

Query: 136 KNGFMQNWLI-DGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEKKIMKTLE 194
           K+G+M  W+I D LPA      +  N  +Y  GF LG VD             ++     
Sbjct: 135 KSGYMVQWMIDDDLPAATTYISTTDNLKYYAPGFPLGSVD---------PRSSRV----- 180

Query: 195 VPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQYNSGSLTLSETEENEVH 254
             +  NH  + I Y+   +D   +VG    P S+          +     +++    E+ 
Sbjct: 181 --FFNNHVMLVIRYNLVDSDKVTIVGFEAYPKSVSDYHCPGASKDFKPFEITDPPLEEIV 238

Query: 255 F---TYSVKFIKSDTV-WATRWDKYLHVYD------PTIQWFSLINCXXXXXXXXXXXXH 304
           +   TYSV + +   + W+ RW  Y++          T  W +L N              
Sbjct: 239 YIPVTYSVYWREDAEIDWSDRWSLYINRAQLADSSSSTFHWMALANSVGIVLFVTFIVIV 298

Query: 305 MLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRXXXXXXXXXXXXXXFLM-I 363
            L+   +N     NE  L+++ +EDS       D+F +                   + +
Sbjct: 299 NLIMIFRNP----NE-QLESKENEDS------SDIFNVANNWLRARQGFQLNRLIVCVSM 347

Query: 364 ACSIIFAALGFLSPS--------SRGSLPTVMFLLYA----LFGFVGSYTSM----AIYK 407
              ++F  LG L+ S         + S+ T+  L +     +  FVG++  M    + Y 
Sbjct: 348 GIQVMFMILGPLAISLSLTRLHNIKNSVLTIAALCFVAGAFMASFVGTWLKMDQNISAYT 407

Query: 408 FFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIP 467
           F+  P++ V   L    +PG I V  + LN  +    S+ A+P GT+   +  +FV  I 
Sbjct: 408 FYN-PVFAV---LCGSALPGSIMVLTLSLNCIIWIWDSTKALPFGTMVVFVSWYFVVCIV 463

Query: 468 LSFAGSLIA---HKRCRLDNHPTKT---NQIARQIPIQPWYLKTIPVSLIAGVFPFASIA 521
           +S  G  +A   H+  R D  P  T    ++ R+       L      LI+G  PF  I 
Sbjct: 464 VSLLGGAVAAQMHRSVRHDAPPATTASDRKVLRRSRAISGKLVVFLAGLISGFLPFVIIY 523

Query: 522 VELYFIYTSLWFNKIXXX-------XXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQ 574
           VEL ++Y S+W  K                                   +   + +  W+
Sbjct: 524 VELEYLYKSVWLEKTTLYYLYSFLFANVLLLCIVVCEISLLGCLVLMKLNHKFINDQNWR 583

Query: 575 WRSFIIGGCGCAIYVFIHSILFTKF--KLGGFTTVVLYLGYSGLISVLCCIVTGSIGFIS 632
           WR F+I   GC+ Y+ I+S+ +  F   + G + V + + YS + +VLC + TGS+G+++
Sbjct: 584 WRCFVI-STGCSWYMEIYSLYYIFFIIHMTGDSAVFISVCYSFIFNVLCGLATGSLGYLT 642

Query: 633 SMFFIRKIYSS 643
           S +F++KI+ +
Sbjct: 643 SSWFVKKIHRT 653

>Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  136 bits (343), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 154/641 (24%), Positives = 263/641 (41%), Gaps = 92/641 (14%)

Query: 78  FCKPENVVRQPA--SLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLI 135
           F  P  + + P   SL  +I GDR + S +KL   E+  C  LC+ +   E  + ++KLI
Sbjct: 86  FTCPPTMHKTPLHLSLNEIIRGDRKWESDYKLTFGEDNPCEVLCARKTTKEGMQTLDKLI 145

Query: 136 KNGFMQNWLIDG-LPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEKKIMKTLE 194
           + G++  WLID  LPA      +  +  +Y +GF LGF+D   G            KT  
Sbjct: 146 REGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFMDPDTG------------KT-- 191

Query: 195 VPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIK--RSSSDSCQYNSGSLTLSETEENE 252
             YL NH  + I +H   N    +VG  V P S+        S  Y    +T+ E +ENE
Sbjct: 192 --YLHNHVMLVIRFHSGDNGKNTIVGFEVYPRSVSDYHCPGASKTYEQYEITIPE-DENE 248

Query: 253 VH---FTYSVKFIKSDTV-WATRWDKYLHVYD------PTIQWFSLINCXXXXXXXXXXX 302
           +    FTYSV + +   V W  RWD +L+  +          W S  N            
Sbjct: 249 LTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSDEQSSQFHWMSFANSVIIVLSISLIT 308

Query: 303 XHMLLRALKNDLS--RYNEF--NLDNEFHED--SGWKLSHGDVFRIPPRXXXXXXXXXXX 356
             + +  +  D +    N+F  N++    ED  +  K S   V+ +              
Sbjct: 309 LIIYIGVMHTDKNNPHSNKFMINIEGIGAEDVLNNDKYSKNSVYMVAKDWIQNGKPDLFS 368

Query: 357 XXXFLMI---ACSIIFAALGFLSPSS--------RGSLPTVMFLLYALFGFVGSYTSMAI 405
               +++       +F  +G L+ S         R S+ T+  L + +  F+ S+    +
Sbjct: 369 LKGLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVLTMAILCFVIGAFMASFVGTRL 428

Query: 406 YKFFKGPLWKVNLL-----------LTPVL-------VPGGIFVTIILLNFFLVFVRSSG 447
               K   +  N              +P+        +PG I ++  LLN  +    S+ 
Sbjct: 429 SIVSKTRRFNANYFGDNKNFKCREKFSPIFAIICGSSLPGMIMISTFLLNSIVWAHDSTN 488

Query: 448 AIPAGTLFTIILLWFVFSIPLSFAGSLIAHK---------RCRLDNHPTKTNQIARQIPI 498
           A+P  T+   I ++F+  IPLS  G ++A+             +D   +K N++   +P 
Sbjct: 489 ALPFKTIVFFISVYFIVCIPLSLFGGIVANNIPLPQYWLSGITIDESDSKNNKLF--LPK 546

Query: 499 QPWYLKTIPVSLI--AGVFPFASIAVELYFIYTSLWFNKIXXXX----XXXXXXXXXXXX 552
            P     +    I   GVFP   I VE+ ++Y SLW  K                     
Sbjct: 547 SPNKFNPLVNCGIYLCGVFPLLVIYVEMQYVYKSLWLEKTTFYYFYGFLFLSIILLCVLT 606

Query: 553 XXXXXXXXXXYHSLCLENW----KWQWRSFIIGGCGCAIYVFIHSI--LFTKFKLGGFTT 606
                         C E+      W+W+ F +G  G  +Y+ ++S+  +F    + GF++
Sbjct: 607 MEISVIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYMELYSLYYIFAVLNIHGFSS 665

Query: 607 VVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647
           +++ + YS L +++C +  G++ ++++ +FI KIY  VKV+
Sbjct: 666 ILISICYSLLFNIMCGLGLGALSYLTASWFINKIY-HVKVN 705

>TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {ON}
           Anc_7.411 YER113C
          Length = 678

 Score =  132 bits (331), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 157/676 (23%), Positives = 271/676 (40%), Gaps = 99/676 (14%)

Query: 24  VAPTTYHSNDEIQLLVNHLTPSM-NFQHEDEDGNMVKGDKEHXXXXXXXXXXKFHFCKPE 82
           + P  Y   D ++LLVN +   +  F +   D                       F  P 
Sbjct: 41  LQPNVYRWGDHVELLVNKVESDLTQFPYGYYD---------------------LPFTCPP 79

Query: 83  NVVRQPA--SLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLIKNGFM 140
              ++P   SL  +I GDR + S +KL   ++  C  LC+ +      +   +L++ G++
Sbjct: 80  TEDKKPLHLSLNEIIRGDRKWESDYKLKFGQDASCEALCARKTKPAGMRRAQELVRQGYV 139

Query: 141 QNWLIDG-LPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEKKIMKTLEVPYLA 199
             WLID  LPA      +  +  +Y +GF LGFVD         D EK         YL 
Sbjct: 140 VQWLIDQELPAATTFISTIDHKKYYVSGFPLGFVD--------PDTEKT--------YLN 183

Query: 200 NHYDINIEYHDRGNDNYRVVGVTVDPVSIK--RSSSDSCQYNSGSLTLSETEENEVH--F 255
            H  + I Y+    + + +VG  V P S+        S  Y    L + E E+   +  F
Sbjct: 184 THVMMVIRYNAIDPETFTIVGFEVYPKSVSDYHCPGASKGYEQYELIVPENEDELTYIPF 243

Query: 256 TYSVKFIKSDTV-WATRWDKYLHVYDPT------IQWFSLINCXXXXXXXXXXXXHMLLR 308
           TYSV + +   V W+ RW+ +L+  + +        W +L N               L R
Sbjct: 244 TYSVYWREEFKVDWSHRWNFFLNSGEMSEASSRRFHWMTLGNSVGISFLLMLIVIANLYR 303

Query: 309 ALK---NDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRXXXXXXXXXXXXXXFLMIAC 365
            ++      S   +F  D     DS + ++   + +                  F+ I  
Sbjct: 304 IVRVGHEAGSEEFQFTFDENEEADSIYGVAKTWLAQTDS-----SSISFKILTIFVSIGV 358

Query: 366 SIIFAALGFLSPSS--------RGSLPTVM-FLL----YALFGFVGSYTSMAIYKFFKGP 412
             +F  +G L+ S         R S+ +V  F L    Y    FVG++  +       G 
Sbjct: 359 QFLFTIIGSLAFSCSLNKLHNIRNSVLSVASFFLCHWSYLWHLFVGTWLHIDHRTTNDGS 418

Query: 413 LWKVNL--LLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSF 470
             +     +L    +PG + ++  +LN+ +    SS A+P  T+   + ++FV  IPLS 
Sbjct: 419 AGRCRTFSILCGSALPGLVMISTQMLNWIVWANESSHALPFRTIVLFVSIYFVICIPLSL 478

Query: 471 AGSLIAHK--RCRLDNHPTKTNQIARQI-PIQ-PWYLKTIPVS----------LIAGVFP 516
            G  ++H+  R +  N P  ++  AR I P + P  L    +S           I G  P
Sbjct: 479 LGEEVSHRVHRKQAQNFPILSSLGARSIKPCRAPTTLAPRKISERLTFDFATFAICGFLP 538

Query: 517 FASIAVELYFIYTSLWFNKIXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWK---- 572
           FA I VEL +IY S+W  K                              + +   K    
Sbjct: 539 FAVIYVELQYIYKSVWLEKTDFYYLYGFLLANIILLCIVVCEVSFLGCYVMMRKHKRVAT 598

Query: 573 ---WQWRSFIIGGCGCAIYVFIHSI--LFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGS 627
              W+W+ F++ G  CA Y+ ++S+  +F   K+ GF ++ + + YS + +++C    GS
Sbjct: 599 FDSWRWKCFMM-GTSCAWYMELYSLYYIFHTLKMTGFPSIFISVSYSLIFNIMCGCGMGS 657

Query: 628 IGFISSMFFIRKIYSS 643
           +G+++S + + +++ +
Sbjct: 658 LGYLTSCWLVNRVFCT 673

>Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  130 bits (328), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 161/695 (23%), Positives = 266/695 (38%), Gaps = 107/695 (15%)

Query: 18  AFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHXXXXXXXXXXKFH 77
            +Y   + P  Y   D ++L+VN +                    E              
Sbjct: 46  TYYDGWITPNFYKKGDPLELIVNKV--------------------ESDLTQLPYAYYDLP 85

Query: 78  FCKPENVVRQPA--SLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLI 135
           F  P  + ++P   SL  +I GDR + S + L   E+  C  LC+ +   E  + ++KL+
Sbjct: 86  FTCPPTMHKKPLHLSLNEIIRGDRKWESDYILAFGEDNACQTLCARKTTKEGMQSLDKLV 145

Query: 136 KNGFMQNWLIDG-LPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEKKIMKTLE 194
           + G++  WLID  LPA      +  +  +Y +GF LGFVD   G            KT  
Sbjct: 146 REGYVVQWLIDDKLPAATTFISTTDHKKYYASGFPLGFVDPDTG------------KT-- 191

Query: 195 VPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIK--RSSSDSCQYNSGSLTLSETEENE 252
             YL NH  + I +H   ND   +VG  V P S+        S  Y    + + E +ENE
Sbjct: 192 --YLHNHVMLVIRFHSGDNDQNTIVGFEVYPRSVSDYHCPGASKNYEQYEIVVPE-DENE 248

Query: 253 VH---FTYSVKFIKSDTV-WATRWDKYLHVYD------PTIQWFSLINCX----XXXXXX 298
           +    FTYSV + +   V W  RWD +L+  +          W S  N            
Sbjct: 249 LTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSNEKSAQFHWMSFANSMGIVLSISFIT 308

Query: 299 XXXXXHMLLRALKNDLSRYNEFNLDNEFHEDS--GWKLSHGDVFRIPPRXXXXXXXXXXX 356
                 ++ R  KN  S     N++    ED+    K     V+ +              
Sbjct: 309 AVIYIQVMHRDKKNTDSTKYLINIEGAEVEDNLDDDKYGKNSVYMVTKDWIQNGRPNMFG 368

Query: 357 XXXFLMI---ACSIIFAALGFLSPSS--------RGSLPTVMFLLYALFGFVGSYTSMAI 405
               +++       +F  +G L+ S         R S+ T+  L + L  F+ S+    +
Sbjct: 369 LKVLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVITMAILCFVLGAFMASFVGTRL 428

Query: 406 YKFFKGPLWKVNLL-----------LTPVL-------VPGGIFVTIILLNFFLVFVRSSG 447
               K    ++N L            +PV        +PG + V+  LLN  +    S+ 
Sbjct: 429 SIVTKRRSIEINYLDDSKNFNNCNKFSPVFAIICGSSLPGLVMVSTFLLNSIVWAHDSTN 488

Query: 448 AIPAGTLFTIILLWFVFSIPLSFAGSLIA-------HKRCRLDNHPTKTNQIARQIPIQP 500
           A+P  T+   I ++F+  IPLS  G  +A       H    +    T  N     +P   
Sbjct: 489 ALPFRTIVFFISVYFIVCIPLSLFGGTVANNIPLPRHWLSGITKDETCGNSSRLFVPRSR 548

Query: 501 WYLKTIPVSLI--AGVFPFASIAVELYFIYTSLWFNKIXXXX----XXXXXXXXXXXXXX 554
                +    I   G+FPF  I VEL ++Y S+W  K                       
Sbjct: 549 TKFNPLVYCGIYLCGLFPFLVIYVELQYVYKSVWLEKTTFYYFYGFLLLNIILLCVLTME 608

Query: 555 XXXXXXXXYHSLCLENW----KWQWRSFIIGGCGCAIYVFIHSI--LFTKFKLGGFTTVV 608
                       C E+      W+W+ F +G  G  +Y+ ++S+  +F    + GF++ +
Sbjct: 609 ISIIGSYSLMRFCFEDKDVRNNWRWKCFEMGFSG-GVYMELYSLYYIFAVLNIHGFSSTL 667

Query: 609 LYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSS 643
           + + YS L +++C +  G + ++++ +FI KIY S
Sbjct: 668 ISICYSLLFNIMCGLGLGGLSYLTASWFINKIYHS 702

>KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {ON}
           Anc_7.411 YER113C
          Length = 664

 Score =  127 bits (319), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 158/656 (24%), Positives = 268/656 (40%), Gaps = 86/656 (13%)

Query: 39  VNHLTPSMNFQHEDEDGNMVKGDKEHXXXXXXXXXXKFHFCKPENVVRQP--ASLGSVIF 96
            N LTP  N   + +D  ++    E              F  P    R+P   SL  ++ 
Sbjct: 34  ANRLTP--NIYRKGDDVELIVNKIESDLTKLPYGYYDLPFICPPTNQRKPLHMSLTEILR 91

Query: 97  GDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLIKNGFMQNWLIDG-LPAGREIH 155
           GDR + S + L   ++ +C  LC+ +   E  +    L+K  ++  W ID  LPA     
Sbjct: 92  GDRKWQSDYSLTFGKDNDCAVLCARKTTPEGIQKAINLVKKDYIVQWSIDNDLPASTTFI 151

Query: 156 DSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEKKIMKTLEVPYLANHYDINIEYHDRGNDN 215
            +  N  +Y  GF LGFVD                   E  YL NH  + I YH   +++
Sbjct: 152 STSENRKYYIPGFSLGFVD----------------PDTETAYLNNHVMLVIRYHAIDDEH 195

Query: 216 YRVVGVTVDPVSIKRSSSDSCQYNSGSLTLSETEENEVH---FTYSVKFIKS-DTVWATR 271
           + +VG+ V P S+          N     L   ++ EV    FTYSV + +  D  W  R
Sbjct: 196 FTIVGLEVYPKSVSDYHCPGASRNYEQFELVANDDEEVTYIPFTYSVYWREEFDVEWKDR 255

Query: 272 WDKYLHVYDPT------IQWFSLINCXXXXXXXXXXXXHMLLRALKNDLSRYNEFNLDNE 325
           +  + +  + +       +W  L N              + LR     +S+ N+      
Sbjct: 256 YSFFSNSGELSKEITDKFRWILLANSSGLALFISMIVSVIFLR-----ISKKNK------ 304

Query: 326 FHEDSGWKLSHGDVFRIPPRXXXXXXXXXXXXXXFLMIACSIIFA--ALGFLSPSS---- 379
            +E+S  +   G +  +  R               ++++  + FA   LG L+ S     
Sbjct: 305 -NENSAIESKKGSM-DVIARKWLRNDRTIHFNFLIVLVSFGVHFAFTLLGSLAISCSLQK 362

Query: 380 ----RGSLPTVMFLLYALFGFVGSY--TSMAIYK---FFKGPLWKVN-----LLLTPVLV 425
               R S+ T++ L + L GF+ S+  T + + K    +KG L +++      +    L+
Sbjct: 363 FDNIRNSVLTLVLLFFVLGGFMASFVGTCLIMQKNKTMYKGSLKRLHYSPLFAMCCGSLL 422

Query: 426 PGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHKRCRLDNH 485
           P  I +  I LN  +    SS A+P  T+  +I ++F+  IPLS  G   A   C+    
Sbjct: 423 PAVIMIITIFLNNIVWAHGSSRALPLKTILFLISIYFIVCIPLSLLGGSYASDICQKRTL 482

Query: 486 PTKTNQIARQIPIQPWYL-KTIP----------VSLIAGVFPFASIAVELYFIYTSLWFN 534
              ++   +++ +    L +TI           ++ I G+FPF  I VEL  +Y  +W  
Sbjct: 483 RAFSSPAQQKLAVTNSNLARTIKSIFDDPFSGLLASIGGLFPFFIIYVELQHVYKFVWLE 542

Query: 535 K-----IXXXXXXXXXXXXXXXXXXXXXXXXXXYHS--LCLENWKWQWRSFIIGGCGCAI 587
           K     +                           HS    LEN  W+WRSF I    CA 
Sbjct: 543 KASFYYLRWFLFANIIILCIVVVEIAIISAYIMMHSSRSSLEN-SWRWRSFQISS-SCAW 600

Query: 588 YVFIHSILFTKFKLG--GFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIY 641
           Y+ ++S+ +  + L   GF++++L +  S L + LC    GSIG++++ +F+ ++Y
Sbjct: 601 YMELYSLYYIFYVLNTTGFSSILLSVCSSALFNGLCGCALGSIGYLATCWFVGRVY 656

>KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 676

 Score =  127 bits (318), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 141/617 (22%), Positives = 243/617 (39%), Gaps = 88/617 (14%)

Query: 76  FHF-CKPENVVRQ-PASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNK 133
            HF C P   ++  P +   +++G++ + S ++L   ++++CV LC  +  GE  K   +
Sbjct: 89  LHFTCPPSQDMKPLPLTFSDILYGNKKWQSDYQLTFGKDEDCVRLCDRKTNGEGKKQAYE 148

Query: 134 LIKNGFMQNWLI-DGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEKKIMKT 192
           LIK  ++  WL  D LP      +++    +Y +GF LG  D         DE       
Sbjct: 149 LIKQNYVVQWLADDDLPGATTYLNTKDKKKYYSSGFPLGQYD------PETDE------- 195

Query: 193 LEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQYNSGSLTLSETEENE 252
               Y+ NH  I I YH        +VG  V P S+          +     +  T E+ 
Sbjct: 196 ---AYINNHVMIVIRYHTIDQGKNTIVGFEVYPKSVSDHHCPGASKDYTPYKIDPTNEDI 252

Query: 253 --VHFTYSVKFIKSDTV-WATRWDKYLH------VYDPTIQWFSLINCXXXXXXXXXXXX 303
             + FTY+V + +   V W  RW+ +++             W +  N             
Sbjct: 253 EFISFTYAVYWREDFKVDWKNRWNFFINGGELKESTSNQFHWITFANGIIVTSCLLLIVI 312

Query: 304 HMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRXXXXXXXXXXXXXXFLMI 363
            +L R  + D S   +   +        W  +     R+P                F  +
Sbjct: 313 AILKRQ-ETDGSITTQLAAE--------WSKA-----RVPLFFQLNLLVSMGIHFLFTTL 358

Query: 364 ACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWK---VNLLL 420
              II  +L          L   +FL  +     GS+TS  I    +G + +   VN ++
Sbjct: 359 GTLIISCSLNHTHRIGSSVLTCAVFLFIS-----GSFTSSFIGALLEGQMSQHKLVNSII 413

Query: 421 TPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHKRC 480
               +PG   V ++LLN+ L    ++  +P GT+  +   +F+  +P+S  G   A +  
Sbjct: 414 FGSTLPGITLVIVLLLNYILKANNAANTLPHGTVALLFGAYFIVCVPISIIGGKCADRFL 473

Query: 481 RLDNHPTKTNQIA----RQIPIQPWYLKT-----------IPVSLIAGVFPFASIAVELY 525
           ++++  T  N  A     +   +P Y+++           I ++L  G+ PFA I VEL 
Sbjct: 474 KVNSTNTLLNSFALAEVNKHDTRPLYVESKNSIPFVLKNPIAITLTFGLIPFALIYVELL 533

Query: 526 FIYTSLWFNKIXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLCLE------NWKW------ 573
           F Y SLW  K                              + L       N+KW      
Sbjct: 534 FAYKSLWLQKTTLYYLYGFLLSNIVIVCICICLLSIIGCYIHLNYGNDSLNFKWDNVIGR 593

Query: 574 --------QWRSFIIGGCGCAIYVFIHSILFTKF--KLGGFTTVVLYLGYSGLISVLCCI 623
                   +W++F +GG   A Y+  +SIL+  F  +   F +  L++ YS L ++LC  
Sbjct: 594 VLEACHSWRWKAFHMGG-AVAWYMEAYSILYLIFVARYRDFISSFLFVCYSTLFNILCWT 652

Query: 624 VTGSIGFISSMFFIRKI 640
             GS+ ++SS++FI K+
Sbjct: 653 AFGSLSYLSSLWFIGKL 669

>SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 707

 Score =  126 bits (317), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 157/715 (21%), Positives = 282/715 (39%), Gaps = 158/715 (22%)

Query: 24  VAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHXXXXXXXXXXKFHFCKPEN 83
           + P  Y  ND ++++VN +                    E           +  F  P  
Sbjct: 56  IRPNVYEENDPVEIIVNKI--------------------ESDLTQFPYAYYELPFTCPPT 95

Query: 84  VVRQPA--SLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLIKNGFMQ 141
            V++P   SL  +I GDR + S + L+  +++ C+ LC  +   +  +  ++LIK G++ 
Sbjct: 96  NVKKPLHLSLNEIIRGDRKWQSDYLLHFKKDEHCLRLCDRKTSPDALRKAHELIKQGYVV 155

Query: 142 NWLIDG-LPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEKKIMKTLEVPYLAN 200
            WLID  LPA      ++ +  +Y +GF LGF+D   G            KT    YL N
Sbjct: 156 QWLIDDELPAATTFISTKDHKKYYASGFPLGFMDKDTG------------KT----YLNN 199

Query: 201 HYDINIEYHDRGNDNYRVVGVTVDPVSIK--RSSSDSCQYNSGSLTLSETEENEVHFTYS 258
           H  + I YH    + + +VG+ V P S+        S  ++   +   ETE   + FTYS
Sbjct: 200 HVMLVIRYHTVDINKFTIVGLEVYPKSVSDYHCPGASKNFDHYEVNTEETETTYIPFTYS 259

Query: 259 VKFIKSDTV-WATRWDKYLHVYD------PTIQWFSLINCXXXXXXXXXXXXHMLLRALK 311
           + + +   V W  RW+ +++  +          W SL N              +L +++ 
Sbjct: 260 IYWREEFNVDWTNRWNFFINSGEISQEKSSQFHWISLANSVVIVTLMTLVVALILAKSVS 319

Query: 312 NDLS-RYNEFNLDNEFHEDSGWKLSHGDVFRIPPRXXXXXXXXXXXXXXFLMIACSIIFA 370
            D +   +   + +++     + L+H +VF                   F ++   II  
Sbjct: 320 TDETVSTSTSQVASQWVVQHSYLLNHLNVF-----------TAMGVQFLFTILGSLIISC 368

Query: 371 ALGFLSPSSRGSLPTVMFLLYALFGFV-GSYTSMAIYKFFKGPLWKVNLLLTPVL----- 424
           ++  L  + R S+ T+     AL  F+ G+YTS      F G L   N   T  +     
Sbjct: 369 SMNKLH-NIRNSVLTM-----ALMCFISGAYTSS-----FVGALLSANHNTTIKISIACG 417

Query: 425 --VPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIA---HKR 479
             +PG     +++LN  +    S+ A+P GT+  +I ++F+  IPLS  G + A    ++
Sbjct: 418 SALPGFTLCVVLILNCIIWAKDSTHALPFGTIVLLITVYFIVCIPLSILGGVSATYTRRK 477

Query: 480 C-----------------RLDNHPTKTNQI-------ARQIPIQPWYLKTIPVSLIAGVF 515
           C                   D+ P   N++         ++P+     + + +++I+G+ 
Sbjct: 478 CLSLDPRSIINRFFLLNIHYDDQPVVENKVHLPRISGNSKLPLM--LRQPVLLTVISGIV 535

Query: 516 PFASIAVELYFIYTSLWFNK-----------------------IXXXXXXXXXXXXXXXX 552
           PF  I VEL F+Y SLW  K                       I                
Sbjct: 536 PFIVIYVELLFVYKSLWLEKTTFYYLYGFLLANIVLLCVVVCEISIIGCYLTLIHVSPDE 595

Query: 553 XXXXXXXXXXYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILFTKFKLGG--------- 603
                      HS  L+  + Q  +F+     CAI + +    +  F++GG         
Sbjct: 596 FIPIATPEQAMHSPMLKQVRVQAMNFV-----CAIGLAMTQWRWKSFQIGGSVAWYLEAY 650

Query: 604 -------------FTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVK 645
                        F++++L+  YS L + LC    G++G++S  +F+ +I+++ K
Sbjct: 651 SLYYFLTVLKIRDFSSILLFFCYSALFNFLCWCSFGALGYLSCCWFVNRIHTNSK 705

>CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113c
          Length = 704

 Score =  122 bits (307), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 156/644 (24%), Positives = 269/644 (41%), Gaps = 101/644 (15%)

Query: 78  FCKPENVVRQPA--SLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLI 135
           F  P    ++P   SL  +  GDR + S +KL+   +  C  LC+ +   E      +L+
Sbjct: 85  FICPPTKEKKPLHLSLDEIFRGDRKWQSDYKLSFGIDSPCEILCARKTKKEGMIKAKELV 144

Query: 136 KNGFMQNWLID-GLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEKKIMKTLE 194
           + G++  WLID  LPA      S  ++ +Y  GF +G+VD   G            KT  
Sbjct: 145 QQGYVTQWLIDESLPAATTFISSTNHNKYYAAGFPVGYVDDRTG------------KT-- 190

Query: 195 VPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQYNSGSLTLSETEENE-- 252
             +L NH  + I YH    + + +VG  V P S+          N     +   E+++  
Sbjct: 191 --FLNNHVMLVIRYHPVSEEEFTIVGFEVYPKSVSDYHCPGANKNHDKYEIIVPEKDDEL 248

Query: 253 --VHFTYSVKFIKSDTV-WATRWDKYLHVYDPT------IQWFSLINCXXXXXXXXXXXX 303
             + FTYSV + +   V W  RW+ +L+  + +        W S +N             
Sbjct: 249 TFIPFTYSVYWREEFEVDWNHRWNYFLNNGELSNSKANQFHWMSFLNSVGIASMTTTIVS 308

Query: 304 HMLLR--ALKNDLSR--YNEFNLDNEFHEDSGWKLSHGDVF----------RIPPRXXXX 349
            +LL+  + K   SR      NL  +  +D+  K+S G VF          +IP      
Sbjct: 309 IILLKIFSKKERESRNINTSTNLGQDNEDDNDDKIS-GSVFVNAKTWITVGKIPYWKALI 367

Query: 350 XXXXXXXXXXFLMIACSIIFAALGFLSPSSRGSLPTVMFLLY----ALFGFVGSYTSMAI 405
                     F ++   II  +L  L  + R ++ T+  + +    A+ G++GS   +  
Sbjct: 368 CLTSMGIQFSFTILGSLIISCSLSKLH-NIRFTVLTMSLICFICGAAISGYIGSRLYIE- 425

Query: 406 YKFFKGPL---------WKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFT 456
           Y+  KG L         +K +++    L PG + V    LN  ++   S+ A+P  T   
Sbjct: 426 YQILKGYLRNEVNRTKVYKFSVVCGSSL-PGLLMVISFSLNCIILAHDSTNALPFKTEVF 484

Query: 457 IILLWFVFSIPLSFAGSLIAHKRCRLDNHPT-------KTNQIARQIPIQPWYLKTIPV- 508
           ++ ++FV  IPLS  G ++A   C++D++ T       + N I+R+   +  + K + + 
Sbjct: 485 LVSIYFVTCIPLSLLGGVLA-LNCKVDSYNTLKRITSLRRNTISRK--SRSDFTKKVSLY 541

Query: 509 ----------------SLIAGVFPFASIAVELYFIYTSLWFNKIXXXXXX--XXXXXXXX 550
                           +L  G F F  I VEL ++Y S+W  K                 
Sbjct: 542 QRLVFDIKHDSFTTFGALAGGFFSFIIIWVELQYVYKSVWLEKTSFYYYYGFLLANILIL 601

Query: 551 XXXXXXXXXXXXYHSLCLENWK-----WQWRSFIIGGCGCAIYVFIHSILFTKFKLG--G 603
                       Y  L  +N +     W W+SF++G   CA Y+ ++S+ +  F L   G
Sbjct: 602 SIVTIEIAIIGCYVMLKAKNDRYLRHTWGWKSFLMGS-SCAWYMELYSLYYIFFVLNMQG 660

Query: 604 FTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647
           F+++ + + YS L + +C    GS+ +++S   + +IY   KVD
Sbjct: 661 FSSIFISVCYSLLFNGMCGWALGSLSYLTSYMLVTQIY---KVD 701

>KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} similar
           to uniprot|P40071 Saccharomyces cerevisiae YER113C
           Hypothetical ORF
          Length = 694

 Score =  102 bits (254), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 133/552 (24%), Positives = 211/552 (38%), Gaps = 101/552 (18%)

Query: 24  VAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHXXXXXXXXXXKFHFCKPEN 83
           + P  Y   D++ L VN +        E E  N+  G                 F  P +
Sbjct: 44  IKPNVYKRGDKVDLTVNKV--------ESEITNLPYG------------YYDLRFVCPPS 83

Query: 84  VVRQPA--SLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLIKNGFMQ 141
             ++P   SL  VI GDR + S + L     ++C  LC  +   +  +  ++LI+  +M 
Sbjct: 84  ETKKPLHLSLDEVIRGDRKWESDYNLEFGVGQDCERLCDRKTMPDGLRQADRLIRENYMV 143

Query: 142 NWLIDG-LPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEKKIMKTLEVPYLAN 200
           +WLIDG LPA      +R+   FY  GF LG VD        ++ +K         +L N
Sbjct: 144 HWLIDGDLPAATTFASTRSGKKFYTAGFPLGRVD--------HETDKT--------HLHN 187

Query: 201 HYDINIEYHDRGNDNYRVVGVTVDPVSIK--RSSSDSCQYNSGSLTLSETEENEVHFTYS 258
           H  + I Y     + Y +VG  V P S+   +    S  +    +   ETE   + FTYS
Sbjct: 188 HLMLVIRYQAFDFNRYAIVGFEVYPRSVSDYQCPGASKSFEPYVINTEETEVTYIPFTYS 247

Query: 259 VKFIKSDTV-WATRWDKYLH----VYDPTIQ---WFSLINCXXXXXXXXXXXXHMLLRAL 310
           V + +   + W+ RW+ +      + +  +    W SL N              + L+  
Sbjct: 248 VYWREESNIDWSHRWNLFFDGGSMLPNGNVSFFYWISLANSAIVVALMTLFIALIFLKIR 307

Query: 311 KNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRXXXXXXXXXXXXXXFLMIACSIIFA 370
            +D      F    E+     + L+  ++                    F +I  S I  
Sbjct: 308 ADDFVGTLAF----EWASQPVYYLTQLNL-----------AASMGIQFLFSIIGSSTISC 352

Query: 371 ALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFK-GPLWKVNL---LLTPVLVP 426
           +L  +       L T      A+   +G+YTS  +      GP  K+NL   +L    +P
Sbjct: 353 SLCKVHNIRSWELSTA-----AICFVLGAYTSSLVGSLLAPGP--KMNLGTSVLCGCTLP 405

Query: 427 GGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHKRCRLDNHP 486
               V + + N  +    SS A+P GTL  ++  +FV  +PLSF G   A K   L + P
Sbjct: 406 ALALVVVAVFNSVVWIKDSSAALPFGTLLALLTSYFVICLPLSFLGGFSARK---LRSAP 462

Query: 487 TK-TNQIARQIP--------------IQPWYLKTIP--------VSLIAGVFPFASIAVE 523
               N    ++P              +     K IP        ++++ G  PF     E
Sbjct: 463 ANGLNYEQSKVPFSFLLSIEYHEYNLLPAGQEKEIPAILSNPFLLTIVTGFPPFVVTCTE 522

Query: 524 LYFIYTSLWFNK 535
           L F+Y SLW  K
Sbjct: 523 LLFVYRSLWLQK 534

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 47/82 (57%), Gaps = 8/82 (9%)

Query: 563 YHSLCLENWK-----WQWRSFIIGGCGCAIYVFIHSILFTKF--KLGGFTTVVLYLGYSG 615
           Y +     WK     W+W++F+  G   A Y  ++S+ +  F   L  F++++L++ Y+ 
Sbjct: 604 YMASTARRWKASFSSWRWKAFM-AGASVAWYFELYSLYYLIFVLHLRDFSSILLFVCYTS 662

Query: 616 LISVLCCIVTGSIGFISSMFFI 637
           L +++C    G++G+++ ++F+
Sbjct: 663 LFNLMCWCAFGALGYLTCLWFL 684

>Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113C -
           Hypothetical ORF [contig 33] FULL
          Length = 690

 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 62/273 (22%), Positives = 113/273 (41%), Gaps = 44/273 (16%)

Query: 12  LTSLVKAFYLPGVAPTTYHSNDEIQLLVNHL-TPSMNFQHEDEDGNMVKGDKEHXXXXXX 70
           +T   +++    + P  Y   D++ +++N + + +  F +   D                
Sbjct: 28  VTRFSQSYDFGWIKPNVYKKGDKVDVIINKVVSETARFPYGYYD---------------- 71

Query: 71  XXXXKFHFCKPENVVRQPA--SLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDA 128
                  F  P +  ++P   SL  +I GDR + S + L   E  +C+ LC  +   E  
Sbjct: 72  -----LQFVCPPSDKKKPLHLSLNEIIRGDRKWESDYNLAFGERHDCLRLCDRKTKPEGL 126

Query: 129 KFVNKLIKNGFMQNWLI-DGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEK 187
           K  + LI+ G++ +WLI D LPA      +++   FY  GF LG VD   G +       
Sbjct: 127 KQADALIRQGYVAHWLIDDDLPAATTFAKTKSGKKFYTAGFPLGEVDAVTGKTR------ 180

Query: 188 KIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQ--YNSGSLTL 245
                     L NH  + + Y     + + ++G  V P S+  +        Y    +  
Sbjct: 181 ----------LYNHLMLVVRYQTVDVNKHTIIGFEVYPKSVSDAHCPGANKDYQPYEINT 230

Query: 246 SETEENEVHFTYSVKFIKSDTV-WATRWDKYLH 277
            E+E   + FTYS+ + +   + W+ RW+ ++H
Sbjct: 231 EESEITYIPFTYSIYWREESNIDWSHRWNFFIH 263

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 56/132 (42%), Gaps = 24/132 (18%)

Query: 425 VPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHK------ 478
           +PG +  T+++LN  +    SS AIP GT+   +  +F+ S PLS  G   A K      
Sbjct: 400 LPGLVLFTVLVLNGIVWLKDSSSAIPFGTVVVFVAGYFMISFPLSLLGGFSARKMKNAAK 459

Query: 479 ----------------RCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAV 522
                               D        + +  PI       I ++++AG+ PF  I V
Sbjct: 460 LAPANAISKSPFSFLLTLSYDTRSWPATALGKPFPIA--LSNPILLTILAGIAPFVVICV 517

Query: 523 ELYFIYTSLWFN 534
           EL+++Y S+W  
Sbjct: 518 ELFYVYKSMWLQ 529

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 42/74 (56%), Gaps = 1/74 (1%)

Query: 573 WQWRSFIIGG-CGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFI 631
           W+W+SF+ GG     + ++    L     L   ++++L++ Y+ L + +C    G++G++
Sbjct: 615 WRWKSFVAGGSVAWYLELYSLYYLIFVLHLRDLSSILLFVCYTALFNFMCWCAFGALGYL 674

Query: 632 SSMFFIRKIYSSVK 645
           S ++F+  I SS K
Sbjct: 675 SCLWFLSHISSSSK 688

>Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar to
           Ashbya gossypii AGL295C
          Length = 676

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 71/265 (26%), Positives = 105/265 (39%), Gaps = 46/265 (17%)

Query: 24  VAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHXXXXXXXXXXKFHFCKPEN 83
           V P  Y   +E+++L+N +          + G +  G  +               C P  
Sbjct: 40  VRPRIYQDGEEVEMLLNQVV--------GKPGELSYGYYDLQFT-----------CTPTK 80

Query: 84  VVRQPA-SLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLIKNGFMQN 142
             R    SL  V  GDR + S +KL    E +C  LC  +         + LI+  +   
Sbjct: 81  SRRMVHHSLYEVFSGDRKWQSDYKLYFNRENKCSTLCFRKTQPSGLIEADSLIRQNYTVQ 140

Query: 143 WLIDG-LPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEKKIMKTLEVPYLANH 201
            LID  +PA +     R N  +Y  GF LGFVD                   +V YL NH
Sbjct: 141 LLIDEIMPASKTYVSMRDNKRYYVPGFPLGFVD----------------PETDVTYLHNH 184

Query: 202 YDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSC-----QYNSGSLTLSETEENEVHFT 256
           + + I Y+    + Y +VG  V P S+   S D C      Y + ++  SE +   +  T
Sbjct: 185 FMLVIRYNAVDINKYTIVGFEVYPKSV---SDDHCPGSSKDYENYAVNPSEKDVVFIPIT 241

Query: 257 YSVKFIKSDTV-WATRWDKYLHVYD 280
           YSV + +   V W  RW+ YL   D
Sbjct: 242 YSVYWREEFMVDWENRWNFYLSAGD 266

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 58/269 (21%), Positives = 103/269 (38%), Gaps = 57/269 (21%)

Query: 425 VPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHKRCRLDN 484
           +P      ++L N     +     +P   +  ++ L+F+ S+PLS  G   A  + + D 
Sbjct: 404 LPALTVAVLVLANSIAWIIERGKEMPFRDITLLLALYFMVSLPLSLLGGTSASYKLK-DQ 462

Query: 485 H----------------PTK-------------TNQIA-RQIPIQPWYLKTIPVSLIAGV 514
           H                P+K             T   A  QIP+  W  K   ++ I G+
Sbjct: 463 HFQLYSLSTKYTGTPVSPSKPTFWFNFEYDTRGTPACAHEQIPM--WLSKPFLITSIIGI 520

Query: 515 FPFASIAVELYFIYTSLW------FNKIXXXXXXXXXXXXXXXXXXXXXXXXXXYH---- 564
            PF +I +++ FI+  LW      F                             +H    
Sbjct: 521 IPFLAIYLQMEFIWKPLWTHSKSLFQIYVSLIIGMILQSILVMEICILIMYVHMHHGDDS 580

Query: 565 SLCLENW-----------KWQWRSFIIGGCGCAIYVFIHSILFTKF--KLGGFTTVVLYL 611
             C ++             W+W++F +GG   A Y   +S+ +  F  +L  F +++LYL
Sbjct: 581 ECCFDDTCVTGRISNAVSSWRWKAFYMGGAA-AWYWEAYSLYYMIFILRLRNFGSILLYL 639

Query: 612 GYSGLISVLCCIVTGSIGFISSMFFIRKI 640
            Y  L++V      GSIG+++  +F+ K+
Sbjct: 640 SYGTLLNVFYFYSFGSIGYLACCWFLNKL 668

>TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411
           YER113C
          Length = 713

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 94/225 (41%), Gaps = 29/225 (12%)

Query: 79  CKPENVVRQ-PASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLIKN 137
           C P +  R    SL  +  GD +  S + L   +++ C  LCS +   +  +    LIKN
Sbjct: 99  CPPSDTKRPIHNSLTELFNGDYLSESDYILEFAKDEPCHILCSRKTSKKGMQRAYDLIKN 158

Query: 138 GFMQNWLIDG-LPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEKKIMKTLEVP 196
            ++  W +D  LP G     ++ N   Y  GF LG+ D   G +                
Sbjct: 159 DYIVQWYVDNDLPVGTTYISNKVNKKQYLPGFSLGYFDNQTGQA---------------- 202

Query: 197 YLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQYNSGSLTLSETEENE---- 252
           YL  H    + YH   +D + +VG+ V P SI   +      +   L +   E N+    
Sbjct: 203 YLNTHLMFVVRYHAVTSDTFTIVGLEVYPRSIVDYNCPGASKDFIPLEVKVPENNDDPTY 262

Query: 253 VHFTYSVKFIKS-DTVWATRWDKY------LHVYDPTIQWFSLIN 290
           + F+YSV + +  D  W  RWD +      L   D +  W+SLIN
Sbjct: 263 LPFSYSVYWREEFDLPWNQRWDLFKTADELLREKDLSFHWYSLIN 307

>AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER113C
          Length = 657

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 81/201 (40%), Gaps = 21/201 (10%)

Query: 79  CKPENVVRQP-ASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLIKN 137
           C P    R    SLG V   +  + S + L++  E +C PLC   +  +  + + ++I++
Sbjct: 71  CPPPAEARAIYGSLGQVFRREMPWESNYVLHVRAETQCQPLCMRELRPDSHRRLIQMIRD 130

Query: 138 GFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEKKIMKTLEVPY 197
           G    W +DGLPA     D R +S  Y  GF+LG VD   G                   
Sbjct: 131 GAQVRWTLDGLPAATTYPD-RQSSYRYEAGFKLGEVDAETGHVR---------------- 173

Query: 198 LANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQYNSGSLTLSETEEN--EVHF 255
           L NH  + + Y    +  Y +VG    P S+        Q       L+   +    V F
Sbjct: 174 LHNHVMLVVRYRILDDGRYVIVGFEAYPRSVAGEGCTGGQTEYEHFWLNPDAQAMIMVPF 233

Query: 256 TYSVKF-IKSDTVWATRWDKY 275
           TY+V +  +S   W  RW  Y
Sbjct: 234 TYAVYWRYQSAVKWNERWRLY 254

>TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7.411
           YER113C
          Length = 733

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 103/265 (38%), Gaps = 43/265 (16%)

Query: 24  VAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHXXXXXXXXXXKFH----FC 79
           V P TY   D ++++VN +      Q +D  G+  +G              K+H     C
Sbjct: 46  VHPNTYTFGDPVEVIVNKMV-----QEKDMLGDSNEG-----------VSYKYHDLPYIC 89

Query: 80  KPENVVRQ-PASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLIKNG 138
            P N  +    SL  +  GD    S + L    + +C  LC  +      +   ++I   
Sbjct: 90  PPTNTKKSIHNSLKELFNGDYNEQSDYILKFGVDNDCQALCLRKTYNAGIRKAKEMIDED 149

Query: 139 FMQNWLIDG-LPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEKKIMKTLEVPY 197
           ++ NW ID  LPA      S T    Y  GF LG+ D   G                  Y
Sbjct: 150 YIVNWFIDDYLPAATTYISSVTRKKKYFEGFSLGWKDPETG----------------SYY 193

Query: 198 LANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQYNSGSLTLSETEENE----V 253
           + NH  + I Y+   ++ + +VG  V P SI        +   G   L + E N+    +
Sbjct: 194 INNHVMLVIRYNAVDDNKFNIVGFEVYPKSIPDLQCPGARRGHGHYELKDLENNDEFSLI 253

Query: 254 HFTYSVKFIKS-DTVWATRWDKYLH 277
            F+YSV + +  +  W TRW  ++ 
Sbjct: 254 PFSYSVYWREEFEYDWRTRWSLFVR 278

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 1/85 (1%)

Query: 395 GFVGSYTSMAIYKFFKGPLWKVNL-LLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGT 453
            FVG++  M +++    P +   + ++   ++PG     + + N    F+  + + P   
Sbjct: 409 SFVGTWLRMYMFQKKMTPNYDPKMSIVCGSILPGLTLAGVTVFNTVTWFLEGNSSYPFRK 468

Query: 454 LFTIILLWFVFSIPLSFAGSLIAHK 478
           L  +I ++F+FSIP+S  G  +A K
Sbjct: 469 LSWLIFVYFIFSIPMSLIGGSLAVK 493

>Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON}
           (64237..66282) [2046 nt, 682 aa]
          Length = 681

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 67/258 (25%), Positives = 99/258 (38%), Gaps = 42/258 (16%)

Query: 24  VAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHXXXXXXXXXXKFHFCKPEN 83
           + P  Y   D + LLVN    ++N          +K    H             F  P  
Sbjct: 47  LQPNVYKVGDNVDLLVNKAISTLNAD--------LKPYIYH----------DLPFVCPPT 88

Query: 84  VVRQPASL--GSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLIKNGFMQ 141
            VR+P  L   S+  GD +  S +KL   ++ EC  LC+ +           +IK  +  
Sbjct: 89  SVRKPVHLEFDSLFRGDTLSESDYKLKFGDDYECEILCARKTNKNGVSKAIDMIKQDYQI 148

Query: 142 NWLIDG-LPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEKKIMKTLEVPYLAN 200
            W ID  LP       + T    Y  GF LG  D         D+ K         YL N
Sbjct: 149 LWSIDDELPISMPYISTITQRKKYIPGFPLGRFD--------KDKNK--------VYLYN 192

Query: 201 HYDINIEYHDRGNDNYRVVG--VTVDPVSIKRSSSDSCQYNSGSLTLSETEENE--VHFT 256
           H  + I Y+   +D + +VG  V +  VS       S  Y    L + E +++   + FT
Sbjct: 193 HSMLVIRYNAIDDDKFTIVGFEVYLRSVSDYHCPGASKNYEEYELVIPENDDDLTFIPFT 252

Query: 257 YSVKFIKS-DTVWATRWD 273
           YSV + +  D  W +RW+
Sbjct: 253 YSVYWREEFDIDWTSRWN 270

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 57/132 (43%), Gaps = 16/132 (12%)

Query: 419 LLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHK 478
           +L   L+P  + + +  ++  +  + SS   P  TL  +I  +++  +P S  G  +A K
Sbjct: 426 ILCGSLLPFLLMIFVYPIHSIVWLIESSSRYPFKTLTMMISFFYIICVPFSIIGGGLAKK 485

Query: 479 RCR----------LDNHPTKTNQIAR------QIPIQPWYLKTIPVSLIAGVFPFASIAV 522
             +          LDN     ++  R         I    L T+  SLI  + PF  I  
Sbjct: 486 YRKHYKEMFGNITLDNENNDNDEKKRFKAQHRPSSINKNKLGTLVYSLITAIVPFFIIKS 545

Query: 523 ELYFIYTSLWFN 534
           ELY+I+T+ W N
Sbjct: 546 ELYWIFTNKWLN 557

>NCAS0B07560 Chr2 complement(1426000..1427477,1427593..1427602)
           [1488 bp, 495 aa] {ON} Anc_1.303 YBR283C
          Length = 495

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 480 CRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVF--PFASIAVELYFIYTSLWFNK 535
           C++  H    N I   +P  P  L T P SLI G+F  P   I   L+ + TS+WF K
Sbjct: 328 CKILGHYENVNNIL-AVPTFPLSLLTPPRSLIGGLFSQPLTFIVFTLFIVSTSVWFAK 384

>KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 607

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 44/103 (42%), Gaps = 10/103 (9%)

Query: 166 TGFQLGFVDVTEGFSDSNDEEKKIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDP 225
           T F +G +    G + S  E   ++  + +P LA      + +H  GN NY+V       
Sbjct: 83  TTFGVGELSAVNGVAGSFAEHVGLLHFVGMPPLAAQRRRLLLHHTLGNGNYKV------- 135

Query: 226 VSIKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVW 268
               R  SD  QY S  LT +ET   EV    S+ F K   V+
Sbjct: 136 --FHRLGSDVTQYTS-VLTDTETCSKEVDKCISIAFTKQRPVY 175

>Skud_7.174 Chr7 (317467..318516) [1050 bp, 349 aa] {ON} YGL100W
           (REAL)
          Length = 349

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 155 HDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEK-KIMKTLEVPYLANHYDINIE 207
            +S  NSN + +G  +      +G SDSN+EEK ++  +L V  L+ H D N E
Sbjct: 255 EESSNNSNLFDSGTDVDMD--RQGRSDSNNEEKAELQSSLMVELLSEHDDHNGE 306

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.141    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,797,623
Number of extensions: 2805662
Number of successful extensions: 9235
Number of sequences better than 10.0: 57
Number of HSP's gapped: 9301
Number of HSP's successfully gapped: 91
Length of query: 647
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 531
Effective length of database: 40,180,143
Effective search space: 21335655933
Effective search space used: 21335655933
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)