Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C01826g8.255ON69969935970.0
TDEL0F038208.255ON68769224330.0
Suva_2.2688.255ON69569623040.0
YDR108W (TRS85)8.255ON69869522970.0
Smik_4.3548.255ON69869522690.0
Skud_4.3698.255ON69869522680.0
NCAS0B038808.255ON70672622310.0
Kpol_392.118.255ON67568521760.0
NDAI0J014108.255ON71671121630.0
CAGL0B01705g8.255ON67269820320.0
KAFR0B055708.255ON66969920240.0
KLTH0G13860g8.255ON70874418130.0
TPHA0B032608.255ON71455017880.0
Kwal_56.235838.255ON70074117810.0
SAKL0H17226g8.255ON71976317540.0
KNAG0H032708.255ON64871715750.0
TBLA0E043808.255ON88963414670.0
Ecym_43168.255ON62368913121e-173
AGR096C8.255ON62368112771e-167
KLLA0F18953g8.255ON64770412091e-157
TBLA0I029004.238ON179496761.7
Kpol_1011.28.72ON584112724.3
KNAG0G019008.238ON213074709.0
TPHA0C007408.335ON38572699.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C01826g
         (699 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {...  1390   0.0  
TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.2...   941   0.0  
Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W ...   892   0.0  
YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subun...   889   0.0  
Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W ...   878   0.0  
Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W ...   878   0.0  
NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {O...   863   0.0  
Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}...   842   0.0  
NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {...   837   0.0  
CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly...   787   0.0  
KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa] ...   784   0.0  
KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]...   702   0.0  
TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {O...   693   0.0  
Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108...   690   0.0  
SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]...   680   0.0  
KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {O...   611   0.0  
TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON} Anc_8...   569   0.0  
Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}...   509   e-173
AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON} S...   496   e-167
KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} simi...   470   e-157
TBLA0I02900 Chr9 complement(687092..692476) [5385 bp, 1794 aa] {...    34   1.7  
Kpol_1011.2 s1011 complement(2303..4057) [1755 bp, 584 aa] {ON} ...    32   4.3  
KNAG0G01900 Chr7 complement(423975..430367) [6393 bp, 2130 aa] {...    32   9.0  
TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.3...    31   9.8  

>ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {ON}
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 699

 Score = 1390 bits (3597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 673/699 (96%), Positives = 673/699 (96%)

Query: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60
           MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL
Sbjct: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60

Query: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPXXXXXX 120
           YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVP      
Sbjct: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPSTSSDT 120

Query: 121 XXXXXXXXXXXXXXXXXXXXLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180
                               LFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF
Sbjct: 121 KNTTTSTSGTTGGTRKRSNSLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180

Query: 181 LENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISA 240
           LENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISA
Sbjct: 181 LENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISA 240

Query: 241 GQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLK 300
           GQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLK
Sbjct: 241 GQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLK 300

Query: 301 KQLFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYNIL 360
           KQLFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYNIL
Sbjct: 301 KQLFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYNIL 360

Query: 361 EKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGKDK 420
           EKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGKDK
Sbjct: 361 EKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGKDK 420

Query: 421 NGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVSV 480
           NGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVSV
Sbjct: 421 NGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVSV 480

Query: 481 LMGAQNIVTVKMIKNDIDPLIQRALETYENCAADEDSTGEELYVPVRSYETRCMFLASEL 540
           LMGAQNIVTVKMIKNDIDPLIQRALETYENCAADEDSTGEELYVPVRSYETRCMFLASEL
Sbjct: 481 LMGAQNIVTVKMIKNDIDPLIQRALETYENCAADEDSTGEELYVPVRSYETRCMFLASEL 540

Query: 541 FLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIRHKTSAQGA 600
           FLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIRHKTSAQGA
Sbjct: 541 FLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIRHKTSAQGA 600

Query: 601 KAMTDELAPDEESNEEIVTRGLTRKRKAAFFRLIAANKWVEQKQWKQAFWCLKEIEEAYA 660
           KAMTDELAPDEESNEEIVTRGLTRKRKAAFFRLIAANKWVEQKQWKQAFWCLKEIEEAYA
Sbjct: 601 KAMTDELAPDEESNEEIVTRGLTRKRKAAFFRLIAANKWVEQKQWKQAFWCLKEIEEAYA 660

Query: 661 GLDFVNREDLILARLKRQMNEAQNNVDESSNQTVESGAA 699
           GLDFVNREDLILARLKRQMNEAQNNVDESSNQTVESGAA
Sbjct: 661 GLDFVNREDLILARLKRQMNEAQNNVDESSNQTVESGAA 699

>TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.255
           YDR108W
          Length = 687

 Score =  941 bits (2433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/692 (66%), Positives = 542/692 (78%), Gaps = 37/692 (5%)

Query: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60
           +KLSYENYMNLL HLDHG + VP DIA+RIVSNA+SPVI V+STPELDRHI++T+HLDSL
Sbjct: 2   VKLSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSL 61

Query: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPXXXXXX 120
           YM LRFFGDCV DRDQA+E             A  PS  D+  E S  S+L V       
Sbjct: 62  YMLLRFFGDCVGDRDQAHECTS----------AGSPS-GDDRAEKSSSSTLAVASGPSRK 110

Query: 121 XXXXXXXXXXXXXXXXXXXXLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180
                               LFQRD TQSQY+RFTRP+ DL+ES+D+NDMLFDYH+LE F
Sbjct: 111 RSNS----------------LFQRDATQSQYIRFTRPLRDLVESADTNDMLFDYHTLESF 154

Query: 181 LENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISA 240
           LEN L L+E+ T+D TP +LLKKSLYH+FFSLAISST YLSPYETFNHPVVSLIA+DI  
Sbjct: 155 LENILLLIEKSTNDKTPHKLLKKSLYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPI 214

Query: 241 GQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLK 300
           GQGYEEARDLL KFKNLNHT +NFP+F++T D+LPVFLLCYN +SE++   CQ L  +LK
Sbjct: 215 GQGYEEARDLLTKFKNLNHTTKNFPVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLK 274

Query: 301 KQLFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYNIL 360
           KQLFVE +LLPLWK +Y    +V LHQPIM+SL+E+LYFL+ P+   L L+LIN  Y++L
Sbjct: 275 KQLFVEGILLPLWKDNYKTATQVILHQPIMTSLDEVLYFLREPSRIELSLELINSIYDVL 334

Query: 361 EKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGKDK 420
           E L+  LM+PFM+RKISFWEETILQPR+SLFHG+ F K+ MSK ++G+N HQ  S+ KD 
Sbjct: 335 EILINGLMIPFMQRKISFWEETILQPRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDA 394

Query: 421 NGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVSV 480
           NG EYFV+SS EFLMRKLADWSMMLSD+KTAYSTY+SL HDLE++PKYLASC EWC+VSV
Sbjct: 395 NGKEYFVSSSAEFLMRKLADWSMMLSDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSV 454

Query: 481 LMGAQNIVTVKMIKNDIDPLIQRALETYENCAA-DEDSTGEEL---YVPVRSYETRCMFL 536
           LMGAQNIVT KM+K DIDPLIQRA+ETYENCA  D   +G +      PVRSYETRCMFL
Sbjct: 455 LMGAQNIVTAKMLKTDIDPLIQRAVETYENCALYDTQLSGSKKSNSMAPVRSYETRCMFL 514

Query: 537 ASELFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIRHKTS 596
           ASELFLSLSDTWTSTPYAL +LETIL ECRLGPCS+IMIWERLS+CY QRID RIRHK +
Sbjct: 515 ASELFLSLSDTWTSTPYALRNLETILAECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVN 574

Query: 597 AQGAKAMTDELAPDEESNEE-----IVTRGLTRKRKAAFFRLIAANKWVEQKQWKQAFWC 651
             GA +  +++  +++S +E     IVTRGLTR RKAAFF+LIAANKW EQKQW+QA WC
Sbjct: 575 -DGAMSNEEKVENEDDSEKEHTHADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWC 633

Query: 652 LKEIEEAYAGLDFVNREDLILARLKRQMNEAQ 683
           LK+ E+AYAG++FVNR+DL LA+LK  +   +
Sbjct: 634 LKDTEDAYAGIEFVNRKDLALAKLKETLKNVE 665

>Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W
           (REAL)
          Length = 695

 Score =  892 bits (2304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/696 (64%), Positives = 538/696 (77%), Gaps = 41/696 (5%)

Query: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60
           M  SYE+YMNLLFHLDH +ETVPP+IA+RIVSNA++PVITV+STP  D+HI++ Y +DSL
Sbjct: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60

Query: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKS-SLKVPXXXXX 119
           YM LRFFG CVSDRDQANE +     E+ E  A P       IE+S K+ +L VP     
Sbjct: 61  YMLLRFFGGCVSDRDQANEGK----FEQDEQNASPS------IESSSKNQNLGVPSALKR 110

Query: 120 XXXXXXXXXXXXXXXXXXXXXLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEV 179
                                LFQRD TQSQYVRFTRP+ DLIE+ D+NDMLF+YHSLEV
Sbjct: 111 GSRSRSNS-------------LFQRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEV 157

Query: 180 FLENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDIS 239
           FL+N L+LV   TD+  P +LLKKS+YH FFSLAISST  LSPYETFNHP++SLIA+DIS
Sbjct: 158 FLDNYLKLVAGNTDEKVPHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDIS 217

Query: 240 AGQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQL 299
            G+ YE+ARDLL+ FKNLNH  E+FPIFM+T ++LPVFLLCYNDES++E   CQ LA +L
Sbjct: 218 YGEVYEDARDLLVNFKNLNHNTESFPIFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKL 277

Query: 300 KKQLFVESLLLPLWKRSYSD--HGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTY 357
           KKQLFVES+LLPLWK S+ D  +  ++LHQP+MSSLEE+L+FL++PT T+L L LIN  Y
Sbjct: 278 KKQLFVESILLPLWKDSFVDVENSNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIY 337

Query: 358 NILEKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNS-NGSNNHQPISL 416
           ++L+ LV DLM+PFMKRKISFWEETILQPRKSLF+GA FFKK M+K   NG  NHQ  SL
Sbjct: 338 DMLDYLVYDLMIPFMKRKISFWEETILQPRKSLFNGAKFFKKFMNKAPVNG--NHQHNSL 395

Query: 417 GKDKNGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWC 476
            KD  GNEYF +SS+EFLMRKLADWSMMLSDFKTAYSTYESL+ DL+ FPKYLASC EWC
Sbjct: 396 TKDNQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWC 455

Query: 477 AVSVLMGAQNIVTVKMIKNDIDPLIQRALETYENCAADEDSTGEELYV-----PVRSYET 531
           AVS+LMGAQ+IVTVKMIKNDI+PLI+RAL TYENC+  +    +EL       PVRSYET
Sbjct: 456 AVSLLMGAQSIVTVKMIKNDINPLIERALATYENCSRMQRRNSKELTSSGVLEPVRSYET 515

Query: 532 RCMFLASELFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRI 591
           RCM LASELFLSLSDTWTSTPYA+  LETIL EC+LGPCS+IM+WERLSDCY  R+DPR+
Sbjct: 516 RCMILASELFLSLSDTWTSTPYAIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRV 575

Query: 592 RHKTSA-QGAKAMTDELAPDEE------SNEEIVTRGLTRKRKAAFFRLIAANKWVEQKQ 644
           +HK    + +   T++L  D+E      + E+I++ GLTR+RKAAFFRL+AA KW EQKQ
Sbjct: 576 KHKVGGMKKSVKNTEDLRNDDEYDTDHFTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQ 635

Query: 645 WKQAFWCLKEIEEAYAGLDFVNREDLILARLKRQMN 680
           W+Q  WCLK+IE  Y+ +DF++   LIL+ LK Q+N
Sbjct: 636 WRQVSWCLKDIENTYSDIDFLHGNGLILSNLKNQLN 671

>YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subunit
           of TRAPPIII (transport protein particle), a multimeric
           guanine nucleotide-exchange factor for Ypt1p, required
           for membrane expansion during autophagy and the CVT
           pathway; directs Ypt1p to the PAS; late post-replication
           meiotic role
          Length = 698

 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/695 (63%), Positives = 535/695 (76%), Gaps = 36/695 (5%)

Query: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60
           M  SYE+YMNLLFHLD+ +ETVPP+IA+RI+SNA++PVITV+STP  D+HI++TY +DSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60

Query: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPXXXXXX 120
           YM LRFFG CVSDRDQANE +  + + E   V +     D++ +N    +L+VP      
Sbjct: 61  YMLLRFFGGCVSDRDQANEAKVGQHEHE---VCDASDSTDSIPKNK---NLEVPNLSKKG 114

Query: 121 XXXXXXXXXXXXXXXXXXXXLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180
                               LFQRD TQSQY+RFTRP+ DLIE+ D+NDMLF+YHSLEVF
Sbjct: 115 SRSRSNS-------------LFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVF 161

Query: 181 LENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISA 240
           L+N L+LV   TD+  P  LLKKS+YH FFSLAISST  LSPYETFNHP++SLIA+DIS 
Sbjct: 162 LDNYLKLVAANTDEMVPHNLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISN 221

Query: 241 GQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLK 300
           G+ YE+ARDLL+ FKNLNH  ENFPIFM+T ++LPVFLLCYND+S++E   CQ LA +LK
Sbjct: 222 GEVYEDARDLLVNFKNLNHNTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCQALAKKLK 281

Query: 301 KQLFVESLLLPLWKRS--YSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYN 358
           KQLFVES+LL LWK S  Y ++  ++LHQP+MSSLEE+L+FLQ+PT T L L LIN  Y+
Sbjct: 282 KQLFVESILLALWKDSFIYDENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYD 341

Query: 359 ILEKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNS-NGSNNHQPISLG 417
           +L+ LV DLM+PFMKRK+SFWEETILQPRKSLF+GA FFKK M+KN  NG  NHQ  SL 
Sbjct: 342 MLDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAKFFKKFMNKNPVNG--NHQHNSLT 399

Query: 418 KDKNGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCA 477
           +D  GNEYF +SS+EFLMRKLADWSMMLSDFKTAYSTYESL+ DL+ FPKYLASC EWCA
Sbjct: 400 RDSQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCA 459

Query: 478 VSVLMGAQNIVTVKMIKNDIDPLIQRALETYENCAADEDSTGEE-----LYVPVRSYETR 532
           VS+LMGAQ+IVTVKMIKNDI+PLI+RAL TYENC+  +   G+E     +  PVRSYETR
Sbjct: 460 VSLLMGAQSIVTVKMIKNDINPLIERALATYENCSRIQRGKGKESNSLDVTEPVRSYETR 519

Query: 533 CMFLASELFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIR 592
           CM LASELFLSLS+TWTSTPYA+  LETIL EC+LGPCS+IM+WERLSDCY  R+DPRI+
Sbjct: 520 CMILASELFLSLSNTWTSTPYAIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIK 579

Query: 593 HKTSAQGAKAMTDE-------LAPDEESNEEIVTRGLTRKRKAAFFRLIAANKWVEQKQW 645
           H+  A    A   E        + D  ++E+I++ GLTR+RKAAFFRLIAA KW EQKQW
Sbjct: 580 HRVGAMKKDAKDTEDLRGEHKYSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQW 639

Query: 646 KQAFWCLKEIEEAYAGLDFVNREDLILARLKRQMN 680
           +Q  WCLK+IE  Y+ + F++   LIL++LK Q+N
Sbjct: 640 RQVSWCLKDIESTYSEIKFLHGNGLILSKLKNQLN 674

>Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  878 bits (2269), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/695 (62%), Positives = 536/695 (77%), Gaps = 36/695 (5%)

Query: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60
           M  SYE+YMNLLFHLD+ +ETVPP+IA+RIVSNA++PVITV+STP  D+HI++ Y +DSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60

Query: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPXXXXXX 120
           YM LRFFG CVSDRDQANE   ++  ++   V +  +  ++    S+  +L+VP      
Sbjct: 61  YMLLRFFGGCVSDRDQANE---VKVGQDEHQVGDTNASMESF---SKSKNLEVPNLPKKG 114

Query: 121 XXXXXXXXXXXXXXXXXXXXLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180
                               LFQRD TQSQY+RFTRP+DDLIE+ D+NDMLF+YHSLEVF
Sbjct: 115 SRSRSNS-------------LFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVF 161

Query: 181 LENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISA 240
           L+N L+LV + TD+  P +LLKKS+YH FFSLAISST  LSPYETFNHP++SLIA+DIS 
Sbjct: 162 LDNYLKLVADNTDEMVPHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISN 221

Query: 241 GQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLK 300
           G+ YE+ARDLL+ FKNLNH  ENFP+FM+T ++LPVFLLCYNDES++E   CQ LA +LK
Sbjct: 222 GEVYEDARDLLVNFKNLNHNTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLK 281

Query: 301 KQLFVESLLLPLWKRSY--SDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYN 358
           KQLFVES+LL LWK S+  +++  ++LHQP+MSSLEE+L+FLQ+PT T L L LIN  Y+
Sbjct: 282 KQLFVESVLLSLWKDSFIEANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYD 341

Query: 359 ILEKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKN-SNGSNNHQPISLG 417
           +L+ LV DLM+PFMKRK+SFWEETILQPRKSLF+GA FFKK M+KN SNG+++H   SL 
Sbjct: 342 MLDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHN--SLT 399

Query: 418 KDKNGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCA 477
            D  GNEYF +SS+EFLMRKLADWSMMLSDFKTAYSTYESL+ DL+ FPKYLASC EWCA
Sbjct: 400 SDNQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCA 459

Query: 478 VSVLMGAQNIVTVKMIKNDIDPLIQRALETYENCAADEDSTGEELYV-----PVRSYETR 532
           VS+LMGAQ IVTVKMIKNDI+PLI++AL TYENC+  + S  E+        PVRSYETR
Sbjct: 460 VSLLMGAQRIVTVKMIKNDINPLIEKALATYENCSKIQRSKSEKSSSSNTVEPVRSYETR 519

Query: 533 CMFLASELFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIR 592
           CM LASELFLSLSD WTSTPYA+  LETIL EC+LGPC +IMIWERLSDCY  R+DPRI+
Sbjct: 520 CMILASELFLSLSDKWTSTPYAIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIK 579

Query: 593 HKTSA--QGAKAMTDELAPDEES-----NEEIVTRGLTRKRKAAFFRLIAANKWVEQKQW 645
           H+  A  +G +   D    D  S     +++I++ GLTRKRKAAFFRLIAA KW EQKQW
Sbjct: 580 HRVGAMKKGIRDTEDLRGGDGNSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQW 639

Query: 646 KQAFWCLKEIEEAYAGLDFVNREDLILARLKRQMN 680
           +Q  WCLK+IE  Y+ + F+N + LIL++L  Q+N
Sbjct: 640 RQVSWCLKDIESIYSDIKFLNGDGLILSKLHNQLN 674

>Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/695 (63%), Positives = 533/695 (76%), Gaps = 36/695 (5%)

Query: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60
           M  SYE+YMNLLFHLD+ +E VPP+IA+RIVSNA++PVITV+STP  D+HI++TY++DSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60

Query: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPXXXXXX 120
           YM LRFFG CVSDRDQANE +   ++ E   V++     ++L   S+  +L VP      
Sbjct: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHE---VSDTSVSMESL---SKNQNLGVPNALKKG 114

Query: 121 XXXXXXXXXXXXXXXXXXXXLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180
                               LFQRD TQSQY+RFTRP+ DLIE+ D+NDMLF+YHSLEV+
Sbjct: 115 SRSRSNS-------------LFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVY 161

Query: 181 LENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISA 240
           L+N L+LV E T++  P +LLKKS+YH FFSLAISST  LSPYETFNHP++SLIA+DIS 
Sbjct: 162 LDNYLKLVTENTNETAPHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISN 221

Query: 241 GQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLK 300
           G+ YE+ARDLL+ FKNLNH  ENFPIFM+T ++LPVFL+CYNDES++E   CQ LA +LK
Sbjct: 222 GEVYEDARDLLVNFKNLNHNTENFPIFMNTNEMLPVFLICYNDESQEEFEKCQALAKKLK 281

Query: 301 KQLFVESLLLPLWKRSYSD--HGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYN 358
           KQLFVES+ LPLWK S+ D  +  ++LHQP+MSSLEE+L+FLQ+PT T L L LIN  Y+
Sbjct: 282 KQLFVESIFLPLWKESFIDDENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYD 341

Query: 359 ILEKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKN-SNGSNNHQPISLG 417
           IL+ LV DLM+PFMKRK+SFWEETILQPRKSLF+GA FFKK M+KN +NGS  HQ  SL 
Sbjct: 342 ILDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAKFFKKFMNKNPANGS--HQHNSLT 399

Query: 418 KDKNGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCA 477
           +D+ GNEYF +SS+EFLMRKLADWSMMLSDFKTAYSTYESL+ DL+ FPKYLASC EWCA
Sbjct: 400 RDRQGNEYFSSSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCA 459

Query: 478 VSVLMGAQNIVTVKMIKNDIDPLIQRALETYENCAADEDSTGEELYV-----PVRSYETR 532
           VS+LMGAQ+IVTVKMIKNDI+PLI+RAL TYE C+  +   G+EL       PVRSYETR
Sbjct: 460 VSLLMGAQSIVTVKMIKNDINPLIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETR 519

Query: 533 CMFLASELFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIR 592
           CM LASELFLSLSDTWTSTPYA+  LETIL EC+LGPCS+IMIWERLSDCY  R+DPRI+
Sbjct: 520 CMILASELFLSLSDTWTSTPYAIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIK 579

Query: 593 HKTSAQGAKAM-------TDELAPDEESNEEIVTRGLTRKRKAAFFRLIAANKWVEQKQW 645
           H+                 DE   D    E+I++ GLTR+RKAAFFRLIAA KW EQK W
Sbjct: 580 HRVGVMKKSFKETEDLRNGDEHYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHW 639

Query: 646 KQAFWCLKEIEEAYAGLDFVNREDLILARLKRQMN 680
           +Q  WCLK+IE  Y+ + F++  D IL++LK Q+N
Sbjct: 640 RQVSWCLKDIESTYSEIKFLHCNDSILSKLKSQLN 674

>NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {ON}
           Anc_8.255 YDR108W
          Length = 706

 Score =  863 bits (2231), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/726 (58%), Positives = 524/726 (72%), Gaps = 63/726 (8%)

Query: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60
           M  SYE+YMNLLFHLD+G+ETVP +IA+RIVSNA+SPVI V+ST ELD HI +TY++DSL
Sbjct: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60

Query: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPXXXXXX 120
           YM LRFF  CVSDRDQANE +               S+ D +  N+   +L +P      
Sbjct: 61  YMLLRFFSGCVSDRDQANELEK--------------SQKDKISSNN---TLTLPTTSPLP 103

Query: 121 XXXXXXXXXXXXXXXXXXXXLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180
                               LFQRD TQSQY+RFT+P+ D+I + ++NDMLFDYHSLE++
Sbjct: 104 KVRTRGRSRSNS--------LFQRDSTQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIY 155

Query: 181 LENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISA 240
           L+N L L+++ TDDNTP+ELLKKS+YH FFSLAISSTT LSPYE FNHPVVSLIA+DIS 
Sbjct: 156 LQNYLDLIQKNTDDNTPYELLKKSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISL 215

Query: 241 GQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLK 300
           GQ Y++ RDLL+ FKNLN +  NFPIFM+T D+LPV LLCY+D+  ++   CQ L  ++K
Sbjct: 216 GQNYDDVRDLLVDFKNLNSSTHNFPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIK 275

Query: 301 KQLFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYNIL 360
           KQLFVE + LPLWK SY    +V LHQP+MSSLEEM+YFL  P    LP +LI   YNIL
Sbjct: 276 KQLFVECISLPLWKDSYPSDPQVHLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNIL 335

Query: 361 EKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGKDK 420
           + LV +LM+PFMKRKI+FW+ETILQPRKSLFHGA F KK M+K    +  HQ   L KD 
Sbjct: 336 DSLVYNLMIPFMKRKIAFWDETILQPRKSLFHGAKFLKKFMTKT---ALTHQENLLTKDA 392

Query: 421 NGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVSV 480
            GNEYF ++S+EFLMRKLADWSMMLSDFKTAY+TYESL HDLE+FPKY ASC EWCAVS+
Sbjct: 393 QGNEYFTSASSEFLMRKLADWSMMLSDFKTAYATYESLTHDLESFPKYSASCLEWCAVSL 452

Query: 481 LMGAQNIVTVKMIKNDIDPLIQRALETYENCA-----ADEDSTGEELYVPVRSYETRCMF 535
           LMGAQNIVTVKM+KNDI+PLI++AL TYENCA      D+ +T E + VPVRSYETRCM 
Sbjct: 453 LMGAQNIVTVKMLKNDINPLIEKALSTYENCATVLPETDKRNTDELIVVPVRSYETRCMI 512

Query: 536 LASELFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIRHKT 595
           LASELFLSLSDTWTSTPYA++ LETIL EC+LG CS+IMIWERLSDCY  R+DPRI+HK 
Sbjct: 513 LASELFLSLSDTWTSTPYAISYLETILVECKLGACSQIMIWERLSDCYELRVDPRIKHKA 572

Query: 596 SA----------------QGAKAMTDELAPDEESN-------EEIVTRGLTRKRKAAFFR 632
           +                 QG       L  ++ SN       ++IV++G TRKRKAAFFR
Sbjct: 573 AGTIANTSSPKKSSESDMQGHVMTPSPLTKEDVSNDANNDTDQDIVSKGFTRKRKAAFFR 632

Query: 633 LIAANKWVEQKQWKQAFWCLKEIEEAYAGLDFVNREDLILARLKRQMNEAQNNVDESSNQ 692
           L+AA KW EQK+W+Q  WCL+ I++ Y+ +   +R+DLIL ++       QN +  +  +
Sbjct: 633 LMAAKKWAEQKRWRQVSWCLQSIDDTYSKIGLADRDDLILKKI-------QNKLKTAETE 685

Query: 693 TVESGA 698
           T+++GA
Sbjct: 686 TIDAGA 691

>Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}
           complement(30871..32898) [2028 nt, 676 aa]
          Length = 675

 Score =  842 bits (2176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/685 (59%), Positives = 516/685 (75%), Gaps = 25/685 (3%)

Query: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60
           ++ SYENYMNL++HLD   E VP DI++RIVSNA++PVITV ST ELD+H++D+Y++DSL
Sbjct: 4   LQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSL 63

Query: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKS-SLKVPXXXXX 119
           Y+ +R+FG C+SDRDQANEY     K   E  A+     D +IE  R S +L++P     
Sbjct: 64  YLLMRYFGGCISDRDQANEYV---KKANVENTAQEGVN-DQIIEEQRNSNTLELPKSERY 119

Query: 120 XXXXXXXXXXXXXXXXXXXXXLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEV 179
                                LFQRD TQS Y+RFT+PI+DLI S DS+DMLFDYHSLEV
Sbjct: 120 SRSRSNS--------------LFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEV 165

Query: 180 FLENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDIS 239
           +LE  L L+++ T+D T  + LK SL+H+FFS AISSTTYLSPYE+FNHP++SL+A+DIS
Sbjct: 166 YLEKCLSLIDKNTNDETDHKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDIS 225

Query: 240 AGQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQL 299
            GQ YE+ARDLLIKFKN N+ VE FP FMST DIL VFLLCY+ +SE+++  CQ +  +L
Sbjct: 226 KGQNYEDARDLLIKFKNQNNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKL 285

Query: 300 KKQLFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYNI 359
           KKQLF ESL+LPLW +S+S+  +VELHQP MSSL+EMLYF + P+   LPL LIN  Y++
Sbjct: 286 KKQLFAESLMLPLWNKSHSEDVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDL 345

Query: 360 LEKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGKD 419
           +EKLV DLM+PFM+RKISFWEETILQPRKSLFHG   F+K M+++S+ + N Q  ++ KD
Sbjct: 346 MEKLVVDLMIPFMQRKISFWEETILQPRKSLFHGNKLFRKFMNRSSSQTAN-QYNNIVKD 404

Query: 420 KNGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVS 479
             GNEYF +SS EFL+RKLADWSMM+SDFKTAYSTYE+L+ DLE  PKYLASC EWCA+S
Sbjct: 405 SRGNEYFTSSSPEFLLRKLADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAIS 464

Query: 480 VLMGAQNIVTVKMIKNDIDPLIQRALETYENC---AADEDSTGEELYVPVRSYETRCMFL 536
           +LMGAQNIVT KMIKND++PLI+R+L+TYE C   A +     E L  PVRSYETRCM L
Sbjct: 465 ILMGAQNIVTAKMIKNDVNPLIERSLDTYEQCSILAQNSLENDELLSEPVRSYETRCMLL 524

Query: 537 ASELFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIRHKTS 596
            SELFLSL+DTWTSTPYAL++LETIL EC+LG CS+IMIWERLSDCY  R DPRIRH+  
Sbjct: 525 TSELFLSLNDTWTSTPYALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHR-- 582

Query: 597 AQGAKAMTDELAPDEESNEEIVTRGLTRKRKAAFFRLIAANKWVEQKQWKQAFWCLKEIE 656
            +    + +     +   ++IV++GL RKRKAAFFRL+AA KW EQKQW+Q  WCL+++E
Sbjct: 583 VETVTKIENNEGGQQLQTDDIVSKGLARKRKAAFFRLLAAKKWAEQKQWRQVSWCLRDVE 642

Query: 657 EAYAGLDFVNREDLILARLKRQMNE 681
             Y  L F  R +LI  +LK ++NE
Sbjct: 643 YIYDDLSFSKRPELIYQKLKDELNE 667

>NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {ON}
           Anc_8.255 YDR108W
          Length = 716

 Score =  837 bits (2163), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/711 (60%), Positives = 520/711 (73%), Gaps = 50/711 (7%)

Query: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60
           M  SYE+YMNLLFHLDH +E+VPP+IA+RIVSNA++PVITV+STP+LD HI++TY++DSL
Sbjct: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60

Query: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPXXXXXX 120
           YM LR+FG CVSDRDQANE   L  K+E ++    P+   N +     SSL VP      
Sbjct: 61  YMLLRYFGGCVSDRDQANE---LVGKQELDVTH--PTNPSNPV-----SSLIVPSGQQQP 110

Query: 121 XXXXXXXXXXXXXXXXXXXXLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180
                               LFQRD TQSQY+RFT+PIDD++    SNDMLFDYHSLE++
Sbjct: 111 PLKARRGRSRSNS-------LFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIY 163

Query: 181 LENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISA 240
           LE  L+L+   T+++TP+ELLK S+YH FFSLAISSTT LSPYETFNHP+VSLIA+DIS 
Sbjct: 164 LEQYLQLIATNTNNSTPYELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISM 223

Query: 241 GQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLK 300
           GQ Y++ RDLL++FKNLN T  NFPIFM+T D+LP+FLLCY+   +++   CQ L  +LK
Sbjct: 224 GQTYDDIRDLLVEFKNLNTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLK 283

Query: 301 KQLFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYNIL 360
           KQLFVESL+LPLW   Y    +V+LHQPIMSSLEEM+YFLQ+P   +L + LIN  YNIL
Sbjct: 284 KQLFVESLILPLWNEQYEIDIKVDLHQPIMSSLEEMIYFLQTPFSAKLSISLINSIYNIL 343

Query: 361 EKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGKDK 420
           + L+ DLM+PFMKRK+ FWEETILQPR+SLFHGA F KK M+KN+NG    Q   L KD 
Sbjct: 344 DSLIYDLMLPFMKRKLLFWEETILQPRRSLFHGAKFLKKFMTKNNNGP---QENILTKDS 400

Query: 421 NGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVSV 480
            GNEYF  SSTE LMRKLADWSMM+SDFKTAYSTYESL  DL+ FPKYLASC EWCA S+
Sbjct: 401 EGNEYFAFSSTELLMRKLADWSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSL 460

Query: 481 LMGAQNIVTVKMIKNDIDPLIQRALETYENCAAD--EDST----GEELYVPVRSYETRCM 534
           LMGAQ+IVTVKMIKNDI+PLI+RAL+TYENCA    +D+T     E+   P+RSYETRCM
Sbjct: 461 LMGAQSIVTVKMIKNDINPLIERALQTYENCAITLIQDTTNKVFAEQSVEPLRSYETRCM 520

Query: 535 FLASELFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIRHK 594
            L SELFLSLSDTWTSTPYA+  LETILTEC+LGPCS+I IWERLSDCY  RIDPRIR+K
Sbjct: 521 ILLSELFLSLSDTWTSTPYAITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYK 580

Query: 595 --------------------TSAQGAKAMTDELAPDEE----SNEEIVTRGLTRKRKAAF 630
                                +    K  T +   D E    S + I+++G TR+RK+AF
Sbjct: 581 INDTATTTTTVTTTTADKVVATPSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAF 640

Query: 631 FRLIAANKWVEQKQWKQAFWCLKEIEEAYAGLDFVNREDLILARLKRQMNE 681
           FRLIAA KW EQKQW+Q  WCLK++E  Y   D   R+DLI+A+L+  ++E
Sbjct: 641 FRLIAAKKWAEQKQWRQVAWCLKDMESIYDATDLGKRDDLIVAKLRNLLDE 691

>CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108w GSG1
          Length = 672

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/698 (55%), Positives = 503/698 (72%), Gaps = 38/698 (5%)

Query: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60
           M  SYE+YMNL++HLD   ETVP DIA+R+VSNA++PVITV+ST  LDRHI +TY +DSL
Sbjct: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60

Query: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSS--LKVPXXXX 118
           YM LRFFG CVSDRDQANE +         L  +     +  +EN +  +  L VP    
Sbjct: 61  YMLLRFFGGCVSDRDQANEVK---------LGTDGLKVTEEGVENEKDGTNGLTVPRQTR 111

Query: 119 XXXXXXXXXXXXXXXXXXXXXXLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLE 178
                                 L+QRD TQSQYVRFT+P+ DLI + D+NDMLFDYHSLE
Sbjct: 112 VRSNSNS---------------LYQRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLE 156

Query: 179 VFLENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDI 238
           V+L+  L +V++    + P  LLK S+YH FF+LAISST+ LSP+E FNHP+VSL+AIDI
Sbjct: 157 VYLQEYLSVVDKKFSPHIPHHLLKTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDI 216

Query: 239 SAGQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQ 298
           +  + YE A + L +FK++N+ + +FP F++T DILPVFLLCYN ++E E   CQ LA +
Sbjct: 217 TRNEDYETAAEQLKEFKSMNNNIPSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGK 276

Query: 299 LKKQLFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYN 358
           LKKQLFVES++LPLW   ++D+  V LHQP+MSS+EE+++FLQ+P   +LPL+L+N  Y+
Sbjct: 277 LKKQLFVESIILPLWSTEFTDNLVVSLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYD 336

Query: 359 ILEKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGK 418
            ++ +V DLM PFMKRK++FWEETIL PRKSLFHGA FFKK M+K++   +  QP SL K
Sbjct: 337 QIDMIVYDLMKPFMKRKMTFWEETILTPRKSLFHGAKFFKKFMNKSTQALS--QPNSLLK 394

Query: 419 DKNGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAV 478
           + +G+ Y  ++S EFLMRKLADWSMM+SDFKTAY+TYESL  D E  PKYLASC EWCAV
Sbjct: 395 ENHGSNYLSSTSPEFLMRKLADWSMMVSDFKTAYTTYESLCQDFERMPKYLASCSEWCAV 454

Query: 479 SVLMGAQNIVTVKMIKNDIDPLIQRALETYENCAADEDS-----TGEELYVPVRSYETRC 533
           S+LMGAQNIVT KM+KN+I+P I+RAL  YE CA + ++       ++L  PVRSYETRC
Sbjct: 455 SLLMGAQNIVTAKMLKNEINPAIERALGAYELCATESNAHRKFGDSDDLSAPVRSYETRC 514

Query: 534 MFLASELFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIRH 593
           MFLASELFLSLSDTWTSTP+A+  LETIL EC+LGP SEIMIWERLSDCY  RIDPRI+H
Sbjct: 515 MFLASELFLSLSDTWTSTPFAIAYLETILNECKLGPLSEIMIWERLSDCYGMRIDPRIKH 574

Query: 594 KTS-----AQGAKAMTDELAPDEESNEEIVTRGLTRKRKAAFFRLIAANKWVEQKQWKQA 648
           +        +  + M D    D  + E+I+++GLTR RKAA F+LIAA KW EQKQW++ 
Sbjct: 575 RIGNLELLQKKEENMDDPKNADVFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWREL 634

Query: 649 FWCLKEIEEAYAGLDFVNREDLILARLKRQMNEAQNNV 686
            WCL ++E  Y+ L   N+E+L+  RL+ ++  A+ ++
Sbjct: 635 SWCLDDLESTYSDLKCFNKENLLYTRLRNELIAARQDM 672

>KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa]
           {ON} Anc_8.255 YDR108W
          Length = 669

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/699 (57%), Positives = 505/699 (72%), Gaps = 53/699 (7%)

Query: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60
           +  SYE+YMNLLFHL+   E +P +IARRIVS+A++PVITV+STPELD+HI+DTY +DSL
Sbjct: 2   INFSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSL 61

Query: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPXXXXXX 120
           YM LRFFG CVSDRDQA+E     SK      +   +        SR +SL         
Sbjct: 62  YMLLRFFGGCVSDRDQASE-----SKANAPHSSSSLTTTKTTRARSRSNSL--------- 107

Query: 121 XXXXXXXXXXXXXXXXXXXXLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180
                                FQRD TQSQY+RFTRP+ DL+E  D NDMLFD+HSLE +
Sbjct: 108 ---------------------FQRDSTQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESY 146

Query: 181 LENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISA 240
           L   L LVE++T D+T  +LLKKSLYH FFSLAISSTT LSP+E+FNHP++SLIA+DI+ 
Sbjct: 147 LRQYLELVEKFTFDSTSHQLLKKSLYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITN 206

Query: 241 GQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLK 300
            Q YE+A+ LLIKFKNL++T++ FPI+++T D+LPVFLLCYN +S +E   C++L+ ++K
Sbjct: 207 SQSYEDAKGLLIKFKNLHNTIDKFPIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIK 266

Query: 301 KQLFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYNIL 360
           KQLFVES+ LPLWK SY     ++LHQP+MSSL+EM+YFLQS     LP++L N TY++L
Sbjct: 267 KQLFVESISLPLWKNSYQTEPFIKLHQPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDML 326

Query: 361 EKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGKDK 420
           EKLV  L++PFM+RKI+FWEET+LQP+KS+FHG+ F KKLMS+ S  S+  Q I L KD 
Sbjct: 327 EKLVYALLIPFMQRKIAFWEETVLQPKKSIFHGSKFLKKLMSRASTSSHQQQNI-LTKDH 385

Query: 421 NGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVSV 480
           +GNEYF +SS E L+RKLADWS+MLSDFKT Y+TYE L HDLE FPKYLASC EW AVS+
Sbjct: 386 DGNEYFASSSPELLLRKLADWSIMLSDFKTGYATYEILSHDLELFPKYLASCLEWEAVSL 445

Query: 481 LMGAQNIVTVKMIKNDIDPLIQRALETYENCAADEDSTGEEL--------YVPVRSYETR 532
           LMGAQNIVTVKM+KNDI PLI RAL+ Y+ CAA+   + +++          PV SYETR
Sbjct: 446 LMGAQNIVTVKMMKNDISPLIDRALDAYDACAANTHLSNKKIGPTNESTSLEPVLSYETR 505

Query: 533 CMFLASELFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIR 592
           C+ L+SELFLSLSDTWTSTPYA+N LE+IL E RLGPCS IMIWERLSDCY  R+DPRI+
Sbjct: 506 CLILSSELFLSLSDTWTSTPYAINYLESILEESRLGPCSRIMIWERLSDCYDLRVDPRIK 565

Query: 593 HKTSAQGAKAMTDELAPDEE---------SNEEIVTRGLTRKRKAAFFRLIAANKWVEQK 643
            K      +   +E A +E          +   IV++GLTRKRKAAFFRL+AA  W EQ 
Sbjct: 566 SKVEQVQKQDNLEEPADNEHRILNSQDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQG 625

Query: 644 QWKQAFWCLKEIEEAYAGLDFVNREDLILARLKRQMNEA 682
           QWKQ  WCL  I + Y+ +  VNR+DLIL RL+ + N A
Sbjct: 626 QWKQVKWCLDNITDIYSRVGLVNRDDLILTRLREEYNIA 664

>KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 708

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/744 (50%), Positives = 475/744 (63%), Gaps = 114/744 (15%)

Query: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60
           M LS+  YMNL FHLD   E VP +I+R+IVS+AVSPV+TV+ST  LD HI+++Y +DSL
Sbjct: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIVSSAVSPVVTVTSTAALDEHIQESYGVDSL 60

Query: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPXXXXXX 120
           YM LR+FGDCVSDRDQA        +  PEL  E     +    NS              
Sbjct: 61  YMLLRYFGDCVSDRDQA--------EAGPELGTESGKNRNRARSNS-------------- 98

Query: 121 XXXXXXXXXXXXXXXXXXXXLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180
                               LFQR    S Y+RFTRP+ DLI+  +S D+LFDYHSLEVF
Sbjct: 99  --------------------LFQRQA--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVF 136

Query: 181 LENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISA 240
           LE  L LVE  T  +TP  LL+ S+YHKFF+ AISST +LSPYE+FNHPV SL+A+DIS 
Sbjct: 137 LEKYLSLVEANTTSDTPHTLLQHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISK 196

Query: 241 GQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLK 300
            QGYEEARDLLI FKN+++T  +FP F++  DILPVFLLCY ++S ++   CQ L+  +K
Sbjct: 197 DQGYEEARDLLIAFKNMHNTTPHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIK 256

Query: 301 KQLFVESLLLPLWKRSYSDHGEVE--LHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYN 358
           KQLFVESLLLP W ++ +        LHQPIMSSLEE +Y +   +   LPL LIN  Y+
Sbjct: 257 KQLFVESLLLPCWGQNINAGASPSRILHQPIMSSLEETMYSMMKESTITLPLSLINYIYD 316

Query: 359 ILEKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKN-----SNGSNNHQP 413
            L  L+ +LM+PFMKRKISFW+E+ILQPRKS+F  + FF+KL+SK      ++ S  H  
Sbjct: 317 RLTNLIDELMIPFMKRKISFWDESILQPRKSIFPNSKFFRKLISKTPAPPPASDSATHS- 375

Query: 414 ISLGKDKNGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCF 473
                 + G  YF A+S EF++RKLADWS MLSDFK AYSTYE L  D E  P+YLASC 
Sbjct: 376 ------QQGVAYFAATSNEFILRKLADWSFMLSDFKNAYSTYELLSKDFEQRPEYLASCL 429

Query: 474 EWCAVSVLMGAQNIVTVKMIKNDIDPLIQRALETYENCA------------------ADE 515
           EWCA+SVLMGAQ+IVTVKMIKNDIDPLI RAL++YE  A                  A++
Sbjct: 430 EWCALSVLMGAQSIVTVKMIKNDIDPLINRALKSYELSARKAKEKNAQLKSSALAKKAEK 489

Query: 516 DS-------------TGEELYVPV--------RSYETRCMFLASELFLSLSDTWTSTPYA 554
           DS             +G+EL   V        +SYETRCM LA+ELFLSLSDTWT+TPYA
Sbjct: 490 DSKSATLPSTVSDEHSGQELDEGVSSAPSQSAQSYETRCMLLAAELFLSLSDTWTATPYA 549

Query: 555 LNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIRHK------TSAQGAKAMTDELA 608
           +  LETIL EC LG  SEI++WERL+ CY  R+DPR++ K       S Q  K   +   
Sbjct: 550 IKYLETILDECTLGSLSEIVLWERLAYCYALRVDPRVKGKLPSLDGQSGQNEKRGEESEG 609

Query: 609 PDEESNEE-----------IVTRGLTRKRKAAFFRLIAANKWVEQKQWKQAFWCLKEIEE 657
            DE  +E            + + GL R+RK+  FRLIA  KW E KQW+QA+W LK+IE 
Sbjct: 610 SDESDDETQKYDHKISQNCMASLGLARRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEV 669

Query: 658 AYAGLDFVNREDLILARLKRQMNE 681
            Y+ LDF NR+DLIL +L+++++E
Sbjct: 670 VYSELDFANRDDLILEKLRKKIHE 693

>TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {ON}
           Anc_8.255 YDR108W
          Length = 714

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/550 (60%), Positives = 413/550 (75%), Gaps = 12/550 (2%)

Query: 141 LFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVFLENTLRLVEEYTDDNTPFEL 200
           LFQRD TQSQ++RFTRPI+DL+ S  + DMLFDYH+LE+FL + L++VE+YT D+   + 
Sbjct: 164 LFQRDSTQSQFIRFTRPIEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKT 223

Query: 201 LKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISAGQGYEEARDLLIKFKNLNHT 260
           L+KSLYH+FFS AISST  LSPYE+FNHP+VSLIAIDI+ GQ YE ARDLLI FKN N T
Sbjct: 224 LQKSLYHRFFSSAISSTNCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTT 283

Query: 261 VENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLKKQLFVESLLLPLWKRSYSDH 320
           + NFPIFMST DILPVF+LCYN  S +E     +L+ ++KKQLF E + +PLW + YSD 
Sbjct: 284 INNFPIFMSTNDILPVFVLCYNGSSAEESEKSTELSKKIKKQLFAECIRMPLWDKRYSDD 343

Query: 321 GEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYNILEKLVKDLMVPFMKRKISFWE 380
             V+LHQP MSSL+EMLY  Q+    +LPL LIN+ Y+ LE L  DLM+PFM+RKI+FWE
Sbjct: 344 ITVKLHQPAMSSLDEMLYVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWE 403

Query: 381 ETILQPRKSLFHGANFFKKLMSKNS--NGSNNHQPISLGKDKNGNEYFVASSTEFLMRKL 438
           ETILQP+KSLF G   F+K M + S  NG   + PI   KD  GNEYF ++S  FL+RKL
Sbjct: 404 ETILQPKKSLFQGTKLFRKFMGRPSMTNGRQENIPI---KDNQGNEYFASTSNVFLLRKL 460

Query: 439 ADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVSVLMGAQNIVTVKMIKNDID 498
           ADWSMM+SDFKTAY+T+ESL+ D+E +PKYLASC EWCAV +LMGAQNIVT KMIKND++
Sbjct: 461 ADWSMMISDFKTAYTTFESLLEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVN 520

Query: 499 PLIQRALETYENCAADEDSTGEELYV----PVRSYETRCMFLASELFLSLSDTWTSTPYA 554
           PLI+R+L+ Y NCA   +S  E        PVRSYETRCM + SELFLSLSDTWTSTPYA
Sbjct: 521 PLIERSLDVYGNCALLLNSIAESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYA 580

Query: 555 LNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIRHKTSAQGAKAMTDELAP---DE 611
           L++LETIL+EC+LG CS+IMIWERLSDCY  R DPR++HK  +  + +   E++     +
Sbjct: 581 LSNLETILSECKLGACSQIMIWERLSDCYNLRTDPRVKHKLRSNISTSSVSEVSEEEIKK 640

Query: 612 ESNEEIVTRGLTRKRKAAFFRLIAANKWVEQKQWKQAFWCLKEIEEAYAGLDFVNREDLI 671
           +    IV +GLTR+RKA+FFRL+AA KW EQ QW+Q  WCL +I E Y    F  RE LI
Sbjct: 641 QDVSSIVLKGLTRQRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLI 700

Query: 672 LARLKRQMNE 681
             +LKR + E
Sbjct: 701 YQKLKRNLLE 710

 Score =  120 bits (300), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 51/80 (63%), Positives = 64/80 (80%)

Query: 1  MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60
          M  +YENYMNL+FHLD   E VP DI++RIVSNA++PVITV++T ELD HI + Y +DS 
Sbjct: 1  MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60

Query: 61 YMFLRFFGDCVSDRDQANEY 80
          Y  LR+FG C+SDRDQ+NEY
Sbjct: 61 YTLLRYFGGCISDRDQSNEY 80

>Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108W
           (GSG1) - involved in meiosis [contig 176] FULL
          Length = 700

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/741 (50%), Positives = 473/741 (63%), Gaps = 106/741 (14%)

Query: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60
           M LSYE YMNL+ HLD   E VP +I+R+IVSNAVSPV+TV+S+  LD+HI+++Y LDSL
Sbjct: 1   MPLSYERYMNLVSHLDSASEPVPSEISRKIVSNAVSPVVTVTSSAALDKHIQESYGLDSL 60

Query: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPXXXXXX 120
           YM LR+FGDC+SDRDQA+  Q   S  EP       S+A      SR  SL         
Sbjct: 61  YMLLRYFGDCISDRDQADSEQ--ESGVEPN-----KSRA-----RSRSGSL--------- 99

Query: 121 XXXXXXXXXXXXXXXXXXXXLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180
                                FQR    SQ++RFTRP+ D+I + ++ D+LFDYHSLEVF
Sbjct: 100 ---------------------FQRQA--SQFLRFTRPLSDIIGTRETRDLLFDYHSLEVF 136

Query: 181 LENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISA 240
           L+  L LV+  T  +TP  LL+ S+YHKFF+ AISST +LSPYE FNHPV SL+A+DIS 
Sbjct: 137 LQKYLELVDVKTSPDTPHTLLQHSIYHKFFTTAISSTAHLSPYECFNHPVCSLLALDISQ 196

Query: 241 GQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLK 300
            +GYE+ARDLL+ FKN+++   +FP F++  DILPVFLLCY + S ++   CQ LA  +K
Sbjct: 197 NEGYEDARDLLVTFKNMHNKTPHFPSFINVNDILPVFLLCYEEGSREQFETCQSLAKMMK 256

Query: 301 KQLFVESLLLPLWKRSYS--DHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYN 358
           KQLFVESLLLP W  +++  D     LHQPIMSSLEE ++ +   +   LPL  I   Y+
Sbjct: 257 KQLFVESLLLPCWSVNFTAKDTPTRVLHQPIMSSLEETMFSMLKDSAFDLPLPFIEHIYD 316

Query: 359 ILEKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGK 418
            L KLV +LM+PFMKRKISFWEE+ILQPR+S+F  + FF+KL+SK    S N+   S   
Sbjct: 317 RLTKLVDELMIPFMKRKISFWEESILQPRRSIFPNSKFFRKLISKAPTPSTNND--SATH 374

Query: 419 DKNGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAV 478
            + G  YF A+S E L+RKLADWS MLSDFKTAYSTYE L  D E  P+YLA C EWCA+
Sbjct: 375 SEQGLAYFAATSNELLLRKLADWSFMLSDFKTAYSTYELLSKDFEQHPEYLAPCLEWCAL 434

Query: 479 SVLMGAQNIVTVKMIKNDIDPLIQRALETYENCAA------------------------- 513
           SVLMGAQ+IVTVKMIKNDIDPLI RAL++YE CA+                         
Sbjct: 435 SVLMGAQSIVTVKMIKNDIDPLITRALKSYELCASKAKERNGLLKSKLQNRDHDKSLNGF 494

Query: 514 -------DEDSTGEELY----VP---VRSYETRCMFLASELFLSLSDTWTSTPYALNSLE 559
                  D+  +G   +     P    +SYETRCM LA+ELFLSLSDTWT+TPYA+  LE
Sbjct: 495 ETISNSHDDRVSGTTDFEISSTPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLE 554

Query: 560 TILTECRLGPCSEIMIWERLSDCYYQRIDPRIRHKTSA-------QGAKAMTDELAPDEE 612
           TIL +C +G  SEI+IWERL+ CY  R+DPR++ + +A       Q  K   +    D +
Sbjct: 555 TILDQCTVGALSEIVIWERLAYCYALRVDPRVKSRLTASEIQSSDQNEKLDEESEGSDND 614

Query: 613 SNEE------------IVTRGLTRKRKAAFFRLIAANKWVEQKQWKQAFWCLKEIEEAYA 660
           S +E            I + GLTRKRKA  FRLIA  KW E KQW+QA W  +++E  Y+
Sbjct: 615 SGDESQVCQHKMSQSCIASSGLTRKRKATLFRLIATKKWTESKQWRQACWSFQDLEVMYS 674

Query: 661 GLDFVNREDLILARLKRQMNE 681
            L F NREDLIL +L++++ +
Sbjct: 675 HLVFANREDLILKKLEKRIAQ 695

>SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 719

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/763 (49%), Positives = 474/763 (62%), Gaps = 142/763 (18%)

Query: 1   MKLSYENYMNLLFHLDHGQE--TVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLD 58
           M LSYENYMNLL+H+DH  E  TV  ++A++IVSNAVSPV+ V+ST  LD H+++ Y L 
Sbjct: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIVSNAVSPVVAVTSTSLLDSHLQEAYGLH 60

Query: 59  SLYMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPXXXX 118
           S+YM LRFFGDCV+DRDQ NE        E      P S +                   
Sbjct: 61  SMYMLLRFFGDCVTDRDQENE-------TETNFKGRPRSNS------------------- 94

Query: 119 XXXXXXXXXXXXXXXXXXXXXXLFQRDQTQSQYVRFTRPIDDLIESSDSN-DMLFDYHSL 177
                                 LFQR+   S +VRFTRP+ DL++   S+  MLFDYHSL
Sbjct: 95  ----------------------LFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSL 130

Query: 178 EVFLENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAID 237
           E+FL+  LRLV+     NTP  LLK S+YHKFF+ AISST YLSPYE+FNHPV+SL+A+D
Sbjct: 131 ELFLDKYLRLVDHRVSANTPHRLLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALD 190

Query: 238 ISAGQGYEEARDLLIKFKNLN---HTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQ 294
           IS G  YE ARDLLI+FKN+N    +  +FP F++  DILPVFLLCYND S ++  ACQ 
Sbjct: 191 ISRGDTYENARDLLIRFKNMNSATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQS 250

Query: 295 LANQLKKQLFVESLLLPLWKRSYSDHGEVE----LHQPIMSSLEEMLYFLQSPTPTR--- 347
           LA  LKKQLFVES+LLPLW+ S  D+   E    LH PIMSSLEEMLYFL    P +   
Sbjct: 251 LAKMLKKQLFVESILLPLWRDS-EDYDAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNI 309

Query: 348 -------------LPLQLINVTYNILEKLVKDLMVPFMKRKISFWEETILQPRKSLFHGA 394
                        LPL L+   Y+ L  L+ +LM+PFMKRKISFWEETILQPRKS+F  A
Sbjct: 310 SYTGSSNPISSFELPLALVETIYDRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNA 369

Query: 395 NFFKKLMSKNSNGSNNHQPISLGKDK--NGNEYFVASSTEFLMRKLADWSMMLSDFKTAY 452
            F ++ +SK++  +    PI+   D     + +F ASS EFL+RKLADWS MLSD++TAY
Sbjct: 370 KFLRRFVSKSAPATPA-APINSKSDGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAY 428

Query: 453 STYESLVHDLENFPKYLASCFEWCAVSVLMGAQNIVTVKMIKNDIDPLIQRALETYENCA 512
           +TY++L  DLE+  +YLA C EWCAVSVLMGAQ+IVTVKMIKNDIDPLI ++L+ YE CA
Sbjct: 429 ATYDTLSKDLEHHLEYLAPCLEWCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCA 488

Query: 513 --------ADEDSTGEELYVPVRSYETRCMFLASELFLSLSDTWTSTPYALNSLETILTE 564
                   A+ DS  +    P +SYETRCM L++ELFLSLSDTWT+TPYA+  LETIL  
Sbjct: 489 SKLTSPHVAEADSPVDS--KPAQSYETRCMLLSAELFLSLSDTWTATPYAIKYLETILQN 546

Query: 565 CRLGPCSEIMIWERLSDCYYQRIDPRIRH------------------------------- 593
           C LGP S++++WE+L+ CY  R+DPR+ H                               
Sbjct: 547 CPLGPKSQVLLWEKLAYCYELRVDPRVSHIHAKQRHLQYEREEVISKSNERAPQHHSESH 606

Query: 594 ------KTSAQGAKAMTDE---------------LAPDEESNEEIVTRGLTRKRKAAFFR 632
                 +T  Q  ++ TD                + P++   ++I   GLTR+RKAAFFR
Sbjct: 607 FSTEKNQTGNQEEQSDTDSKDEALSNREKEHADFVNPNKLPYKDIALLGLTRRRKAAFFR 666

Query: 633 LIAANKWVEQKQWKQAFWCLKEIEEAYAGLDFVNREDLILARL 675
           LIAANKW EQKQWKQA W L++++  Y+GL F  R+ LIL RL
Sbjct: 667 LIAANKWCEQKQWKQASWLLRDVDTVYSGLVFSYRKGLILERL 709

>KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {ON}
           Anc_8.255 YDR108W
          Length = 648

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/717 (46%), Positives = 438/717 (61%), Gaps = 112/717 (15%)

Query: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60
           M  SYE+YMNLL HL+   ETVPPDIARRIVS+AV+PVITV+S+  LD HI ++Y + S 
Sbjct: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60

Query: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPXXXXXX 120
           Y+  R FG C+SDRDQ  E+  L                      +RK S          
Sbjct: 61  YLLFRLFGGCISDRDQLMEHYTLDDSSTGG--------------RTRKRS---------- 96

Query: 121 XXXXXXXXXXXXXXXXXXXXLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180
                               LFQRD TQSQ++RF +P+ DL+ S      LFD  SLE +
Sbjct: 97  ------------------NSLFQRDATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWY 138

Query: 181 LENTLRLVEEYT-----------DDNTP-----------FELLKKSLYHKFFSLAISSTT 218
           L + L  +++ T           D+ TP            +LL+ ++YH FF+LA+SSTT
Sbjct: 139 LTHYLSWIQKLTATDPEKVEQLPDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTT 198

Query: 219 YLSPYETFNHPVVSLIAIDISAGQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFL 278
            +SP+ETFN PV++LIAID+S GQ YE  RDL+  FKNLN  +E+FP+F++  DILP+ +
Sbjct: 199 RISPFETFNVPVMNLIAIDVSRGQDYEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMIV 258

Query: 279 LCYNDESEDEQNACQQLANQLKKQLFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLY 338
           LCY+   E +   C+QL  ++KK LFV+S+ L LW     +   V LH+PIMSSL+E++ 
Sbjct: 259 LCYDAADETQLATCEQLQRKIKKCLFVDSIPLALWDED-PESPLVPLHEPIMSSLDEIVK 317

Query: 339 FLQSPTP-------------TRLPLQLINVTYNILEKLVKDLMVPFMKRKISFWEETILQ 385
           F  S +                LPL +I   Y  L+ LV ++++PFM RK  +WEE ILQ
Sbjct: 318 FYSSNSSAGGDEVGTDGHSRAALPLNIITHMYQALDVLVDEMLIPFMHRKTKYWEENILQ 377

Query: 386 PRKSLFHGA-NFFKKLMSKNSNGSNNHQPISLGKDKNGNEYFVASSTEFLMRKLADWSMM 444
           PRKS+FHG+ NFFKK + K +            +D +  ++F ASSTE L+RKLADWS+M
Sbjct: 378 PRKSIFHGSNNFFKKFIGKTTT----------QRDPSDTQFFPASSTECLLRKLADWSLM 427

Query: 445 LSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVSVLMGAQNIVTVKMIKNDIDPLIQRA 504
           LSDFKTAY TY+SL +DL+N P YLASC EWCAVS+L+GAQNIVTVKMIK +I PLI+RA
Sbjct: 428 LSDFKTAYLTYDSLSNDLQNSPNYLASCLEWCAVSLLLGAQNIVTVKMIKTEITPLIERA 487

Query: 505 LETYENCAADEDSTGEELYVPVRSYETRCMFLASELFLSLSDTWTSTPYALNSLETILTE 564
           + TY                   SYETRCM L++ELFL+L DTWTSTPYA+  LETIL +
Sbjct: 488 VATYRQQGRS-------------SYETRCMILSAELFLALRDTWTSTPYAIRYLETILRD 534

Query: 565 C-RLGPCSEIMIWERLSDCYYQRIDPRIRHKTSAQGAKAMTDELAPDE-ESNEEIVTRGL 622
           C +LG CS++MIWERLSDCY  R DPR+        A A++   +P   +   EI+ +G 
Sbjct: 535 CPQLGACSQVMIWERLSDCYQSRTDPRV--------ASALSTNTSPGSAQPGNEILAQGF 586

Query: 623 TRKRKAAFFRLIAANKWVEQKQWKQAFWCLKEIEEAYAGLDFVNREDLILARLKRQM 679
           TRKRKAAFFRLIAA KW EQ QW+Q  WCL +I++ Y      +++ L++ RL  ++
Sbjct: 587 TRKRKAAFFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNTEV 643

>TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON}
           Anc_8.255 YDR108W
          Length = 889

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/634 (48%), Positives = 414/634 (65%), Gaps = 89/634 (14%)

Query: 141 LFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVFLENTLRLVEEYTDDNTPFEL 200
           LFQRD TQSQY+RFT+PI DL+ + D  D LFD+ SLE  L+  L+++E  T  + P   
Sbjct: 191 LFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIETNTTPDMPHNA 250

Query: 201 LKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISAGQGYEEARDLLIKFKNLNHT 260
           LKKSLYH+FFS+ ++STT L P+E+F+HP+VSL++ID++  Q Y+ A+++LIKFKN++  
Sbjct: 251 LKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEMLIKFKNIHSK 310

Query: 261 VENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLKKQLFVESLLLPLWK-RSYSD 319
             NFP++++  DILPVFLLCY+  S ++ +  ++++ ++KKQLF ES+LLPLW  + Y++
Sbjct: 311 TPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILLPLWNDKIYNN 370

Query: 320 HGEVELHQPIMSSLEEMLYFLQS-------PTPTRLPLQLINVTYNILEKLVKDLMVPFM 372
              V+LH+P+MSS++E LYFLQ         T  +LPL L+   Y ++  L  +L++PFM
Sbjct: 371 DKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIANLSVNLIIPFM 430

Query: 373 KRKISFWEETILQPRKSLFHGANFFKKLMSKN--------------SNGSNNHQPISLGK 418
           +RKI FW+ETILQPRKS+F     FK  M++N              SN  + H    L K
Sbjct: 431 QRKIRFWDETILQPRKSIFRNK-LFKSFMNRNSNVSSSTGTSSSEISNSISKHHHSLLTK 489

Query: 419 DKNGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAV 478
           D NG+EYF A STEF +RKLADWSMM+SDFKTAY+TYESL  DLEN  KY+ASC EW AV
Sbjct: 490 DSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKYMASCLEWWAV 549

Query: 479 SVLMGAQNIVTVKMIKNDIDPLIQRALETYEN--------------------CAADEDST 518
           S+LMGAQNIVT KM+KND+DPLI+ ALE+YE                      ++   +T
Sbjct: 550 SILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVPNSRLPSNNINSLNSRSSISSAT 609

Query: 519 GEELYV-----PVRSYETRCMFLASELFLSLSDTWTSTPYALNSLETILTECRLGPCSEI 573
             E+ +      +RSYE RCM L SELFLSLSDTWTSTPYAL  LETIL++ +LGPCS+ 
Sbjct: 610 KAEVSLIENNHTIRSYEIRCMLLLSELFLSLSDTWTSTPYALRYLETILSDYKLGPCSQT 669

Query: 574 MIWERLSDCYYQRIDPRIRHK---------TSAQGAKA---------------------- 602
           ++WERLS CY  R+DPRI+ K         T A G++A                      
Sbjct: 670 ILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEKYRNDGKQEKYS 729

Query: 603 --MTDELAPDEESNEE------IVTRGLTRKRKAAFFRLIAANKWVEQKQWKQAFWCLKE 654
               + L  D  SNEE      I++ G TRKRKAAFF+LIAA KW EQKQW+Q  WCLK+
Sbjct: 730 IDRKNSLIIDVNSNEEYDCGYDILSDGFTRKRKAAFFKLIAAKKWSEQKQWRQLDWCLKD 789

Query: 655 IEEAYAGLDFVNREDLILARLKRQMNE--AQNNV 686
           IE  Y  + F +R+DLIL +LK Q+N+   +NN+
Sbjct: 790 IENVYKEVGFSDRKDLILIKLKDQLNKYYIKNNI 823

 Score =  122 bits (307), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 68/79 (86%)

Query: 1  MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60
          M  SYENYMNLLFHLD   E +P DIA+RIV N+++P+I+V++TPELD+H++D+Y++DSL
Sbjct: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60

Query: 61 YMFLRFFGDCVSDRDQANE 79
          YM LR+FG C+SDRDQ +E
Sbjct: 61 YMLLRYFGGCISDRDQYHE 79

>Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}
           similar to Ashbya gossypii AGR096C
          Length = 623

 Score =  509 bits (1312), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 287/689 (41%), Positives = 418/689 (60%), Gaps = 77/689 (11%)

Query: 3   LSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSLYM 62
           LSYE YMNLL + D   + VP +I+R+++ NA+SP I+V ST  L++H+ + + + SLY 
Sbjct: 2   LSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLYK 61

Query: 63  FLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPXXXXXXXX 122
            LR+FGD + DRDQ ++   + +K +P               N+R+              
Sbjct: 62  LLRYFGDYIQDRDQLDD--KISAKLQP---------------NNRRQR------------ 92

Query: 123 XXXXXXXXXXXXXXXXXXLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVFLE 182
                             LFQR+   S+Y+RF  P+ D+I   D++ +  +++ LE  L 
Sbjct: 93  ---------------QNSLFQRNS--SRYIRFQTPLTDIISVGDNHQV--EFNDLEESLS 133

Query: 183 NTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISAGQ 242
             L+ +EE+T +++P ELLK S++HKF ++ +SSTT LSPY +FNHP+++L+A+DI+ G+
Sbjct: 134 EFLKDIEEHTVNDSPCELLKHSIFHKFITM-LSSTT-LSPYHSFNHPILALLALDITQGE 191

Query: 243 GYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLKKQ 302
            YE AR+LL++FKNL +T+  FP F++T D+LPVF+LC++  S  +    Q L   +KKQ
Sbjct: 192 EYELARELLMEFKNLPNTLSKFPAFINTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQ 251

Query: 303 LFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYNILEK 362
           LFVES+ LP++  ++ D   V LH PI +SL+E LY    P   +L  +L+ + Y+ +  
Sbjct: 252 LFVESVPLPIFT-NFRDRSIV-LHPPITNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINS 309

Query: 363 LVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGKDKNG 422
           +V+DLM+PFM RKISFW+ETILQPRKS+FH     K+ +SK+S       P S       
Sbjct: 310 MVEDLMIPFMNRKISFWDETILQPRKSIFHSNKLLKRFISKSSGSPTASMPTS------P 363

Query: 423 NEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVSVLM 482
           + +F+ASS EFL+RKLADW  MLSD+KTAYS YE L+ D EN+P Y++SC E+ A+S+LM
Sbjct: 364 DGHFLASSNEFLLRKLADWCFMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLM 423

Query: 483 GAQNIVTVKMIKNDIDPLIQRALETYENCAADEDSTGEELYVPVRSYETRCMFLASELFL 542
           GA +IVT KMIKNDIDPLI + L+   N     D             + RCM   +ELFL
Sbjct: 424 GAHSIVTAKMIKNDIDPLIMKYLDYAVNNIISLD-------------QIRCMIYMTELFL 470

Query: 543 SLSDTWTSTPYALNSLETILTE--CRLGPCSEIMIWERLSDCYYQRIDPRIR--HKTSAQ 598
           SLSDTWTS P+A+  LE IL +   +LGP    +IWER+S  Y  RIDPRI     +++ 
Sbjct: 471 SLSDTWTSAPFAIKYLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIHADDDSTSD 530

Query: 599 GAKAMTDE--LAPDEESNEEIVTRGLTRKRKAAFFRLIAANKWVEQKQWKQAFWCLKEIE 656
               + +E  L P +    +I  +G TR RK A F+L+AA KW++  Q +Q  W LK   
Sbjct: 531 CDHDLEEELYLNPHKLHCGKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCN 590

Query: 657 EAYAGLDFVNREDLILARLKRQMNEAQNN 685
             Y  L F N E  +L+RL   + +++N+
Sbjct: 591 RVYRDLPFANAEGTLLSRLADAVVDSENS 619

>AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR108W
           (GSG1)
          Length = 623

 Score =  496 bits (1277), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 283/681 (41%), Positives = 403/681 (59%), Gaps = 86/681 (12%)

Query: 3   LSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSLYM 62
           LSYE YMNL+ + +H  + VP +I+RR++ NA+SP ++V ST  L+ H+ + +   SLYM
Sbjct: 2   LSYETYMNLVHYPEHWSQPVPHEISRRVICNALSPCVSVQSTAALEAHLAEEFSEGSLYM 61

Query: 63  FLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPXXXXXXXX 122
            LR+F D V  R++  E   +  +  P  V                              
Sbjct: 62  LLRYFADYV--RERGEEVGSVSGQRRPGSV------------------------------ 89

Query: 123 XXXXXXXXXXXXXXXXXXLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVFLE 182
                              +QR QT S+YVRF RP++++IE+ +   +  D+  LE  L 
Sbjct: 90  -------------------YQR-QT-SRYVRFQRPLEEVIETVEQQAV--DFEDLEEALG 126

Query: 183 NTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISAGQ 242
             LR +E  T + +P ELLK S++HKF ++   S+T LSPY T NHP+++L+A+D++ G+
Sbjct: 127 QHLRDIEARTTNESPSELLKHSIFHKFITML--SSTALSPYHTVNHPIMALLALDVTQGE 184

Query: 243 GYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLKKQ 302
            Y  AR+LL++FKNL      FP +++T D+LPVF+LC+++ S ++    Q L   +KKQ
Sbjct: 185 EYTLARELLVQFKNLPSKSSKFPSYINTNDVLPVFILCFDESSSEQWETVQALQKAIKKQ 244

Query: 303 LFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYNILEK 362
           LFVES+ LP++    SD   V LH PI +SL+E +Y    P   RL  QL++V Y  +  
Sbjct: 245 LFVESVPLPIFTNYESD--PVVLHPPITNSLQEQVYDGSHPPLLRLCPQLVDVIYETINA 302

Query: 363 LVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGKDKNG 422
           +V+DLM+PFM RKISFW+ETILQPRKS+FHG  F K+ M+K ++ +      +L    +G
Sbjct: 303 MVEDLMIPFMNRKISFWDETILQPRKSIFHGNKFLKRFMNKTNSSAAG----TLSTSSDG 358

Query: 423 NEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVSVLM 482
             YF+ASS EFL+RKLADWS MLSD+KTAYS Y  L+ D E +P+YL+SC E+ A+S+LM
Sbjct: 359 --YFLASSNEFLLRKLADWSFMLSDYKTAYSIYYILLRDFELYPQYLSSCQEFSALSLLM 416

Query: 483 GAQNIVTVKMIKNDIDPLIQRALETYENCAADEDSTGEELYVPVRSYETRCMFLASELFL 542
           GA +IVT KMIKNDIDPLI + +++     A  +  G          + RC+   +ELFL
Sbjct: 417 GAHSIVTTKMIKNDIDPLIMKYMDS---TVASLNYLG----------KFRCLVYMAELFL 463

Query: 543 SLSDTWTSTPYALNSLETILT--ECRLGPCSEIMIWERLSDCYYQRIDPRIRHKTS--AQ 598
           SLSDTWTS P+A+  LE IL   + +LGP S  M+WER+S  Y  RIDPRI       + 
Sbjct: 464 SLSDTWTSAPFAIKYLELILQNEQLKLGPLSRTMLWERISYAYQLRIDPRIHTDDEYLSD 523

Query: 599 GAKAMTDE----LAPDEESNEEIVTRGLTRKRKAAFFRLIAANKWVEQKQWKQAFWCLKE 654
               +T E    + P++  +  I + GLTR RK A FRL+AA KW+E    +Q  W LK 
Sbjct: 524 NFMELTTEDDFCMNPNKLHHWRIHSLGLTRHRKEAVFRLLAAKKWLEYGHIRQGAWSLKG 583

Query: 655 IEEAYAGLDFVNREDLILARL 675
             + Y  L F N +  +L+RL
Sbjct: 584 CNKVYRNLGFANADGTLLSRL 604

>KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} similar
           to uniprot|P46944 Saccharomyces cerevisiae YDR108W GSG1
           Subunit of TRAPP (transport protein particle) a
           multi-subunit complex involved in targeting and/or
           fusion of ER-to-Golgi transport vesicles with their
           acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 647

 Score =  470 bits (1209), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 272/704 (38%), Positives = 401/704 (56%), Gaps = 83/704 (11%)

Query: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60
           ++ SYE YMNL+ + +H    +P +I+++++ N +SP I V S  ELD H++D Y++DS+
Sbjct: 3   LQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSI 62

Query: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPXXXXXX 120
            M  R+FGD + DRDQ      L+   +P  V+    ++D+L                  
Sbjct: 63  SMLFRYFGDYIQDRDQIPSTTDLK---DPGSVSSGRHRSDSL------------------ 101

Query: 121 XXXXXXXXXXXXXXXXXXXXLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180
                                FQR    S+ VRFTR ++DLI S DS D +     ++ F
Sbjct: 102 ---------------------FQRQA--SECVRFTRSLEDLI-SIDSEDHILQSTDIDSF 137

Query: 181 LENTLRLVEEYTDDN-TPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDIS 239
           L   L+ +E   ++N TP +LLK S+YH+FF + +SS   LS Y +F+HPVV+L+ +DI+
Sbjct: 138 LSQYLQNLEPIMNENGTPSKLLKHSIYHRFF-ITLSSIN-LSRYHSFHHPVVALLPLDIT 195

Query: 240 AGQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQL 299
            GQGYE AR++LI FKNLN+T+ENFP F++  DILPVF+LCY++ S ++  + Q L   L
Sbjct: 196 KGQGYENAREILIHFKNLNNTLENFPEFININDILPVFVLCYDENSREQWESVQALTKSL 255

Query: 300 KKQLFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYNI 359
           KKQLFVES+ + L+   + +     LH PI  SL E ++ +  PT   +P +L+   Y+ 
Sbjct: 256 KKQLFVESVSISLFT-PHDNQKSTTLHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDT 314

Query: 360 LEKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGKD 419
           +  +V+++M+PFM RK+ FW+ET+LQPRKS+F    FF++ +S  SN    H+       
Sbjct: 315 ISFIVEEMMIPFMHRKLVFWDETVLQPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDP 374

Query: 420 KNGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVS 479
             G+  F ASS EFL+RKLADWS MLSDFK AYS Y+ L  D E++P+YLA C E+  +S
Sbjct: 375 AEGDIMFPASSPEFLLRKLADWSFMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTIS 434

Query: 480 VLMGAQNIVTVKMIKNDIDPLIQRALETYENCAADEDSTGEELYVPVRSYETRCMFLASE 539
           +LMGAQNI+T K IK ++DPL+ RA+E Y+    DE  +   ++         C+   S+
Sbjct: 435 LLMGAQNIITAKTIKTEVDPLMTRAIEQYKK--QDEKHSLRVIH---------CILTFSD 483

Query: 540 LFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIR------- 592
           L LSLSDTW S+P A+N L  I     LGP + ++I ER++  Y   ID R+        
Sbjct: 484 LLLSLSDTWVSSPLAVNYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKP 543

Query: 593 -------HKTSAQGAKAMTDELAPD---EESNE------EIVTRGLTRKRKAAFFRLIAA 636
                     +A+ +K   + L  D   E  NE       + + GLTR RK + ++L+AA
Sbjct: 544 DEENKADESEAAENSKKGENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAA 603

Query: 637 NKWVEQKQWKQAFWCLKEIEEAYAGLDFVNREDLILARLKRQMN 680
            KWVE  +  QA WC+     AY  L    R D +  RL  +++
Sbjct: 604 KKWVELHKRNQAKWCIYHAAPAYEKLSLSKRPDGLFHRLSMELS 647

>TBLA0I02900 Chr9 complement(687092..692476) [5385 bp, 1794 aa] {ON}
           Anc_4.238 YDL058W
          Length = 1794

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 42/96 (43%), Gaps = 23/96 (23%)

Query: 463 ENFPKYLASCFEWCAVSVLMGAQNIVTVKMIKNDIDPLIQRALETYENCAADEDSTGEEL 522
           ENF +    C         +GA++ +T++ +KND+D L     E++EN   D        
Sbjct: 758 ENFEQIQEECKALKQEINTLGAESQLTIEKLKNDLDALK----ESHENVTTD-------- 805

Query: 523 YVPVRSYETRCMFLASELFLSLSDTWTSTPYALNSL 558
                 +ET     A E +LS+SD +  T   L  L
Sbjct: 806 ------FET-----AKEEYLSVSDNYNKTQKELKDL 830

>Kpol_1011.2 s1011 complement(2303..4057) [1755 bp, 584 aa] {ON}
           complement(2303..4057) [1755 nt, 585 aa]
          Length = 584

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 56/112 (50%), Gaps = 8/112 (7%)

Query: 145 DQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVFLENTLRLVEEYTDDNTPFELLKKS 204
           D+ + QY+   + + +L E      +L DY   E   ++ L +V+E T D  P E  ++ 
Sbjct: 264 DEDKEQYIGLKKNVVNLTEKIKR--VLSDYKENE--FKDDLIIVKEQTVD--PLEKKRRD 317

Query: 205 LYHKFFSLAISSTTYLSPYETFNHPV--VSLIAIDISAGQGYEEARDLLIKF 254
           +Y ++FS+  S   +++ +ET+   +     I  +I   +  E+ +DL+ K 
Sbjct: 318 IYKEYFSVKESFLEFINKFETYKELLDKREKIKQEIKDRRAKEQQKDLIPKL 369

>KNAG0G01900 Chr7 complement(423975..430367) [6393 bp, 2130 aa] {ON}
            Anc_8.238 YER172C
          Length = 2130

 Score = 31.6 bits (70), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 32/74 (43%), Gaps = 8/74 (10%)

Query: 588  DPRIRHKTSAQGAKAMTDELAPDEESNEEIVTRGLTRKRKAAFFRLIAANKWVEQKQWKQ 647
            D  I  K   QG + + D +A D+E  E I+   L  KR A   + I     VE      
Sbjct: 2026 DNEILKKCKEQGVETVYDVMALDDEERESIIQ--LENKRLATLAQFINNYPNVE------ 2077

Query: 648  AFWCLKEIEEAYAG 661
              W +K IEE  AG
Sbjct: 2078 LTWKMKSIEEVKAG 2091

>TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.335
           YDR153C
          Length = 385

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 6/72 (8%)

Query: 273 ILPVFLLCYNDESEDEQNACQQLANQLKKQLFVESLLLPLWKRSYSDHGEVELH-QPIMS 331
           IL   LL  ND  E      QQ+ + LKK   + +     +K  +S+ G++E+H Q I +
Sbjct: 111 ILDFLLLNVNDGDE-----LQQITSCLKKHKHILNKETMNYKIQFSNDGKMEIHEQSIRT 165

Query: 332 SLEEMLYFLQSP 343
             E +L +L  P
Sbjct: 166 KCEVILSYLSEP 177

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,454,223
Number of extensions: 3337501
Number of successful extensions: 11929
Number of sequences better than 10.0: 42
Number of HSP's gapped: 12208
Number of HSP's successfully gapped: 56
Length of query: 699
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 582
Effective length of database: 40,065,477
Effective search space: 23318107614
Effective search space used: 23318107614
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)