Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C01804g8.256ON1209119559120.0
NDAI0B023808.256ON1219121325080.0
TDEL0F038308.256ON1195119625070.0
NCAS0B049808.256ON1204120224370.0
YLR084C (RAX2)8.256ON1220120823770.0
Suva_10.1688.256ON1220120623440.0
Smik_12.1438.256ON1220120823440.0
Skud_12.1528.256ON1220120722950.0
SAKL0H17204g8.256ON1211122422290.0
Kpol_392.108.256ON1226121522290.0
KAFR0B026908.256ON1210120621690.0
TPHA0B032508.256ON1215120621520.0
TBLA0E043908.256ON1278126319780.0
KLTH0G13838g8.256ON1214121418490.0
KNAG0G020008.256ON1202122318270.0
KLLA0F18975g8.256ON1200123017310.0
CAGL0L12144g8.256ON1156118717190.0
Kwal_56.235898.256ON1213122517130.0
Ecym_43158.256ON1212122516220.0
AGR095W8.256ON1201123015780.0
Suva_4.1944.231ON36167800.87
TDEL0C025601.483ON47958762.6
Skud_4.1994.231ON36167753.0
Smik_4.1794.231ON36167753.0
YDL055C (PSA1)4.231ON36167753.0
YDR141C (DOP1)8.313ON169862763.7
KNAG0D043104.231ON36167745.0
TBLA0A081304.231ON36191726.6
NDAI0D044404.231ON36157726.8
NCAS0A024304.231ON36170728.0
KLLA0E05853g7.491ON629122728.3
Kpol_1043.705.702ON132173729.3
Skud_12.2777.321ON422102719.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C01804g
         (1209 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} simil...  2281   0.0  
NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {...   970   0.0  
TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {...   970   0.0  
NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {...   943   0.0  
YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}...   920   0.0  
Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] ...   907   0.0  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...   907   0.0  
Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] ...   888   0.0  
SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} sim...   863   0.0  
Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON} (27006.....   863   0.0  
KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {...   840   0.0  
TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8....   833   0.0  
TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa]...   766   0.0  
KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} sim...   716   0.0  
KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {...   708   0.0  
KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa...   671   0.0  
CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 a...   666   0.0  
Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] ...   664   0.0  
Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar ...   629   0.0  
AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic h...   612   0.0  
Suva_4.194 Chr4 complement(345321..346406) [1086 bp, 361 aa] {ON...    35   0.87 
TDEL0C02560 Chr3 (445830..447269) [1440 bp, 479 aa] {ON} Anc_1.4...    34   2.6  
Skud_4.199 Chr4 complement(351168..352253) [1086 bp, 361 aa] {ON...    33   3.0  
Smik_4.179 Chr4 complement(332129..333214) [1086 bp, 361 aa] {ON...    33   3.0  
YDL055C Chr4 complement(355674..356759) [1086 bp, 361 aa] {ON}  ...    33   3.0  
YDR141C Chr4 complement(734901..739997) [5097 bp, 1698 aa] {ON} ...    34   3.7  
KNAG0D04310 Chr4 (780803..781888) [1086 bp, 361 aa] {ON} Anc_4.2...    33   5.0  
TBLA0A08130 Chr1 complement(2009133..2010218) [1086 bp, 361 aa] ...    32   6.6  
NDAI0D04440 Chr4 complement(1043289..1044374) [1086 bp, 361 aa] ...    32   6.8  
NCAS0A02430 Chr1 (459091..460176) [1086 bp, 361 aa] {ON} Anc_4.2...    32   8.0  
KLLA0E05853g Chr5 complement(520702..522591) [1890 bp, 629 aa] {...    32   8.3  
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...    32   9.3  
Skud_12.277 Chr12 complement(513291..514559) [1269 bp, 422 aa] {...    32   9.4  

>ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} similar to
            uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1209

 Score = 2281 bits (5912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1135/1195 (94%), Positives = 1135/1195 (94%)

Query: 15   ITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNS 74
            ITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNS
Sbjct: 15   ITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNS 74

Query: 75   STDSHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLT 134
            STDSHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLT
Sbjct: 75   STDSHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLT 134

Query: 135  DLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIG 194
            DLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIG
Sbjct: 135  DLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIG 194

Query: 195  FGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDVELGLAIPL 254
            FGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDVELGLAIPL
Sbjct: 195  FGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDVELGLAIPL 254

Query: 255  QNANWTSSSSQFDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIRIYNSPVEDNE 314
            QNANWTSSSSQFDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIRIYNSPVEDNE
Sbjct: 255  QNANWTSSSSQFDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIRIYNSPVEDNE 314

Query: 315  VSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEAXXXXXXVENMTTFSD 374
            VSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEA      VENMTTFSD
Sbjct: 315  VSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEASSNSSSVENMTTFSD 374

Query: 375  NNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLNQ 434
            NNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLNQ
Sbjct: 375  NNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLNQ 434

Query: 435  PACGKMQSYSNATISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPGNYSIKLY 494
            PACGKMQSYSNATISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPGNYSIKLY
Sbjct: 435  PACGKMQSYSNATISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPGNYSIKLY 494

Query: 495  TPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPKVTLE 554
            TPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPKVTLE
Sbjct: 495  TPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPKVTLE 554

Query: 555  YHSPIYPNNPTSVVVADYISLEAKSFDHFEKHKKDITLNGIFQYQISNFTKNITKESIGN 614
            YHSPIYPNNPTSVVVADYISLEAKSFDHFEKHKKDITLNGIFQYQISNFTKNITKESIGN
Sbjct: 555  YHSPIYPNNPTSVVVADYISLEAKSFDHFEKHKKDITLNGIFQYQISNFTKNITKESIGN 614

Query: 615  TSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSSKSFNLASQVR 674
            TSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSSKSFNLASQVR
Sbjct: 615  TSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSSKSFNLASQVR 674

Query: 675  GIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVERFTNIDLKGTELLVFDNE 734
            GIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVERFTNIDLKGTELLVFDNE
Sbjct: 675  GIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVERFTNIDLKGTELLVFDNE 734

Query: 735  FFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPVSLFQNGSAVS 794
            FFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPVSLFQNGSAVS
Sbjct: 735  FFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPVSLFQNGSAVS 794

Query: 795  SNIKDNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNGDEGPWRWTNSIETMIYRNRDALL 854
            SNIKDNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNGDEGPWRWTNSIETMIYRNRDALL
Sbjct: 795  SNIKDNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNGDEGPWRWTNSIETMIYRNRDALL 854

Query: 855  AXXXXXXXXXXXXXXXXXTTSEVLANETLDKGAEVNSMILFGKNSTLLIGGNFSFSDAHC 914
            A                 TTSEVLANETLDKGAEVNSMILFGKNSTLLIGGNFSFSDAHC
Sbjct: 855  ALGTSSSPSLPQLSVLNLTTSEVLANETLDKGAEVNSMILFGKNSTLLIGGNFSFSDAHC 914

Query: 915  NGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAGSLRVNGTSDVNLVSVNITGQ 974
            NGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAGSLRVNGTSDVNLVSVNITGQ
Sbjct: 915  NGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAGSLRVNGTSDVNLVSVNITGQ 974

Query: 975  GMKTLLRGWEGPLRSFVVSEDRLVVWNDTSLMAYDNTSWRHISTSNSTSFTKLQDIHQVS 1034
            GMKTLLRGWEGPLRSFVVSEDRLVVWNDTSLMAYDNTSWRHISTSNSTSFTKLQDIHQVS
Sbjct: 975  GMKTLLRGWEGPLRSFVVSEDRLVVWNDTSLMAYDNTSWRHISTSNSTSFTKLQDIHQVS 1034

Query: 1035 LEHSLEKRAXXXXXXXLDGLLVYGNDKTQGDSYQASIYDYYSWTPLFIANSKSENSNSGP 1094
            LEHSLEKRA       LDGLLVYGNDKTQGDSYQASIYDYYSWTPLFIANSKSENSNSGP
Sbjct: 1035 LEHSLEKRANSSSNSNLDGLLVYGNDKTQGDSYQASIYDYYSWTPLFIANSKSENSNSGP 1094

Query: 1095 NIFMNQDVSDFFISEQMLPNPTNHTXXXXXXXXXXXXXXXXGDKKHRASHKVDRGYVVLI 1154
            NIFMNQDVSDFFISEQMLPNPTNHT                GDKKHRASHKVDRGYVVLI
Sbjct: 1095 NIFMNQDVSDFFISEQMLPNPTNHTSSRSSSSSSSAVTSNSGDKKHRASHKVDRGYVVLI 1154

Query: 1155 GLALAXXXXXXXXXXXXXXAYMFGEDIGGYEFLSPPAEGTKAAETAPPAKSSKFL 1209
            GLALA              AYMFGEDIGGYEFLSPPAEGTKAAETAPPAKSSKFL
Sbjct: 1155 GLALAIGTVVVIGVFGILIAYMFGEDIGGYEFLSPPAEGTKAAETAPPAKSSKFL 1209

>NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1219

 Score =  970 bits (2508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/1213 (43%), Positives = 750/1213 (61%), Gaps = 26/1213 (2%)

Query: 15   ITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNS 74
            I   SQLS+++ +LN +N+ +P L+LT+S +   +LLGD   L+FY+Y GQ+NFT+ +  
Sbjct: 15   ILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKGQQNFTTGIIP 74

Query: 75   STDSHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLT 134
             ++S+GLIYYSN+T +QL   SNDT I +I P G DSFILSG+G + GY+L  QL YNLT
Sbjct: 75   GSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFILSGTGSLSGYSLTNQLLYNLT 134

Query: 135  DLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIG 194
             LS +PIF   + EV +IL+D  LVYFGGNFT  NG+   HS+++W+S  +ST  L F G
Sbjct: 135  TLSIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTSSSTEFLNFGG 194

Query: 195  FGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDVELGLAIPL 254
            FG+NS +NSI++L+ DNILFAG FY LD+   L  +   S N+   S  T V++G  +PL
Sbjct: 195  FGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIFNS--TTVDIGQLVPL 252

Query: 255  QNANWTSSSSQFDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIRIYNSPVEDNE 314
              + W +  S FD+D F+CPD   ESW+QSGT+GSL C LP E  P KIRIYNSP EDN+
Sbjct: 253  SASTWDTGESTFDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAPTKIRIYNSPNEDNQ 312

Query: 315  VSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEAXXXXXXVENMTTFSD 374
            VSLFRIL    +GI+NL+Y+DP   EL++CDAFCPLY++  L +A        +      
Sbjct: 313  VSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANTTSPSDTIHLLA 372

Query: 375  NNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLNQ 434
            +NTTDIKW ++FQEFAF+N + +SSV+FVAL SYG+NV LSS+Q +Q+  +++AN++LN+
Sbjct: 373  DNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNAYAVFANDTLNE 432

Query: 435  PACGKMQSYSNATISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPGNYSIKLY 494
            P C  ++S S++++S NDW  GL GQTY+ST+Y  +Q  +P V+F PQI+YPG YSI +Y
Sbjct: 433  PNCNSIESSSSSSLSANDWEMGLTGQTYISTTYTPNQDPVPYVSFSPQIKYPGQYSINIY 492

Query: 495  TPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPKVTLE 554
            TPGC  D TC+ RAIVNVT+WD D    L++E+IY+NN ELKYDEL+ G+L SSP+VT+E
Sbjct: 493  TPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYSGYLSSSPRVTIE 552

Query: 555  YHSPIYPNNPTSVVVADYI-----SLEAKSFDHFEKHKKDIT-LNGIFQYQISNFTKN-- 606
            Y S +Y +N  + VVAD +     SLE         +  +I  LNG+ QYQISNF+ +  
Sbjct: 553  YVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLLQYQISNFSTSSS 612

Query: 607  -ITKESIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSSK 665
              T   I NTSL+   L  FS N+S++A LY+++TLLL +S      +KL++N  ++SS 
Sbjct: 613  ETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVVKLNENMDIESSN 672

Query: 666  SFNLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINR--SVERFTNIDL 723
              +L     G  SYS G++ +G+YN S +    +++NG+FN     N+  S+    N+ +
Sbjct: 673  EASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFNKNSSITNVVNLTI 732

Query: 724  KGTELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGP 783
              TELLV DN+  YNVSS S ++N++   LS+WS+G N N D +FSGA++  DY +L G 
Sbjct: 733  HDTELLVIDNQAIYNVSSSSTITNSSALQLSLWSSGSNLNRDTVFSGAIALLDYTDLNGS 792

Query: 784  VSLFQNGSA--VSSNIKDNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNGDEGPWRWTNS 841
            +++  N +   +++N+    + Y G +LND+L+ YA K  S S ++FSNG   PW +   
Sbjct: 793  IAIGNNFTVTNITNNVSSTNSLYTGLFLNDSLSIYASKTDSYSELLFSNGYSAPWSFFEG 852

Query: 842  IETMIYRNRDALLAXXXXXXXXXXXXXXXXXTTSEVLANETLDKGAEVNSMILFGKNSTL 901
            I  M+Y +   +LA                 TT E +ANETL+  +++N +I F  NSTL
Sbjct: 853  INYMVYSSHQTMLAVASSDFNKNSELSILNLTTFETIANETLNVNSKINGLINFEHNSTL 912

Query: 902  LIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAGSLRVNGT 961
            ++GGNF+   ++C+GLCLYNY +  W TFAN SI G + Q++L N ++LL++G       
Sbjct: 913  IVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELINGTQLLLSGLFNAQNI 972

Query: 962  SDVNLVSVNITGQGMKTLLRGWEGPLRSFVVSEDRLVVWNDTSLMAYDNTSWRHISTSNS 1021
            S VNL  ++++   + ++  G    L+SF    D+++ WN   L +Y+N +W  I  SN 
Sbjct: 973  SSVNLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITWNGIMLESYENGAWSTIQ-SNF 1031

Query: 1022 TSFTKLQDIHQVSLEHSLEKRAXXXXXXXLDGLLVYGND-KTQGDSYQASIYDYYSWTPL 1080
             S T ++ I  +    +L+KR         DG ++ GN   T+  + QA IY++  W P 
Sbjct: 1032 NSSTTIRSIEPIGFGPTLQKRDGTGSA---DGFIINGNIYDTEYGTIQAMIYNFKEWRPY 1088

Query: 1081 FIANSKSENSNSGPNIFMNQDVSDFFISEQMLPNPTNHTXXXXXXXXXXXXXXXXGDKKH 1140
            +I +S   NS     IFMN+D S  + S+ +L NP N T                  + H
Sbjct: 1089 YIISST--NSQIAGQIFMNRDDSALYNSQSVLQNPNNATVTTPSSTSSGTPSATHSSQPH 1146

Query: 1141 RASH----KVDRGYVVLIGLALAXXXXXXXXXXXXXXAYMFGEDIGGYEFLSPPAEGTKA 1196
                    K+DRG+VVLIGLALA              AY+F +  G ++ L+P     + 
Sbjct: 1147 HQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDGSHDALNPRTNEDEM 1206

Query: 1197 AETAPPAKSSKFL 1209
             ET PP K  KFL
Sbjct: 1207 LETVPPEKLMKFL 1219

>TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1195

 Score =  970 bits (2507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/1196 (44%), Positives = 754/1196 (63%), Gaps = 21/1196 (1%)

Query: 18   GSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNSSTD 77
             SQL +L+      NI  P+LD      +AL+L G F  LTF +Y GQENFT  +N++TD
Sbjct: 17   ASQLENLKNKHGIVNIGTPRLDFPG---EALQLFGGFNALTFPQYEGQENFTGTINNNTD 73

Query: 78   SHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLTDLS 137
            S G++YYSNDTF++L NGS+D+ +++IVP G +SFIL GSG + GY L RQL YNL+DLS
Sbjct: 74   SRGIVYYSNDTFIKLINGSSDSYVEKIVPFGSESFILGGSGSLLGYELGRQLLYNLSDLS 133

Query: 138  FKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIGFGQ 197
             +PIF+  LT+V  IL D P+ YFGGNF+F NGS  GHSV  WNS  N+TSLLPF GFG+
Sbjct: 134  LRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWNSSSNTTSLLPFGGFGE 193

Query: 198  NSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTD-VELGLAIPLQN 256
             S VNSII+LD DNILF G FY LDD  LL      +N ++SK+N +  +E+   +PL+ 
Sbjct: 194  ESIVNSIIKLDSDNILFTGEFYTLDDQTLLI-----TNENTSKTNHSQSIEINELLPLRA 248

Query: 257  ANW-TSSSSQFDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIRIYNSPVEDNEV 315
            A W T S S FD+  FICP+ ++E+W    TSGSL  SLP E+ P K+RIYNSP E N V
Sbjct: 249  ATWNTDSDSSFDSSAFICPNSQKEAWSVPSTSGSLEASLPYESYPKKVRIYNSPEEHNAV 308

Query: 316  SLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEAXXXXXXVENMTTFSDN 375
            SLFRI+ +P+ GI+NL+YVDP  GEL  CDAFCPL  +  L+ A       + +    DN
Sbjct: 309  SLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTSQVVRL--DN 366

Query: 376  NTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLNQP 435
            N TDI+W  D+Q+FAFVN + ++ ++F+ALSSYG  VGLSS+Q +Q   + YANNSLN+ 
Sbjct: 367  NLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYANNSLNEV 426

Query: 436  ACGKMQSYSNATISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPGNYSIKLYT 495
             C      S + +S+++W+QGL GQ+YL   +   Q  +P+VTF+P I Y G Y++ LYT
Sbjct: 427  GCESNDIASTSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAINYAGQYTMNLYT 486

Query: 496  PGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPKVTLEY 555
            PGC  D TC  R+IVNVT+W       LSS ++++NN  +KYD+++ GHL+++P +TLEY
Sbjct: 487  PGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETAPVLTLEY 546

Query: 556  HSPIYPNNPTSVVVADYISLEAKSFDHFEKHKKD-ITLNGIFQYQISNFTKNI-TKESIG 613
            +SPI PNNP++VVVAD + +  +S D  +    + I LNG+FQYQ+SNFT +  +K SI 
Sbjct: 547  YSPISPNNPSNVVVADRLEVIVESVDILKNQTDETIPLNGMFQYQLSNFTNSTDSKPSIA 606

Query: 614  NTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSSKSFNLASQV 673
            NT+L+ + +  F  N+SLF+S+Y N+TL +  S S  A ++LD++  V S+  +     V
Sbjct: 607  NTTLNSYTVQNFPKNASLFSSMY-NNTLWVGGSVSGVAAVELDEDLHVSSTAKYATGGTV 665

Query: 674  RGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVERFTNIDLKGTELLVFDN 733
             GI SYSDG+ILFG +N S +    L+FNG F S+  +  ++  +TN+  +  ELLVF+N
Sbjct: 666  EGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRTYTNVSFQQDELLVFNN 725

Query: 734  EFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPVSLFQNGSAV 793
            E+ +N+SS SY+SN++ F LS+WSAG+N   D +FSGAV+ N +  L G  S++ N S  
Sbjct: 726  EYVFNLSSNSYISNSSTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSASIYSNSSVA 785

Query: 794  SSNIKDNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNGDEGPWRWTNSIETMIYRNRDAL 853
              ++++   PY   +LND++TAYAY+ GS S++ F NG EGPW W  +I +M Y     +
Sbjct: 786  HFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGKEGPWTWFGTINSMRYSKNSTI 845

Query: 854  LAXXXXXXXXXXXXXXXXXTTSEVLANETLDKGAEVNSMILFGKNSTLLIGGNFSFSDAH 913
            LA                 T+ +VLAN T+ +   ++SM+ F +NS+LL+GG++  SDA 
Sbjct: 846  LAIGTDGSTDEPILSLFNLTSFDVLANTTISENGTISSMVFFDRNSSLLVGGDYHISDAD 905

Query: 914  CNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAGSLRVNGTSDVNLVSVNITG 973
            C+GLCLYNY  K+W+ FAN+SITG +T++QL  S +LLI+G++ V   + VNL+S N++ 
Sbjct: 906  CSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMNVANKTSVNLLSFNMSN 965

Query: 974  QGMKTLLRGWEGPLRSFVVSEDRLVVWNDTSLMAYDNTSWRHISTSNSTSFTKLQDIHQV 1033
              +  L+    GP++SF+  ++ ++ WN+TSL  Y +  W+++   NS S   + D+  V
Sbjct: 966  YEVNPLVWDSNGPIKSFIAEDNDIITWNETSLSGYSDGDWQNLEFDNS-SLISIVDVIAV 1024

Query: 1034 SLEHSLEKRAXXXXXXXLDGLLVYGNDKTQGDSYQASIYDYYSWTPLFIANSKSENSNSG 1093
              E +L+KR         D +LV G +  +    QASIY++  W P ++AN   +   S 
Sbjct: 1025 KTEPALDKR--QTFSSTFDAILVAGQNYAEYP--QASIYNFQRWLPYYVANKADDEDPSR 1080

Query: 1094 PNIFMNQDVSDFFISEQMLPNPTNHTXXXXXXXXXXXXXXXXGDKKHRASHKVDRGYVVL 1153
               F NQD S  + S+ +L +PT  T                     R S K++RG+VVL
Sbjct: 1081 TTFFTNQDDSQLYDSQNLLSDPTRTTTSSSSSTTSSSQTSPSKGSLVRKSGKINRGFVVL 1140

Query: 1154 IGLALAXXXXXXXXXXXXXXAYMFGEDIGGYEFLSPPAEGTKAAETAPPAKSSKFL 1209
            IGLALA              A +F     GYE + P A+ ++  +T PP K  KFL
Sbjct: 1141 IGLALALGTVVIIGITGVLLALVFNGH-SGYEQVDPRADESEMIDTVPPEKLLKFL 1195

>NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1204

 Score =  943 bits (2437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/1202 (44%), Positives = 765/1202 (63%), Gaps = 25/1202 (2%)

Query: 18   GSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNSSTD 77
             SQLS LQ+ LN ++I +P L+LT+  N + ELLG    L+FY+YTGQ+NFTS +  +++
Sbjct: 18   ASQLSSLQENLNITHINIPNLNLTTDDN-SFELLGGIDSLSFYRYTGQQNFTSGILPNSN 76

Query: 78   SHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLTDLS 137
            S+GL YYSN+TF+QL   S D+ I++I+P G DSFILSG G + GY+L  QL +NL+  S
Sbjct: 77   SNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFILSGKGSLGGYSLSNQLLFNLSSFS 136

Query: 138  FKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIGFGQ 197
             K IF + L  VNSILVD  +V FGGNFT S  S  GHSV LWN   NSTSLLPF+GFG+
Sbjct: 137  LKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGE 196

Query: 198  NSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDVELGLAIPLQNA 257
            NS +NSI +L+ DNILFAG FY LD+  LL N +     + +  N +D+ LG  IPL  A
Sbjct: 197  NSLINSITKLNDDNILFAGKFYTLDNSTLL-NVV-----NDTMRNISDINLGQLIPLSAA 250

Query: 258  NWTSSSSQFDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIRIYNSPVEDNEVSL 317
             W+S+ S FD + F+CPDP  E+W Q+GTSG+L C+LP +  P KIRIYNSP  DNE+SL
Sbjct: 251  TWSSTGSFFDEETFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEISL 310

Query: 318  FRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEAXXXXXXVENMTTFSDNNT 377
            FRI ++P++ I+NL+Y+DP  G+L++CDAFCPLY +Q L+ A         M    ++NT
Sbjct: 311  FRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDNT 370

Query: 378  TDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLNQPAC 437
            +DI+W +DFQEFAFVN +  SS+ F+AL+SYG+NVGLSS+Q +Q   +I+ANNSLN+P+C
Sbjct: 371  SDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPSC 430

Query: 438  GKMQSYSNATISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPGNYSIKLYTPG 497
              ++S+S++ +SNN W +G++ Q Y+ T+Y+  QG +P VTFHP ++Y G YSI+LYTPG
Sbjct: 431  NSLESFSSSDLSNNTWTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSIELYTPG 490

Query: 498  CLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPKVTLEYHS 557
            C  D TC+ R IVNVT+W+ ++N  LS+ +IY+NN++LKYDEL+ G+L  SPK+T+ YHS
Sbjct: 491  CQQDNTCSSRGIVNVTVWNTNNNSILSTTLIYQNNDQLKYDELYSGYLNYSPKITVTYHS 550

Query: 558  PIYPNNPTSVVVADYISLEAKSFDHF-EKHKK--DITLNGIFQYQISNF---TKNITKES 611
             IY       VV D +++   S D   E H     + LNG+FQYQ+SNF   +K+ +   
Sbjct: 551  GIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLELNGLFQYQLSNFSTSSKDSSIAR 610

Query: 612  IGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSSKSFNLAS 671
            + NTS++   L+ FS+N SL ASLY NDTLL+       +  +L+K+ ++ SS    +  
Sbjct: 611  VANTSINQLTLTGFSSNVSLSASLY-NDTLLVGAGDDGLSIYELNKDLAIQSSSQQGIEG 669

Query: 672  QVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVERFTNIDLKGTELLVF 731
            ++ G+ SYS+G++++GD+NSS+     LSFNGSF+S   I   +  F NI +  +ELLVF
Sbjct: 670  KITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDDSELLVF 729

Query: 732  DNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPVSLFQNGS 791
            DN   +NVSS S +SNT+ FSLS+WS+G N+NGD +FSGA+S   + NL G VS+  N S
Sbjct: 730  DNNLIFNVSSSSQISNTSSFSLSLWSSGSNSNGDTLFSGALSQVQFTNLSGSVSIANNLS 789

Query: 792  AVSSNIKDNINPYMGAYLNDTLTAYAYK-DGSDSRIVFSNGDEGPWRWTNSIETMIYRNR 850
            A S  ++   +PY   +LND++T Y  K D S S ++FS+G + PWRWT  +++M+Y   
Sbjct: 790  ATS--LRSIGSPYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSKAPWRWTGYVDSMLYLTN 847

Query: 851  DALLAXXXXXXXXXXXXXXXXXTTSEVLANETLDKGAEVNSMILFGKNSTLLIGGNFSFS 910
             ++LA                 +  +VLANETL++ + V +M+ F +NS++L+GGNFS S
Sbjct: 848  QSMLAVGSSSSVNGELSILNLDSF-KVLANETLNQNSSVKTMVHFERNSSILVGGNFSIS 906

Query: 911  DAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAGSLRVNGTSDVNLVSVN 970
            +  C GLCLYNY   +W TF N +I G +T++Q+ N S+L+IAG       S VNL  +N
Sbjct: 907  NTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSSVNLALMN 966

Query: 971  ITGQGMKTLLRGWEGPLRSFVVSEDRLVVWNDTSLMAYDNTSWRHISTSNSTSFTKLQDI 1030
            +T   +  +  G++ P++ F+  +D +  WN+TSL  Y + SW  I  SNS S T +  I
Sbjct: 967  LTDNKLVLIRWGFKEPVKDFITIDDNIFAWNETSLFEYTSNSWVDIPISNSNSSTTIDSI 1026

Query: 1031 H-QVSLEHSLEKRAXXXXXXXLDGLLVYGN--DKTQGDSYQASIYDYYSWTPLFIANSKS 1087
                + +++L+KR        +  L+V G   D   G   QA IY++  W P    NS  
Sbjct: 1027 GWTTTTDNNLKKRDNSETSNNV--LIVKGQIYDNVYGH-IQAMIYNFEEWIPYLSINSLV 1083

Query: 1088 ENSNSGPNIFMNQDVSDFFISEQMLPNPTNHTXXXXXXXXXXXXXXXXGDKKHRASHKVD 1147
             ++N    +F+++DVS  F S Q+    +N T                  K H++  K+D
Sbjct: 1084 SSANQPAELFIDRDVSKLFDS-QLALQVSNTTASITASSSTPTPTSSPKKKLHQSKKKID 1142

Query: 1148 RGYVVLIGLALAXXXXXXXXXXXXXXAYMFGEDIGGYEFLSPPAEGTKAAETAPPAKSSK 1207
            RG+VVLIGLALA              AY F +D G Y+ ++P     +  +T PP K  +
Sbjct: 1143 RGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRVNEDEMLKTVPPEKLME 1202

Query: 1208 FL 1209
            F+
Sbjct: 1203 FI 1204

>YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}
            RAX2N-glycosylated protein involved in the maintenance of
            bud site selection during bipolar budding; localization
            requires Rax1p; RAX2 mRNA stability is regulated by Mpt5p
          Length = 1220

 Score =  920 bits (2377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/1208 (42%), Positives = 735/1208 (60%), Gaps = 17/1208 (1%)

Query: 15   ITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNS 74
            I+  SQL +++ LL+  +  +P L+++ + + A+++LG    L+FY+YTGQ+NFT  +  
Sbjct: 17   ISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFYEYTGQQNFTKEIGP 76

Query: 75   STDSHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLT 134
             T SHGL+YYSN+T++QL + S+DT I +I P G DSFILSGSG I+  ++  Q+ YNL+
Sbjct: 77   ETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSGTINNISVGNQILYNLS 136

Query: 135  DLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIG 194
             LS  PIF + L  V ++L D   +YFGGNF+++NGS TG+S ++W+S  N+T LLPF G
Sbjct: 137  TLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSALIWDSISNTTQLLPFGG 196

Query: 195  FGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDVELGLAIPL 254
            FG+NS+VNSI++L+ DNILFAG FY LDD   L +      NS+S  N T +ELG  IPL
Sbjct: 197  FGENSSVNSIVKLNNDNILFAGQFYTLDDPSALISSSNNGTNSTSSLNATTLELGQRIPL 256

Query: 255  QNANWTS-SSSQFDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIRIYNSPVEDN 313
            + A+W S  S+ F +D  +CP+   ++WL   TSGSL C+LP E +P KIR+YNS   D+
Sbjct: 257  RYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPYEVSPTKIRLYNSQRSDS 316

Query: 314  EVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEAXXXXXXVENMTTFS 373
            E+S+F+IL +P+  I+NL+Y+DP  GEL+ C  FCPLY+R  L  A        +M TF 
Sbjct: 317  EISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLLSASQNVSSSMDMITFI 376

Query: 374  DNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLN 433
            DNN TD+KW  DFQ+FAFVN +P+SS++FVAL+SYG +VGLS  + +Q   S YAN+SLN
Sbjct: 377  DNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGLELYQDTFSTYANDSLN 436

Query: 434  QPACGKM-QSYSNATISNNDWRQGLNGQTYLSTSYVEDQGN-IPRVTFHPQIQYPGNYSI 491
            +  C  +    S++T+S+NDW  GL G++Y++  YV DQ   IPRV F+P I +PG+Y+I
Sbjct: 437  EYGCSALTNDSSSSTLSSNDWYNGLTGESYIAAKYVPDQNEPIPRVKFYPNIIHPGHYTI 496

Query: 492  KLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPKV 551
             +YTPGCL D TC+ R IVNVT+W+  +N  + + +IY+NN+ LKYD+++ G+L  SP++
Sbjct: 497  NMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNLKYDQIYSGYLDFSPEI 556

Query: 552  TLEYHSPIYPNNPTSVVVADYISLEAKSFDHF------EKHKKDITLNGIFQYQISNFTK 605
             LEY S IY  N  +VVVAD +++   S D F         KK+  LNGI QYQ SNFT 
Sbjct: 557  VLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKETLLNGILQYQKSNFTS 616

Query: 606  NITKES-IGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSS 664
                E+ +GNT+L++FP+  +  NSSL+A +Y+N  L++    ++ + + L+ ++ V SS
Sbjct: 617  TRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNK-LVIGGVSNRISIVDLNDDFEVTSS 675

Query: 665  KSFNLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVERFTNIDLK 724
            K+  +   V GI   + GL++FGD  SS  Q     FNGSF +    +R+V    NI L 
Sbjct: 676  KNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENVFNQSRTVNSALNISLA 735

Query: 725  GTELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPV 784
              + +V DN++  N SS + + N++ FSLS+W+AG N +GD++FSGAVS   Y NL G V
Sbjct: 736  NNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFSGAVSHMQYGNLNGSV 795

Query: 785  SLFQNGSAVSSNIKDNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNGDEGPWRWTNSIET 844
                       N++  I PY+GAYLN++ TAYAY+  S ++I FSN     W W++ I  
Sbjct: 796  RFLNENEIEPLNLEGGIVPYLGAYLNESATAYAYEVDSLNKIYFSNEVYPSWNWSSGITQ 855

Query: 845  MIYRNRDALLAXXXXXXXXXXXXXXXXXTTSEVLANETLDKGAEVNSMILFGKNSTLLIG 904
            M+Y +   LLA                   + ++ANETL   A +N+++ F KN ++L+G
Sbjct: 856  MLYADNQTLLAVSAGSSTTAELSIFDLRNLT-MIANETLGSNARINALVNFEKNCSMLVG 914

Query: 905  GNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAGSLRVNGTSDV 964
            G+F  ++ +C GLCLYNY++K WSTF N++I G++TQ+   NSSEL+I+G         +
Sbjct: 915  GDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSFTNSSELIISGLFETKEYQSI 974

Query: 965  NLVSVNITGQGMKTLLRGWEGPLRSFVVSEDRLVVWNDTSLMAYDNTSWRHISTSNSTSF 1024
             L S N+T   M  LL G EG L SF V+ED +V WNDTSL  Y N  W   S   + S 
Sbjct: 975  RLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTSLFIYRNQEWNITSLPGNASS 1034

Query: 1025 TKLQDIHQVSLE-HSLEKRAXXXXXXXLDGLLVYGN-DKTQGDSYQASIYDYYSWTPLFI 1082
                      +E ++L KR           LL+ GN + +Q    Q+ ++D+  WTP FI
Sbjct: 1035 ISSVSAIYTDIESNTLNKRGINNVNNG-SILLLNGNFNISQYGYLQSLLFDFQKWTPYFI 1093

Query: 1083 ANSKSENSNSGPNIFMNQDVSDFFISEQMLPNP-TNHTXXXXXXXXXXXXXXXXGDKKHR 1141
            + + +  SN  P IF+N+DVS  F S+  L N     T                  K   
Sbjct: 1094 SET-TNTSNYNPIIFINRDVSTEFNSQSPLANVNITVTSPQSTSSQPPSSSASSESKSKS 1152

Query: 1142 ASHKVDRGYVVLIGLALAXXXXXXXXXXXXXXAYMFGEDIGGYEFLSPPAEGTKAAETAP 1201
               K+ RG+VVLIGLALA              AY+F +  G Y+ + P  +  +  +T P
Sbjct: 1153 KKKKIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVP 1212

Query: 1202 PAKSSKFL 1209
            P K  KF+
Sbjct: 1213 PEKLMKFV 1220

>Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  907 bits (2344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/1206 (41%), Positives = 724/1206 (60%), Gaps = 19/1206 (1%)

Query: 18   GSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNSSTD 77
             SQL  ++ LL+  +  +P L+++   + A+++LG    L+FY+YTGQ+NFT  + S T+
Sbjct: 20   ASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSETN 79

Query: 78   SHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLTDLS 137
            S GL+YYSN+T++ L     DT I +I P G DSFILSGSG I+G  L  Q+ YNL+ LS
Sbjct: 80   SRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLSTLS 139

Query: 138  FKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIGFGQ 197
               IF + L  V ++LV+   VYFGGNF+++NGS TGH  ++W+S  N+T LLPF GFG+
Sbjct: 140  MARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFGGFGE 199

Query: 198  NSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDVELGLAIPLQNA 257
            +S VNSI++L+ DNILFAG FY LDD  +L      + N+SS  N T +ELG  IPL+ A
Sbjct: 200  DSNVNSIVKLNDDNILFAGKFYTLDDSSILTTSSTNTTNASSTLNATTLELGQRIPLRYA 259

Query: 258  NWTS-SSSQFDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIRIYNSPVEDNEVS 316
            +W S  S+ F++   +CPD  +++WL  GTSGSL C+LP E  P KIR+YNSP  DN++S
Sbjct: 260  SWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPYEVAPTKIRLYNSPNSDNDIS 319

Query: 317  LFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEAXXXXXXVENMTTFSDNN 376
            LF+IL  P+  I+NL+Y+DP  GEL+ CD FCPLY+R  L  A        +M +F DNN
Sbjct: 320  LFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMISFIDNN 379

Query: 377  TTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLNQPA 436
             TD+KW  DFQ+FAF N + ++S++F AL+SYG+ VGLS  + +Q   S YANNSLN+  
Sbjct: 380  NTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNSLNEYG 439

Query: 437  CGKMQSYSNATI-SNNDWRQGLNGQTYLSTSYVEDQGN-IPRVTFHPQIQYPGNYSIKLY 494
            C  + + S+++I S+N W  GL GQ+Y++  YV +Q    P VTF+P I +PG+Y+I  Y
Sbjct: 440  CSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPGHYTINTY 499

Query: 495  TPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPKVTLE 554
            TPGC+ D TC+ R IVNVT+W+  +N  + + +IY+NNN LKYD+++ G+L  SP++ ++
Sbjct: 500  TPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDFSPEIVMK 559

Query: 555  YHSPIYPNNPTSVVVADYISL------EAKSFDHFEKHKKDITLNGIFQYQISNFTKNIT 608
            Y S IY +N  +++VAD +++         S       K+   LNGI QYQ SNFT   +
Sbjct: 560  YVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRHTPLNGILQYQRSNFTATTS 619

Query: 609  KES-IGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSSKSF 667
              + I NT+L++F +  +  NSS+FA +Y+   L+L    +  + I  + N  V SS++ 
Sbjct: 620  NGTKIANTTLNLFSVDNYPKNSSMFADVYDKK-LILGGKDNHISVIDFNDNLEVTSSENK 678

Query: 668  NLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVERFTNIDLKGTE 727
             +   V G+   + GL++FGD  SS  +   L FNGSF S    +++VE   NI L   +
Sbjct: 679  TIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVSNYSKAVENAINITLANND 738

Query: 728  LLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPVSLF 787
            L+VF+N++ +N SS S +SN+T FSLS+WSAG N N D++FSGAVS   + +L G     
Sbjct: 739  LIVFNNDYIFNASSNSQISNSTSFSLSLWSAGNNDNDDVLFSGAVSQMQFSDLSGSARFL 798

Query: 788  QNGSAVSSNIKDNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNGDEGPWRWTNSIETMIY 847
               +  + N+   I PY+GAYLN++  AYAYK  S S+I FSN     W W+N+I  M+Y
Sbjct: 799  NESTVEALNLNKGIVPYLGAYLNESTIAYAYKTNSLSKIYFSNNVSPSWNWSNNITKMVY 858

Query: 848  RNRDALLAXXXXXXXXXXXXXXXXXTTSEVLANETLDKGAEVNSMILFGKNSTLLIGGNF 907
             N   LL                    + + ANETL   A++N+ + F KNS+LL+GG+F
Sbjct: 859  ANNQTLLVIGSESSTTAELSILNLRNFTTI-ANETLGSNAKINAFVNFEKNSSLLVGGDF 917

Query: 908  SFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAGSLRVNGTSDVNLV 967
              S  +C GLC+YNY++K WSTF N++I G++TQ+   N SEL+I+G         + L 
Sbjct: 918  QMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESELIISGLFATEKQQSIRLG 977

Query: 968  SVNITGQGMKTLLRGWEGPLRSFVVSEDRLVVWNDTSLMAYDNTSWRHIST-SNSTSFTK 1026
            S N+T   M  LL G  G L SF V+E+ +V WNDTSL+ Y +  W   S   N +S + 
Sbjct: 978  SFNLTNSTMVPLLTGSGGKLNSFTVTEESIVAWNDTSLLIYKDQKWNTTSLPGNGSSVSS 1037

Query: 1027 LQDIHQVSLEHSLEKRAXXXXXXXLDGLLVYGN-DKTQGDSYQASIYDYYSWTPLFIANS 1085
            +  I   +  ++L KRA          LL+ GN    Q  + Q  ++D  +WTP F + +
Sbjct: 1038 VTTIDTNTDSYALRKRATTDAEKG-SILLLNGNFSIPQYGNLQGLLFDSQNWTPYFTSET 1096

Query: 1086 KSENSNSGPNIFMNQDVSDFFISEQMLPNPTNHTXXXXXXXXXXXXXXXXGDKKHRASHK 1145
              E S+  P IF+N+DVS  F S+  L N +N T                  + ++ S K
Sbjct: 1097 L-EASSYNPTIFINRDVSADFNSQIPLSN-SNMTVTSPQSTSPLSPSSSASSEPNKKSKK 1154

Query: 1146 --VDRGYVVLIGLALAXXXXXXXXXXXXXXAYMFGEDIGGYEFLSPPAEGTKAAETAPPA 1203
              +DRG+VVLIGLALA              AY+F +  G Y  + P  +  +  +T PP 
Sbjct: 1155 KNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIKPRIDENEMLDTVPPE 1214

Query: 1204 KSSKFL 1209
            K  KF+
Sbjct: 1215 KLMKFV 1220

>Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  907 bits (2344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/1208 (41%), Positives = 735/1208 (60%), Gaps = 23/1208 (1%)

Query: 18   GSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNSSTD 77
             SQL +++ LL+  +  +P L+++ + + A+++LG    ++FYKYTGQ+NFT  ++  T+
Sbjct: 20   ASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAISFYKYTGQQNFTKGISPGTN 79

Query: 78   SHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLTDLS 137
            SHGL+YYSN+T++QL + S+DT I +I P G+DSFILSGSG I+  ++  Q+ YNL+ LS
Sbjct: 80   SHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSGTINNISVGNQILYNLSTLS 139

Query: 138  FKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIGFGQ 197
              PIF + L +V ++LV+   VYFGGNF+++NGS  GHS ++W++  ++  LLPF GFG+
Sbjct: 140  MAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSALVWDAMSDTAQLLPFGGFGE 199

Query: 198  NSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDVELGLAIPLQNA 257
            NS VNSI++L+ DNI+FAG FY LDD  +L        NS+   N T +ELG  I L+ A
Sbjct: 200  NSNVNSILKLNDDNIVFAGKFYTLDDSSVLITSSNNGTNSTFSLNATKLELGQRISLRYA 259

Query: 258  NWTS-SSSQFDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIRIYNSPVEDNEVS 316
            +W S  S+   ++  +CP+    +WL   TSGSL C+LP E +P KIR+YNS    +E++
Sbjct: 260  SWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPYEVSPTKIRLYNSQDAGSEIA 319

Query: 317  LFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEAXXXXXXVENMTTFSDNN 376
            LF+IL  P+  I+NL+Y+DP  GEL+ CD FCPLY+R  L  A        +M TF D N
Sbjct: 320  LFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLLAASQNASSSMDMITFIDGN 379

Query: 377  TTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLNQPA 436
             TD+KW  DFQ+FAF N +P++S++ +AL+SYG ++GLS  + +Q+  S YANNSLN+  
Sbjct: 380  NTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGLELYQNTFSTYANNSLNEYG 439

Query: 437  CGKM-QSYSNATISNNDWRQGLNGQTYLSTSYVEDQGN-IPRVTFHPQIQYPGNYSIKLY 494
            C  +    S++ +SNN W  GL G++Y++T+Y+ DQ   IPRV F+P I + G+Y+I  Y
Sbjct: 440  CSALVNDSSSSILSNNSWYNGLTGESYIATNYIPDQNEPIPRVKFYPNIIHSGHYTINTY 499

Query: 495  TPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPKVTLE 554
            TPGC+ D TC+ R IVNVT+W+  +N  + +  IY+NN+ LKYD+++ G+L  SP++ LE
Sbjct: 500  TPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNLKYDQIFSGYLDFSPEIVLE 559

Query: 555  YHSPIYPNNPTSVVVADYISLEAKSFDHFEKH------KKDITLNGIFQYQISNFTKNIT 608
            Y S IY +N  +VVVAD +++   S D F         K+   LNGIFQYQ SNFT   +
Sbjct: 560  YISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQTPLNGIFQYQKSNFTGTTS 619

Query: 609  -KESIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSSKSF 667
             K  +GNT+L++FP++ +  N+SL   +Y ND L++    ++ + I L++N+ + SS++ 
Sbjct: 620  NKTKVGNTTLNLFPVNNYPKNASLLVEIY-NDKLIVGGVSNRISTIDLNENFEIKSSENR 678

Query: 668  NLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVERFTNIDLKGTE 727
             +   V GI     GL+++GD  SS  Q   L FN SF      ++ V   TNI +   E
Sbjct: 679  TIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKVPNYSKRVNSATNISIADNE 738

Query: 728  LLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPVSLF 787
            L VFDN +  N SS + +SN+T FSLS+W+AG N NGD++FSG VS  ++ NL G  S F
Sbjct: 739  LFVFDNNYIINASSNAQISNSTSFSLSLWAAGNNGNGDVLFSGTVSHMEFSNLNGSAS-F 797

Query: 788  QNGSAVSS-NIKDNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNGDEGPWRWTNSIETMI 846
            +N   V + NI   I PY GAYLN++++AYAY+  + ++I FSN     W W+N+I  M+
Sbjct: 798  KNEDQVQALNIGRGIVPYFGAYLNESVSAYAYETDALNKIYFSNKVNPSWNWSNTITRML 857

Query: 847  YRNRDALLAXXXXXXXXXXXXXXXXXTTSEVLANETLDKGAEVNSMILFGKNSTLLIGGN 906
            Y N   +L                    + + ANETL   A+V++++ F KNS++L+GG+
Sbjct: 858  YANNQTMLVVSSESSSTADLTIFNLRNMTTI-ANETLGSNAKVSALVNFEKNSSILVGGD 916

Query: 907  FSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAGSLRVNGTSDVNL 966
            F  +  +C+GLCLYNY+ K WSTF N++I G+VTQ+ L NSSEL+I+G         + L
Sbjct: 917  FQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSLANSSELIISGLFNTREHQSIRL 976

Query: 967  VSVNITGQGMKTLLRGWEGPLRSFVVSEDRLVVWNDTSLMAYDNTSWRHIST-SNSTSFT 1025
             S N+    M  LL G EG L SFVV+++ LV WNDTSL  Y N  W   S  S+ +   
Sbjct: 977  GSFNLNNFTMVPLLSGSEGKLNSFVVTDNSLVAWNDTSLFIYGNQKWNITSLPSDDSLIG 1036

Query: 1026 KLQDIHQVSLEHSLEKRAXXXXXXXLDG--LLVYGN-DKTQGDSYQASIYDYYSWTPLFI 1082
             +  I   +   +L KRA        DG  LL+ GN    Q  + Q+ ++D+ +WTP FI
Sbjct: 1037 SVSTISTNTKSDTLNKRATNNAH---DGSILLLNGNFTMPQYGNLQSLLFDFQAWTPYFI 1093

Query: 1083 ANSKSENSNSGPNIFMNQDVSDFFISEQMLPN-PTNHTXXXXXXXXXXXXXXXXGDKKHR 1141
            +   S +SN  P  F+N+DVS  F S+  LPN     T                  K   
Sbjct: 1094 S-EISNSSNYNPTFFINRDVSTEFNSQITLPNLNITVTNPQSTSSQSPSTSATSESKSKS 1152

Query: 1142 ASHKVDRGYVVLIGLALAXXXXXXXXXXXXXXAYMFGEDIGGYEFLSPPAEGTKAAETAP 1201
               K+DRG+VVLIGLALA              AY+F +  G Y+ + P  +  +  +T P
Sbjct: 1153 EKKKIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYKPIKPRIDENEMLDTVP 1212

Query: 1202 PAKSSKFL 1209
            P K  KF+
Sbjct: 1213 PEKLMKFV 1220

>Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  888 bits (2295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/1207 (40%), Positives = 723/1207 (59%), Gaps = 21/1207 (1%)

Query: 18   GSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNSSTD 77
             SQL +++ LL+  +  +P L+++   + A+++LG    L+ Y+YTGQ+NFT  ++  T+
Sbjct: 20   ASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALSLYEYTGQQNFTKEISPGTN 79

Query: 78   SHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLTDLS 137
            S GL+YYSN+T++Q+ + S+DT I +I P G DSFILSGSG I+   +  Q+ YNL+ LS
Sbjct: 80   SRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSGTINNMPIGNQILYNLSTLS 139

Query: 138  FKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIGFGQ 197
              PIF + L  V S+L++   VYFGGNF+++NGS TGHS ++W+S  N T LLPF GFG+
Sbjct: 140  MAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSALIWDSISNKTQLLPFGGFGE 199

Query: 198  NSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSN---NSSSKSNWTDVELGLAIPL 254
            NS VNSII+L+ DNILFAG FY LDD   L     GSN   NS+S  N T +ELG  IPL
Sbjct: 200  NSNVNSIIKLNDDNILFAGKFYTLDDSSALITA--GSNNTTNSTSLLNATKLELGQRIPL 257

Query: 255  QNANWT-SSSSQFDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIRIYNSPVEDN 313
            + A W    S+ F+++  +CP+   ++W+   TSG+L C LP E +P K+R+YNS   D 
Sbjct: 258  RYATWDFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPYEVSPTKVRLYNSQDSDG 317

Query: 314  EVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEAXXXXXXVENMTTFS 373
            E+S+F+IL  P+  I+NL+Y+DP  G+L+ CD FCPLY+R  L  A        +M +F 
Sbjct: 318  EISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATLLSASQNVSSPMDMISFL 377

Query: 374  DNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLN 433
            DNN TD+KW  DFQ+FAF N +P++ ++F A++SYG +VGLS  + +Q   S YANNSLN
Sbjct: 378  DNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSGLELYQDTFSTYANNSLN 437

Query: 434  QPACGKMQS-YSNATISNNDWRQGLNGQTYLSTSYVEDQGN-IPRVTFHPQIQYPGNYSI 491
            +  C  + +  S++T+S+N W  GL G++Y++T YV +Q    PRV F+P I +PG+Y I
Sbjct: 438  EYGCSALANDSSSSTLSSNSWYNGLGGESYIATEYVPNQDEPTPRVNFYPNIVHPGHYII 497

Query: 492  KLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPKV 551
              YTPGC+ D TC+ R IVNVT+W+  +   + +  IY+NN+ LKYD+++ G+L  SP++
Sbjct: 498  NTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDNLKYDQIYSGYLDFSPEI 557

Query: 552  TLEYHSPIYPNNPTSVVVADYISLEAKSFDHFE------KHKKDITLNGIFQYQISNFTK 605
             LEY S I+ +N  +VVVAD +++     D F         K+ I LNG+ QYQ SNFT 
Sbjct: 558  ILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKEYIPLNGVLQYQKSNFTS 617

Query: 606  NITKES-IGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSS 664
              + E+ IGNT+L+VF +  + NNSSLFA     D L+L  + +  + I L+ N  V  S
Sbjct: 618  TTSNETKIGNTTLNVFAVDNYPNNSSLFADT-NGDRLILGGTNNHISIIGLNDNLEVVLS 676

Query: 665  KSFNLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVERFTNIDLK 724
            +   +   V G+   S GL++FGD  SS  Q   L FNGSF +    +R+V    NI L 
Sbjct: 677  EKQIIQGDVHGMTQTSQGLLIFGDLLSSNNQSSVLLFNGSFENVFNYSRTVNSAINISLA 736

Query: 725  GTELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPV 784
              +L+VFDN++  N SS + + N+T FSLS+WSAG N N D++FSGAVS   +  L G  
Sbjct: 737  NNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLFSGAVSRMQFGGLNGSA 796

Query: 785  SLFQNGSAVSSNIKDNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNGDEGPWRWTNSIET 844
                     + N+ + + PY+ AYLN++ TAYAY+    ++I FSN  +  W W+ SI  
Sbjct: 797  RFLSEDKVQALNLDNAVVPYLAAYLNESTTAYAYETNLLNKIYFSNNVDPSWNWSTSITR 856

Query: 845  MIYRNRDALLAXXXXXXXXXXXXXXXXXTTSEVLANETLDKGAEVNSMILFGKNSTLLIG 904
            M+Y N  +LL                    + ++ANET+   A++N+++ F KNS+LL+G
Sbjct: 857  MLYANNQSLLTVGSESSTTAELSIFNLKNFT-MIANETMGSNAKINALVNFEKNSSLLVG 915

Query: 905  GNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAGSLRVNGTSDV 964
            GNF  S  +C+GLCLYNY++K WSTF N++  G++TQ+    +S+L+I+G         V
Sbjct: 916  GNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSAASQLVISGLFDTEEYQSV 975

Query: 965  NLVSVNITGQGMKTLLRGWEGPLRSFVVSEDRLVVWNDTSLMAYDNTSWRHIST-SNSTS 1023
             L S N+T   M  LL G EG + SFVV+E+ +V WNDTSL+ Y +  W   S   N +S
Sbjct: 976  RLASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAWNDTSLLIYRDQEWNITSVPGNDSS 1035

Query: 1024 FTKLQDIHQVSLEHSLEKRAXXXXXXXLDGLLVYGNDKTQG-DSYQASIYDYYSWTPLFI 1082
               +  I+  +   +L +RA          LL+ GN       + Q  ++D+ +W+P F+
Sbjct: 1036 IGSVSTINTNAGPGTLNRRATNNAENGTI-LLLSGNFSIPDYGNLQGLLFDFETWSPYFV 1094

Query: 1083 ANSKSENSNSGPNIFMNQDVSDFFISEQMLPNPTNHTXXXXXXXXXXXXXXXXGDKKHRA 1142
            + S S  SN  P IF+N+DVS  F S+  L N                      + K ++
Sbjct: 1095 SES-SNTSNRNPTIFINRDVSTEFNSQIPLSNLNVTETGPQSASSQFPSSSASSELKPKS 1153

Query: 1143 SHKVDRGYVVLIGLALAXXXXXXXXXXXXXXAYMFGEDIGGYEFLSPPAEGTKAAETAPP 1202
              ++DRG+VVLIGLALA              AY+F +  G Y+ + P  +  +  +T PP
Sbjct: 1154 KKRIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPP 1213

Query: 1203 AKSSKFL 1209
             K  KF+
Sbjct: 1214 EKLMKFV 1220

>SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1211

 Score =  863 bits (2229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/1224 (40%), Positives = 729/1224 (59%), Gaps = 58/1224 (4%)

Query: 15   ITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNS 74
            +  GSQLS L++ LN  ++ +P++DL+SS N  + LLGDF+DLTFY+YTGQENFT  +  
Sbjct: 17   LVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQENFTGSITE 76

Query: 75   STDSHGLIYYSNDTFLQLANGSND---TDIKQIVPLGEDSFILSGSGHI-DGYNLQRQLH 130
            +     LIYYSN TF++L + S++    DI  I+P G+DSFILSG+G +  G+NL++QL 
Sbjct: 77   T--EKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLPGGHNLEQQLL 134

Query: 131  YNLTDLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLL 190
            YNL+ L +  IF + ++ VN IL D  +VYFGG F ++ G+ TGHSVVLWNS  N   LL
Sbjct: 135  YNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWNSTTNEIQLL 194

Query: 191  PFIGFGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDVELGL 250
            PF GFG +S VNSI+RLD DNI+FAG F  LDD  LL+  I GSN   S  N TD+E   
Sbjct: 195  PFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLK-QIRGSN---SSKNATDIEFDQ 250

Query: 251  AIPLQNANWTSSSSQFDADDFICPDPERESWLQSGTS-GSLACSLPQETTPYKIRIYNSP 309
             IPL++A W+S  S  +    ICP  + + W Q GT+ G    SL  +  P K+RIYN+ 
Sbjct: 251  LIPLKHAGWSSQGS-LEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLRPSKLRIYNAF 309

Query: 310  VEDNEVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEAXXXXXXVENM 369
              D +VSLFRI+  P  GI+NL+Y+DP+ GEL YCDA+CPL + + LE+A        + 
Sbjct: 310  DSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVTISSDS 369

Query: 370  TTFSDNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYAN 429
              +  NN T+IKW   +QEFAFVN V + S+ F+AL SYGS+VGL  ++ +Q+    +AN
Sbjct: 370  VAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGYPTFAN 429

Query: 430  NSLNQPACGKMQSYSNA-TISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPGN 488
            ++LNQP C  + SYS+A T S   W QG    +Y+ ++Y +  G++P V F+P I Y G+
Sbjct: 430  DTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTY-DGTGDLPSVNFYPNITYAGD 488

Query: 489  YSIKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSS 548
            Y++ + TPGC GDG+C+ R IVNVT+WD  ++  LS+++IY+NNN+ KYD L+ G+L+S+
Sbjct: 489  YTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSGYLESA 548

Query: 549  PKVTLEYHSPIYPNNPTSVVVADYISLEAKSFDHFEKHKKDI--TLNGIFQYQISNFTKN 606
            PK+TL+++  I  ++ TS++VAD + +   S D  +   K I  TLNG+FQYQISNFT  
Sbjct: 549  PKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTINETLNGLFQYQISNFTT- 607

Query: 607  ITKES--IGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSS 664
            I+ +S  IGNT+++ + +    +NS LFA  Y N+TLL+  + +  A ++L+ + ++ S 
Sbjct: 608  ISNDSLKIGNTTINRYSIENVPSNSELFAGYY-NNTLLVDGAFNGIAVLQLNDDLNIISE 666

Query: 665  KSFNLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVERFTNIDLK 724
            +         GI +YS+GL+  GD+N S +Q   LS+NG+F+S+  +  ++ RF NI + 
Sbjct: 667  QRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTNITRFNNITID 726

Query: 725  GTELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPV 784
             +ELLVF+N + +NVSS  Y+ NT+ F+LS+WSAG N+  D I  GAVS   Y  L G V
Sbjct: 727  DSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQYTELNGAV 786

Query: 785  SLFQNGSAVSSNIK--DNINPYMGAYLNDTLTAYAYKDGSDS--RIVFSNGDEG---PWR 837
             +    S  +  +   D    Y   Y+ND+ TAYAY   +DS   ++ + G+     P  
Sbjct: 787  YINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKNDSTHHVLIARGNRSEDLPVS 846

Query: 838  WTNSIETMIYRNRDALLAXXXXXXXXXXXXXXX-XXTTSEVLANETLDKGAEVNSMILFG 896
            W++++ TMIY   D+LLA                  + S+++  E L   + VN+++ F 
Sbjct: 847  WSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENLGAKSSVNAIVAFN 906

Query: 897  KNSTLLIGGNFSF--SDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAG 954
            KNS+LL+GG+F+    D  C+GLCLYNY   +WS F N+SI+G +T +Q  N ++LLI+G
Sbjct: 907  KNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFFNGTQLLISG 966

Query: 955  SLRVNGTSDVNLVSVNITGQGMKTLLRGWEGPLRSFVV---SEDRLVVWNDTSLMAYDNT 1011
            +L     + +NL  +N+    + T+LR     ++SFV    + D L+  +D  +  Y N 
Sbjct: 967  NLYTENETGINLAKLNMASNEV-TILRHGSTMVQSFVTFDHTTDELITQSDNEISYYTNG 1025

Query: 1012 SWRHISTS--NSTSFTKLQDI--HQVSLEHSLEKRAXXXXXXXLDGLLVYGNDK--TQGD 1065
             W+++++   N + +   Q I   Q S +  +  RA          LLV G+ K  T G 
Sbjct: 1026 EWKNLTSEDFNDSLYMGAQLIPLKQTSSKRDVSNRA----------LLVNGDLKHSTYG- 1074

Query: 1066 SYQASIYDYYSWTPLFIANSKSENSNSGPNIFMNQDVSDFFISEQMLPNPTNHTXXXXXX 1125
            S  A +YD+  W P FI +   EN+    NIFMN+D+S  + ++ +L      T      
Sbjct: 1075 SVSAMLYDFEDWMPYFIVD--GENAGRASNIFMNKDLSSLYTTQTILQGSNTSTSTTSSN 1132

Query: 1126 XXXXXXXXXXGDKKHRASHKVDRGYVVLIGLALAXXXXXXXXXXXXXXAYMFGEDIGGYE 1185
                       DK   +S K+DRG+VVLIGLALA              AY F  + G YE
Sbjct: 1133 MPSETS-----DKNESSSDKIDRGFVVLIGLALAIGTVAVLGGAGAIIAYFFAGNKGQYE 1187

Query: 1186 FLSPPAEGTKAAETAPPAKSSKFL 1209
             L P  +     +T PP K  KF+
Sbjct: 1188 PLKPRVDEGDMIDTVPPEKLMKFV 1211

>Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON}
            (27006..30686) [3681 nt, 1227 aa]
          Length = 1226

 Score =  863 bits (2229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/1215 (39%), Positives = 744/1215 (61%), Gaps = 24/1215 (1%)

Query: 15   ITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNS 74
            ++  SQL++++  L  + + +P+++  ++ N+ +++L + + LTFY+Y GQ+NFT  +++
Sbjct: 16   VSQASQLTNVKDSLGINTVNIPQINFGNTNNE-IQILSNIEGLTFYQYQGQQNFTGSIDT 74

Query: 75   STDSHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLT 134
            ++++HGLIYYSNDT ++L  GS++T I QIVPL ED+FILSGSG + G+ L+ QL YNL+
Sbjct: 75   NSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTLGGFQLENQLLYNLS 134

Query: 135  DLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIG 194
            DLS  P+F   L  + SILVD+ +VYFGGNF++++ ++T +S++ WN    +  +LPFIG
Sbjct: 135  DLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKNVDMLPFIG 194

Query: 195  FGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHI---LGSNNSSSKSNWTDVELGLA 251
            FG+NSTVNSI++LD DN+LF G+F  LDD  LL ++I      N++SS S  T++EL   
Sbjct: 195  FGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVSNITTYTQQNSTSSSSTETNLELEQQ 254

Query: 252  IPLQNANWTSSSSQFDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIRIYNSPVE 311
            I L+ A+W S      +  FICP+ + E+W  +GT+G + C+L  E +  KIRI+NSP E
Sbjct: 255  ISLKYASWASLGDLKSSTQFICPNGQNEAWSSAGTTGEITCNLAFEASLSKIRIFNSPYE 314

Query: 312  DNEVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEAXXXXXXVENMTT 371
             ++++ FRI+  P+ GI+NL+Y+DP   E++YCDAFCPLY+   L+ +        + + 
Sbjct: 315  QDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQASSENATTSASTSA 374

Query: 372  FSDNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNS 431
            F + N T+I W  D+QEFAFVN VP+++++ +AL+SYG NVGLS +Q +Q+  SI+ANNS
Sbjct: 375  FINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSIFANNS 434

Query: 432  LNQPACGKMQSY-SNATISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPGNYS 490
            LN+PAC    +   ++ +SNN W QGLN Q+Y++T Y       P V F+P I   GNY+
Sbjct: 435  LNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGDDPSPLVNFYPSINRIGNYT 494

Query: 491  IKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPK 550
            + +YTPGC GDGTC+ R IVNVTLWD  +N+ +S+ +IY+NNNE+KYD+L++G L  +PK
Sbjct: 495  VNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGFLDYAPK 554

Query: 551  VTLEYHSPIYPNNPTSVVVADYISLEAKSFDHFE--------KHKKDITLNGIFQYQISN 602
            VTLEY+S I   N   VVVAD + L   + +  E          +  + LNG+FQYQ+SN
Sbjct: 555  VTLEYYSGINDENSPVVVVADNVDLVPINIELDETIGNVTSSTEELKVPLNGMFQYQLSN 614

Query: 603  FTKNITKE--SIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWS 660
            FT +       + NTSL++FP+S FS++ SL+   Y N+TLLL  S +    + L    +
Sbjct: 615  FTSSNNNSTLKVDNTSLNLFPVSRFSSSVSLYGVEY-NETLLLGGSIAGVYALSLSNYTN 673

Query: 661  VDSSKSFNLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVERFTN 720
            + S++      +V G G+Y+ G++LFG++N S R   +LS+NG+F+S+  +N ++  F+N
Sbjct: 674  IRSTRIVETGGEVTGTGAYAGGVVLFGNFNISNRIVSSLSYNGTFDSFGNVNSNIATFSN 733

Query: 721  IDLKGTELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENL 780
            +    +E+L F+NE+F+N S+ SY+ NT+  SLS+WSAG N  GD +FSG ++ N++ NL
Sbjct: 734  LTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGLITRNEFPNL 793

Query: 781  QGPVSLFQNGSAVSSNIKDNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNGDEGPWRWTN 840
                 L  NG+A S  +++ I PY+G YLND+LTAY Y   S+S I+FSNG +G W    
Sbjct: 794  NNSAVLTGNGTAQSLQLRNGIQPYLGVYLNDSLTAYLYDSSSNSNILFSNGLQGNWNLPR 853

Query: 841  SIETMIYR-NRDALLAXXXXXXXXXXXXXXXXXTTSEVLANETLDKGAEVNSMILFGKNS 899
            S+ +  Y  N    +                  TT ++L NET D  + +NS++ FG+NS
Sbjct: 854  SVSSAYYSDNETMFVGSSLSNGDSGAELFVLNFTTMDLLYNETFDVNSSINSIVSFGRNS 913

Query: 900  TLLIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAGSLRVN 959
            +LL+GG+F+  + +C+ LCL N  N +WS+F+N    G +T ++  N S LLI+GS R  
Sbjct: 914  SLLVGGDFTAPNTNCSNLCLLNLGNNQWSSFSN-KFDGTITGLEFANDSRLLISGSYRFE 972

Query: 960  GTSDVNLVSVNITGQGMKTLLRGWEGPLRSFVVSEDRLVVWNDTSLMAYDNTSWRHISTS 1019
              S ++L  +++  Q  K+LL   +  + SF  +   +V W+ +++ +Y   SW +    
Sbjct: 973  NQSGISLGYIDLNNQEFKSLLSDSQ-KVNSFNYNNGTIVAWDSSTIYSYRGDSWSNHQIP 1031

Query: 1020 NSTSFTKLQDIHQVSLEHSLEKRAXXXXXXXLDGLLVYGNDKTQGDSY-QASIYDYYSWT 1078
            N+ S T ++++  VS  ++             + +LV+G   ++   + QA  YD+ +W 
Sbjct: 1032 NTNSSTSIKNVQIVSKLNNSLSTNNTSNNLNDELILVFGELYSEDYGFVQAMFYDFQNWI 1091

Query: 1079 PLFIANSKSENSNSGPNIFMNQDVSDFFISEQMLPNPTNHTXXXXXXXXXXXXXXXXGD- 1137
            P +I    S  + S  ++FMN+D+S  + S+ +L NP +                     
Sbjct: 1092 PYYITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNSTISISSTSSSSATTRSSSTSS 1151

Query: 1138 ---KKHRASHKVDRGYVVLIGLALAXXXXXXXXXXXXXXAYMFGEDIGGYEFLSPPAEGT 1194
               K      K+ RGYVVLIGLALA              AY+F +D G Y  + P  +  
Sbjct: 1152 TSLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSDDKGEYVRIKPRIDEH 1211

Query: 1195 KAAETAPPAKSSKFL 1209
            +  +T PP K  KF+
Sbjct: 1212 EMLDTVPPEKLMKFI 1226

>KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1210

 Score =  840 bits (2169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/1206 (40%), Positives = 724/1206 (60%), Gaps = 29/1206 (2%)

Query: 18   GSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNSSTD 77
             SQLS L+  L       P L  +S+ + +L+LLG +  L+ Y YTGQ+NF+  +   T+
Sbjct: 20   ASQLSQLENSLGIQTFAPPALIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTN 79

Query: 78   SHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLTDLS 137
            S+GL+YYSN+T +QL  G +DT I  IVP+G DSFILSGSG ++ Y+L+ QL YNL+ LS
Sbjct: 80   SNGLVYYSNNTLIQLNQGLDDTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLS 139

Query: 138  FKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIGFGQ 197
              PIF   L +V SILVD+ LVYFGGNFTFSNG+  GHSV +WN   NST LLPF+GFG+
Sbjct: 140  VYPIFNTTLEQVESILVDEDLVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGE 199

Query: 198  NSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDVELGLAIPLQNA 257
            NS++N+I+RL+ DNILFAG FY LDD  LL      SN S++ +N  D+EL   +PL  A
Sbjct: 200  NSSINNILRLNDDNILFAGEFYTLDDASLLT-----SNTSNATTNIYDLELSPLLPLNEA 254

Query: 258  NWTSSSSQFDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIRIYNSPVEDNEVSL 317
             W+S  S FDA  FIC +P+ ++W  SGT+G+LACSLP ++   KIRIYNSP   N++S 
Sbjct: 255  TWSSDVSDFDASSFICVNPDSDAWFVSGTTGTLACSLPYDSALTKIRIYNSPDSQNQISE 314

Query: 318  FRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEAXXXXXXVENMTTFSDNNT 377
            FR++++P+  I+N++Y+DP  G L +CD++CPL +R  L  A       E     SDN T
Sbjct: 315  FRLISDPSGSIMNMTYIDPRTGNLEHCDSYCPLLSRDTLSSASDAASVSEMARLLSDNAT 374

Query: 378  TDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLNQPAC 437
              IKW  ++QEF FVN V  + ++F+AL+SYGSNV L+ +  +Q   +++ANNSLN  +C
Sbjct: 375  V-IKWSAEYQEFGFVNVVSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASC 433

Query: 438  GKMQS-YSNATISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPGNYSIKLYTP 496
                S Y+++T+S+NDW  G +GQTY++T Y E    IP+VTF+  + Y G+Y I LYTP
Sbjct: 434  TSNNSDYTSSTLSDNDWVFGASGQTYVTTFYTEGDDPIPQVTFNANLPYSGDYVINLYTP 493

Query: 497  GCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPKVTLEYH 556
            GC  DGTC+ R +VNVT++D   +  LS+  IY+NN  LKYDEL+ G+LK+S ++ LEY 
Sbjct: 494  GCSDDGTCSTRGLVNVTVYDESDDSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYV 553

Query: 557  SPIYPNNPTSVVVADYISLEAKSFDHF-----EKHKKDITLNGIFQYQI--SNFTKNITK 609
            S I  ++  + VVAD  ++   S D        K+   + LNG+FQYQ+   + T N + 
Sbjct: 554  SGISSDSTGTTVVADRSNIYVTSLDILGQISSSKNGSTVALNGLFQYQLSNFSSTFNSSS 613

Query: 610  ESIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSSKSFNL 669
              +G T L+ +PL  F+ NSSLFAS Y+N  LL+  ++     ++   + +  +S +  +
Sbjct: 614  AKVGKTFLNQYPLDIFNTNSSLFASTYDN-YLLVGGAEQSVYALESSNDLNFSTSDNSGV 672

Query: 670  ASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKI-NRSVERFTNIDLKGTEL 728
              Q + +  +S+G+ L+G++N S     A+++NGSFN + +  N S++ F N+    +E+
Sbjct: 673  EGQFKNMQPFSEGIFLYGNFNLSGVTEGAVTYNGSFNPFTQYGNSSIDTFKNVTFGNSEI 732

Query: 729  LVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPVSLFQ 788
            LVF+N + YNVSS + +SN++  SLS+WSAG N NGDL+F+GA S   Y      +++  
Sbjct: 733  LVFNNAYLYNVSSSTLMSNSSSLSLSLWSAGANANGDLLFNGASSQMSYSFNNESINIGA 792

Query: 789  NGSAVSSNIKDNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNGDEGPWRWTNSIETMIYR 848
            N      N  ++I+PY+G Y+N +  AY Y+D  ++R+ F+NG +  W+W N +   IY 
Sbjct: 793  NNIVQGLNFNESIDPYLGLYMNTSHGAYFYQDDDNTRVYFTNGSQPSWQWPNDVVAAIYS 852

Query: 849  -NRDALLAXXXXXXXXXXXXXXXXXTTSEVLANETLDKGAEVNSMIL-FGKNSTLLIGGN 906
             N+  L+A                 TT +V+ANE+L       S I+ F  N+T +IGGN
Sbjct: 853  DNQSLLIAGTSSSLESSSFLTVLNTTTYDVIANESLSSQQSQISGIVNFASNATAIIGGN 912

Query: 907  FSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAGSLRVNGTSDVNL 966
            FS  + +C GLCL+NY N  WS+FA+ SI G V  +QL N SEL+++G       S + +
Sbjct: 913  FSMPNVNCFGLCLFNYGNSTWSSFADASINGTVDHMQLFNESELIVSGLFSTKNISSITM 972

Query: 967  VSVNITGQGMKTLLRGWEGPLRSFVVSEDRLVVWNDTSLMAYDNTSWRHISTSNSTSFTK 1026
             S+N+    +  L  G     +SF V++ ++V WN+T+L  Y++  W     SN  S + 
Sbjct: 973  ASLNLKNNKITALKSGESNTFKSFTVADQKIVAWNNTALSIYEDNVWTVERISNINSSSV 1032

Query: 1027 LQDIHQVSLEHSLEKRAXXXXXXXLDGLLVYGN--DKTQGDSYQASIYDYYSWTPLFIAN 1084
            + +++ V+L  +L KR         D +LV G   D + G   QA +YD+ SW P  + N
Sbjct: 1033 VDNLNYVTLASALSKRDTSSS----DAILVSGQLYDNSYGH-IQAMVYDFSSWVPYLLIN 1087

Query: 1085 SKSENSNSGPNIFMNQDVSDFFISE-QMLPNPTNHTXXXXXXXXXXXXXXXXGDKKHRAS 1143
            S+S++S    N F+++D+S F  ++  +L N    +                        
Sbjct: 1088 SESDSS---INAFIDRDMSSFTNTQVALLTNSGTVSNSSSSTTSPGASASATSIPNKTHK 1144

Query: 1144 HKVDRGYVVLIGLALAXXXXXXXXXXXXXXAYMFGEDIGGYEFLSPPAEGTKAAETAPPA 1203
             K+DRG+VVL+GLALA              AY+F +D G YE ++P  +  +  ET PP 
Sbjct: 1145 RKIDRGFVVLLGLALALGTVAVLGIAGVIMAYVFRDDNGAYEPINPRIDENEMIETVPPE 1204

Query: 1204 KSSKFL 1209
            K  K++
Sbjct: 1205 KLMKYI 1210

>TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8.256
            YLR084C
          Length = 1215

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/1206 (38%), Positives = 692/1206 (57%), Gaps = 26/1206 (2%)

Query: 18   GSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNSSTD 77
             S LS++ +LLN    ++P L+  ++ N +++LLGD ++L FY Y GQ+NFT   NS   
Sbjct: 22   ASSLSNILKLLNIQEFELPNLNFNNTSN-SIQLLGDVENLQFYHYEGQQNFTDDGNSGIS 80

Query: 78   S-HGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLTDL 136
            S + LIYYS+D  +QL  GSNDTDI++I+P+G+DSF+LSGSGH++GY L RQL YNLT L
Sbjct: 81   STNNLIYYSDDVLIQLEVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTL 140

Query: 137  SFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIGFG 196
            S KPIF + L  + SILVD+ +VYFGG FT+   SQ   SV+ WN   +    LPF GFG
Sbjct: 141  SIKPIFDQDLGNITSILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFG 200

Query: 197  QNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILG--SNNSSSKSNWTDVELGLAIPL 254
             +S VNSI++L+ DNILF G F  L +  LL  +     SN ++S  N + ++L   I L
Sbjct: 201  SDSKVNSILKLNDDNILFVGMFDTLGNSSLLTYNTTSNFSNFTNSTENSSTIQLEQQISL 260

Query: 255  QNANWTSSSSQFDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIRIYNSPVEDNE 314
            + A W + ++ FD ++F+C     E+W+  G SG+L  + P   +P KIRIYN+   ++ 
Sbjct: 261  KYATWDAGTAYFDQNNFVCEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTAEDG 320

Query: 315  VSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEAXXXXXXVENMTTFSD 374
            VSLFRI+  P+ GI+NL+YVDP  G+L+YCDAFCPL N   LE A            F +
Sbjct: 321  VSLFRIVTSPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFIN 380

Query: 375  NNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLNQ 434
            NNTT + W   +QEFAF+NN+ +S++  +A  SYGS   LS  + FQ   + YANN+LNQ
Sbjct: 381  NNTTSVTWSESYQEFAFINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQ 440

Query: 435  PACGKMQS--YSNATISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPGNYSIK 492
            P C    +  +S++ +S+N W +GL+  +Y++ +Y  D   +P V F+P IQ  G++SIK
Sbjct: 441  PGCDTESTSLFSSSVLSDNGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDFSIK 500

Query: 493  LYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPKVT 552
            +YTPGCL DGTC  R+IVNVT+ D      LS+++IY+NNNE+KYDE+++G L  SP++T
Sbjct: 501  MYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEIT 560

Query: 553  LEYHSPIYPNNPTSVVVAD-------YISLEAKSFDHFEKHKKDITLNGIFQYQISNFTK 605
            L ++S I P+  ++++VAD       YI+++    D   K    + LNG+FQYQ+SNFT 
Sbjct: 561  LTFYSTILPDLDSAIIVADRVDLTPTYINVDDILLDSNLKSTS-LKLNGLFQYQLSNFTS 619

Query: 606  NITKESIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSSK 665
            + TK  +GN S+    LS F ++ SL  + + N+++ LA S S   +++L+ +  + ++ 
Sbjct: 620  D-TKTKVGNNSIHQLALSQFPSSVSLIGNTF-NNSIFLAGSTSNIVQLQLNSDLELRNTV 677

Query: 666  SFNLASQVRGIGSYSDGLILFGDYNSSQRQPLA-LSFNGSFNSYDKINRSVERFTNIDLK 724
              +   +   I +YS GL+ FG YN S    +  LSFNG+F+S+ ++  +V  F N   +
Sbjct: 678  VVDNGGETTRIENYSQGLLFFGQYNISSTNVVDNLSFNGTFSSFSQLGDNVTTFANFTYE 737

Query: 725  GTELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPV 784
            G+ELL F+N++ YNVSS+SY+ N T F+ SV + G N+N D +  G +  ++Y N   P+
Sbjct: 738  GSELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNEPL 797

Query: 785  SLFQNGSAVSSNIKDNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNGDEGPWRWTNSIET 844
             L+ N S  S     +I PY   +LNDT   YAYKDG +S+I++ N       ++ ++  
Sbjct: 798  KLYGNSSLESLTFSSSIVPYAAVFLNDTANLYAYKDGENSKIIYGNNMTTSLDFSGTLNK 857

Query: 845  MIYRNRDALLAXXXXXXXXXXXXXXXXXTTSEVLANETLDKGAEVNSMILFGKNSTLLIG 904
            + + N  +LL                  +    LA+E L+    + SMI F  N+T+L+ 
Sbjct: 858  LSFSNNSSLLFANAITNNGSSSLVISNISDGMSLASENLNNYGYITSMIDFNSNNTILVS 917

Query: 905  GNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAGSLRVNGTSDV 964
            GNF+  D  C+G+CLYNY  K+WS FAN +I G + ++QL NS ++LI+G       S +
Sbjct: 918  GNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNYSSI 977

Query: 965  NLVSVNITGQGMKTLLRGWEGPLRSFVVSEDRLVVWNDTSLMAYDNTSWRHISTSNSTSF 1024
             L S++I G  +  L    +  + SF+     + VW++ ++M Y +  W  IS  N+TS 
Sbjct: 978  TLASLDIKGYNISVLSDDSKIEISSFIHDGQSITVWSNDTIMEYKSEKWNEISFPNTTS- 1036

Query: 1025 TKLQDIHQVSLEHSLEKRAXXXXXXXLDGLLVYGN-DKTQGDSYQASIYDYYSWTPLFIA 1083
              ++ +  VS++  L+             L  YG  + T      A ++    W P F  
Sbjct: 1037 KYIESVEAVSID--LQNSTSNVSKI----LFAYGEFNSTLYGRLNAMLFRAGDWKPYFSI 1090

Query: 1084 NSKSENSNSGPNIFMNQDVSDFFISEQMLPNPTNHTXXXXXXXXXXXXXXXXGDKKHRAS 1143
            N+   N +    +F N+D+S  F S+  LP                       +K     
Sbjct: 1091 NNFQVNEDPAITLFENRDLSSLFNSKNSLPANITSAETSSRSTVSSATATTVVNKIEGKH 1150

Query: 1144 HKVDRGYVVLIGLALAXXXXXXXXXXXXXXAYMFGEDIGGYEFLSPPAEGTKAAETAPPA 1203
             K+DRG+VVLI LALA              AY+F  D   YE + P  +G +  +T PP 
Sbjct: 1151 SKIDRGFVVLIALALAVGTVALLGLFGVTIAYIF-RDEQKYESIKPRIDGQEMLDTVPPE 1209

Query: 1204 KSSKFL 1209
            K  KF+
Sbjct: 1210 KLMKFI 1215

>TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1278

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/1263 (36%), Positives = 706/1263 (55%), Gaps = 79/1263 (6%)

Query: 18   GSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGD--FQDLTFYKYTGQENFTSPLNSS 75
             +QL+HL+ +L   NI  P+ +L  S NQ+L+LL    F  L F  Y GQ+NFT P+ SS
Sbjct: 23   ANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQNFTQPIISS 82

Query: 76   TDSHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLTD 135
            + +H LIYYSNDT+++L +    T I+ I+P G+D+FILSG+G ++G+ L  QL YNLTD
Sbjct: 83   SQNH-LIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGTGSLNGFELSNQLVYNLTD 141

Query: 136  LSFKPIFQEGLT-EVNSILVDQP--LVYFGGNFTFS-NGSQTGHSVVLWNSEKNSTSLLP 191
            LS  PIF+  L  EV +I  D    LVYFGGNF++    S   + +++W+S  N T    
Sbjct: 142  LSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGLIIWDSSSNDTISYE 201

Query: 192  FIGFGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLE--NHILGSNNSSS---KSNWTDV 246
            F GFG NS +N+I++L+ +++LF+G FY LDD  +L    +I   NN+SS   + N +  
Sbjct: 202  FGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPNNTSSLLSQQNVSTF 261

Query: 247  ELGLAIPLQNANWTSSSSQ--FDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIR 304
            EL   IPL    ++++ +    + +  ICP  E E+W     +GSL  +LP    P KIR
Sbjct: 262  ELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSKAGSLQITLPFSIRPSKIR 321

Query: 305  IYNSPVEDNEVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEAXXXXX 364
            I+NSP  D+EV+ FRI       I++L+Y+DP +G+L+YC  FCPLYNR +L+       
Sbjct: 322  IFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLYNRNQLKLFNSNDN 381

Query: 365  XVENMTTFSDNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRA 424
               ++ T  DNNTTDIKW   +QEFAFVN   ++++EF ALSSYGS VGLS    FQS  
Sbjct: 382  LKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGSRVGLSGLSLFQSDI 441

Query: 425  SIYANNSLNQPACGKMQSYSN----------------ATISNNDWRQGLNGQTYLSTSYV 468
            +++AN S N+P+C    +Y N                + +S+NDW   L    YL+ +Y+
Sbjct: 442  AVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWYTPLPNSDYLACTYL 501

Query: 469  EDQGNIPRVTFHPQIQYPGNYSIKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVI 528
                 IP VTF+P + Y GNY++ + TPGC  D +C+ R IVNVT+W+   +  L + +I
Sbjct: 502  SSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSSILQTSLI 561

Query: 529  YENNNELKYDELWDGHLKSSPKVTLEYHSPIYPNNPTSVVVADYISLEAKSFDHF----- 583
            Y+ N   K+D++++G+L    K+T+ ++S +Y N     +VAD I+L   S D       
Sbjct: 562  YQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRINLIINSLDFVTTTSS 621

Query: 584  -EKHKKDITLNGIFQYQISNFTKNITKESIGNTSLDVFPLSYFSNNSSLFASLYENDTLL 642
             E    ++TLNG+FQY   N   N+  E+  N++++ +  S +  N SL A+ Y+ DTLL
Sbjct: 622  NEIDIYNVTLNGLFQYPEYNSVNNL-NENYTNSTINQYAYSNYPANVSLIAAAYDKDTLL 680

Query: 643  LADSKSKAAEIKLDKN-WSVDSSKSFNLASQVRGIGSYSDGLILFGDYNSSQRQPLALSF 701
            +  S +K  E +++KN  ++    +F   + V GI  YSDGLI +GD   S     A++F
Sbjct: 681  VGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSDGLIAYGDIMDSSGSYKAITF 740

Query: 702  -NGSFNSYDKINRSVERFTNIDLKGT-ELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAG 759
             N  F +       ++ F+NI L  + E+L F+N++FYN S+     NT+ F LS+WSAG
Sbjct: 741  TNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFKNTSTFELSLWSAG 800

Query: 760  QNTNGDLIFSGAVSDNDYENLQGPVSLFQNGSAVSSNIKDNINPYMGAYLNDTLTAYAYK 819
            +N   DLIFSG VS+N+  NL G VS+  N      N+ +NI PY   +LND+ T YAY 
Sbjct: 801  KNAQNDLIFSGLVSENENVNLTGVVSINANEQIKELNLGNNIYPYSAVFLNDSSTIYAYM 860

Query: 820  DGSD--SRIVFSNGDEGPWRWTNSIETMIYRNRDALLAXXXXXXXXXXXXXXXXXTTS-E 876
            + +   +R++ SNG++  W W N I +M +   ++LL+                  TS +
Sbjct: 861  EPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLSVGTISDKDVFPSFSILNLTSNK 920

Query: 877  VLANETLDKGAEVNSMILFGKNSTLLIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDSIT 936
            V+ANETL+K ++++S++ F KNS++L+GGNF+FSD  C+GLCL+NY+ K WSTF N+++ 
Sbjct: 921  VIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLFNYETKNWSTFMNNTLE 980

Query: 937  GQVTQVQLRNSSELLIAGSLRVNGTSDVNLVSVNITGQGMKTLLRGWEGPLRSFVVSEDR 996
            G V++++L+N+S +LI+G+L  N +++++L  +N+    +  LL+     L SF  + ++
Sbjct: 981  GTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNVSILLQNTN--LTSFEFTGNQ 1038

Query: 997  LVVWNDTSLMAYDNTSWRHISTSNSTSFTKLQDIHQVSLEHS-----LEKRAXXXXXXXL 1051
            +  WN ++L  Y+N +W  I   N T   KL  I    + +      LEKRA        
Sbjct: 1039 IAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKNSSSILEKRALRDT---- 1094

Query: 1052 DGLLVYGNDKTQG-DSYQASIYDYYSWTPLFIAN-SKSENSNSGPNIFMNQDVSDFFISE 1109
            + ++  G   ++G  + QA  Y   +W P F  N + + ++++  NIF N+D+S   IS+
Sbjct: 1095 NIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSINIFPNKDISSKIISD 1154

Query: 1110 QMLPN-----------------------PTNHTXXXXXXXXXXXXXXXXGDKKHRASHKV 1146
             +L N                           +                  K+    HK+
Sbjct: 1155 FVLKNWNFNLSDVGNSTNTTNSTNTTSTTNLTSPSNTTSPQPSSSIIPIIGKQQNKKHKI 1214

Query: 1147 DRGYVVLIGLALAXXXXXXXXXXXXXXAYMFGEDIGGYEFLSPPAEGTKAAETAPPAKSS 1206
             RG+VVLIGLAL+              +++F +  G YE L P     +  +  PP K  
Sbjct: 1215 QRGFVVLIGLALSLATVALLGIFGILLSFIFRDSRGDYESLKPRTTEHEMFDAVPPEKLM 1274

Query: 1207 KFL 1209
             F+
Sbjct: 1275 PFV 1277

>KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1214

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/1214 (36%), Positives = 673/1214 (55%), Gaps = 41/1214 (3%)

Query: 18   GSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNSSTD 77
            GS L  L+  L      +P LDL+ S+N  ++LLG+F+D+   KY+GQ+NFT  + S   
Sbjct: 20   GSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNFTGEV-SGNP 78

Query: 78   SHGLIYYSNDTFLQLANGSNDTDI---KQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLT 134
             + LIYYSN+TFL++ + S+ +++     IVP  +D+FILSG+G I G+ L RQL +NL+
Sbjct: 79   ENALIYYSNETFLEIYSSSDSSEVFSVDHIVPFKDDAFILSGAGSISGHQLSRQLLFNLS 138

Query: 135  DLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIG 194
             L F+ IF + L +VN+I  +   V+FGG+F +   +QT HS+++W+S K+   +LPF G
Sbjct: 139  SLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIKDGVEVLPFGG 198

Query: 195  FGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDVELGLAIPL 254
            FG+NSTVNSI+ LD  NILFAGNF  +D+ + L N      N S+ SN +  ELG  I L
Sbjct: 199  FGKNSTVNSILNLDNSNILFAGNFSAVDNTQQLNNI-----NVSNTSNTSVPELGHQISL 253

Query: 255  QNANWTSSSSQFDADDFICPDPERESWLQSG-TSGSLACSLPQETTPYKIRIYNSPVEDN 313
            Q+A W S  +  D     CP  E   WL++G T G     +P+ET P K+R++N+   D 
Sbjct: 254  QSAAWVSDGT-LDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPSKLRVFNARDSDE 312

Query: 314  EVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEAXXXXXXVENMTTFS 373
            +VSLFRI+  P+ GI+NL+Y+DP  GEL  CDA+CPL + Q L +        + +  F 
Sbjct: 313  QVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDISSKSYPGDQVQYFE 372

Query: 374  DNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLN 433
              N T ++W   FQ+FAFVNNVP+S + F+AL SYGS+VGL+  + ++S  S+YANN+LN
Sbjct: 373  --NRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAYSVYANNTLN 430

Query: 434  QPACGKMQSYSNATISNND-WRQGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPGNYSIK 492
             P C +  + SNA +SN+  W  G +   YLSTS V+D    P V F+P I YPG Y+I 
Sbjct: 431  APNCAQGSATSNALLSNSSAWDSGSSEGNYLSTS-VQDSETNPFVIFYPSIIYPGVYTID 489

Query: 493  LYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPKVT 552
            + TPGCL D +C  R I+N T+ D  +N  L S  IY+NN+  K+D L+ G L S  KVT
Sbjct: 490  VLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSGFLDSEVKVT 549

Query: 553  LEYHSPIYPNNPTSVVVADYISLEAKSFDH--FEKHKKDITLNGIFQYQISNFTKNITK- 609
            LE+   I       V+VA  I +  + FD   FE +     +NG+  Y  SN +  +++ 
Sbjct: 550  LEFDGAINSGTEVPVMVASKIVVNIEDFDQSVFENNTSGF-INGLLHYSTSNTSSFLSEL 608

Query: 610  ESIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSSKSFNL 669
             S   T L  + +S    +S++FA+++E+D L+L  +  + A +KL  N S++      +
Sbjct: 609  GSYSATDLAHYSVSKLPKHSNIFANMFEDD-LVLFTTDGEMARLKLANNLSIEEYTFETI 667

Query: 670  ASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVERFTNIDLKGTELL 729
               +  I  YS GLI+ G +N S  +P A  FNG+F +  + N +V  F+N+ L  TE+L
Sbjct: 668  GKDISTISEYSGGLIIVGTFNGSS-EPAARGFNGTFFNLTEFNSTVRTFSNLTLGQTEML 726

Query: 730  VFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPVSLFQN 789
            +FD     N ++   + +T++ +L V SAG+N   D +F G V  NDY NL G   +  N
Sbjct: 727  IFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDYTNLNGSFFISTN 786

Query: 790  GSAVSSNI--KDNINPYMGAYLNDTLTAYAY---KDGSDSRIVFSNGDEGPW----RWTN 840
               VS N        PY  A+++++ TAYAY    + S+S  V    D G       W+ 
Sbjct: 787  SEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMNDSGSTVQLSAWSG 846

Query: 841  SIETMIYRNRDALLAXXXXXXXXXXXXXXXXXTTSEVLANETLDKGAEVNSMILFGKNST 900
             +  M     D+LLA                 ++ E LA+   D    +NS+I F +N++
Sbjct: 847  KVGAMASSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYKWDSEISLNSIIFFARNNS 906

Query: 901  LLIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAGSLRVNG 960
            +L+GG+F  ++  C+GLCL+NY++K+WS F N+SI G + ++++ N+S LLIAGS R+N 
Sbjct: 907  VLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLLIAGSFRLNE 966

Query: 961  TSDVNLVSVNITGQGMKTLLRGWEGPLRSFVV---SEDRLVVWNDTSLMAYDNTSWRHIS 1017
            T  V+L S+ +     + L  G    L  FV    S + +V ++DTSL+  ++  W+ IS
Sbjct: 967  TDGVSLASICLKDSSSEILHEG-NITLNGFVSMDGSSNNVVAFSDTSLLQLESGKWQQIS 1025

Query: 1018 TSNSTSFTKLQDIHQVSLEHSLEKRAXXXXXXXLDGLLVYGN-DKTQGDSYQASIYDYYS 1076
            T N T  +K + +    L+ +  K+           LL+ G+    +  S  A+ YD   
Sbjct: 1026 T-NFTENSKFKGLDVFPLKDTTRKQKRDSSSKV---LLITGSLQHAKFGSINAAFYDSGE 1081

Query: 1077 WTPLFIANSKSENSN-SGPNIFMNQDVSDFFISEQMLPNPTNHTXXXXXXXXXXXXXXXX 1135
            WTP   +N  + +S+    ++F+N+D+SDF   +  L    +                  
Sbjct: 1082 WTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQGTFSSNTSSGTSGTPSPSGSSP 1141

Query: 1136 GDKKHRASHKVDRGYVVLIGLALAXXXXXXXXXXXXXXAYMFGEDIGGYEFLSPPAEGTK 1195
             + + R   K+DRG++VLI LALA              +Y FG+   GY+   P  +  +
Sbjct: 1142 SNLQ-RKKKKIDRGFIVLISLALALGTLAVLGLLGVIFSYFFGDSGDGYQLSKPRTDENE 1200

Query: 1196 AAETAPPAKSSKFL 1209
              +T PP K  +F+
Sbjct: 1201 MIDTVPPEKLMRFI 1214

>KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1202

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/1223 (36%), Positives = 678/1223 (55%), Gaps = 73/1223 (5%)

Query: 15   ITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNS 74
            IT  S L +++++LNA+ + VP  D+ +  NQ  ++L D   ++FY+Y GQ+NFT+  N 
Sbjct: 15   ITRASNLENVRRILNATEVTVPTFDVGNKNNQ-FQILDDINGISFYEYLGQQNFTTDANV 73

Query: 75   STDSHGLIYYSNDTFLQLANG-SNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNL 133
             TD   LIYYSN+TF+ L++  + +  I+ I+PLG+DSFILSG G I+  +L  QL +N+
Sbjct: 74   -TDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGMINNVSLASQLVFNM 132

Query: 134  TDLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFI 193
            TDLS   IF   L  +  + VD PLVYF GNFTF+N +      ++W+S   S +LLPF 
Sbjct: 133  TDLSITKIFDTPLRSIEGVTVDGPLVYFMGNFTFNNNT----GAIMWDSRDRSINLLPFH 188

Query: 194  GFGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSS-SKSNWTDVELGLAI 252
            GFG  + +NSI++L+ DNILFAG+F  + +  LL    L SN S  S  N T + L  ++
Sbjct: 189  GFGPYANINSILKLNDDNILFAGHFSTVWNSSLL----LQSNVSEESVRNTTSLLLNPSV 244

Query: 253  PLQNANWTSSSSQFDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIRIYNSPVED 312
            PLQ + W  ++ + D+   ICPDP ++SW  S T+G   C LP + TP KIRIYNSP +D
Sbjct: 245  PLQYSQW-KTNGELDSSQLICPDPSKDSWSVSATTGDFTCELPFQITPSKIRIYNSPDKD 303

Query: 313  NEVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEAXXXXXXVENMTTF 372
            ++VSLFR L  P   I+NL+Y+DP  G +  CDAFCPLY++  L+          N    
Sbjct: 304  SQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDNTAEA-NTVAI 362

Query: 373  SDNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSL 432
             +NN+T+I+W  ++QEFA V+ V  +S+EF AL+SYG+N+GL+ +Q +Q+  S + NNS 
Sbjct: 363  INNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAFGNNSF 422

Query: 433  NQPACG-----KMQSYSNATISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPG 487
            N P C         +++++++S N+W     G+ YL+  Y  ++  +P+VT+   IQ+ G
Sbjct: 423  NTPNCNNNDKDSNNTFTSSSLSPNNWTSV--GE-YLTVGYTPNENPVPKVTYKIDIQHSG 479

Query: 488  NYSIKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKS 547
             YSI ++TPGC  D TC+ R IVN TL+D  +N+ L++ +IY+NN+E+KYD L+ G L S
Sbjct: 480  EYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYSGQLNS 539

Query: 548  SPKVTLEYHSPIYPNNPTSVVVADYISLEAKSFDHFEKHKKDIT---LNGIFQYQISNFT 604
            S ++T+ Y+S +Y +N  + +VAD + L   S D    H+ +++   LNG+FQYQISNFT
Sbjct: 540  SCEITMTYYSGLYASNTVTTIVADRVDLNIISMDL--SHRTEVSKLALNGLFQYQISNFT 597

Query: 605  KNITKESIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSS 664
             +     I NTSL+ F L+ F  + SL A    N ++LL+ ++     I L+ + SV +S
Sbjct: 598  NDSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSINLNTDLSVQNS 657

Query: 665  KSFNLASQVRGIGSYSDGLILF-GDYNSS----QRQPLALSFNGSFNSYDKINRSVERFT 719
                          YS+GL++  G  N S      + L  + +GS               
Sbjct: 658  TRLISTENFTTFQPYSNGLVMLDGQGNVSLFKDNFKNLNTTMDGSL---------ATDVA 708

Query: 720  NIDLKGTELLVFDNEFFYNVSSQSYV-SNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDY- 777
            NI L G ELLVF+N + YNV+SQ    SN++ F+L+V SAG N+  D IF G V    Y 
Sbjct: 709  NITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGKVVQWQYA 768

Query: 778  -ENLQGPVSLFQNGSAVSSNIKDNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNGDE-GP 835
              N    V+   N      ++  N  P  G +LND  T Y YK+ + S++  +N +    
Sbjct: 769  IANQSAQVNADFNDGIEQMSLPSNTVPSRGIFLNDDSTGYFYKESNKSKLYITNSNSTSG 828

Query: 836  WRWTNSIETMIYRNRDALLAXXXXXXXXXXXXXXXXXTTS-EVLANETLDKGAEVNSMIL 894
              W    ET++Y   D LL                   TS +V+  E L+ G+ ++S++ 
Sbjct: 829  LEWYGEPETVVYDKNDTLLMVGYYNDNTFSSTLSLTNLTSFDVIKEENLNVGSSISSLLY 888

Query: 895  FGKNSTLLIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAG 954
            F KN TLL+ G+F  S+ +C+ LCLYNYK+ +W + AN+S++G V  +QL  +  +L+ G
Sbjct: 889  FAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSVAALQLYQNDTILVLG 948

Query: 955  SLRVNGTSDVNLVSVNITGQGMKTLLRGWEGP--LRSFVVSEDRLVVWNDTSLMAYDNTS 1012
            +L +   +DVN+  VN++   + +L+   + P  L S +VS  R+V WNDT L ++D  S
Sbjct: 949  NLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLHSMIVSNSRIVAWNDTVLFSFDGNS 1008

Query: 1013 WRHISTSNS-TSFTKLQDIHQVSLEHSLEKRAXXXXXXXLDGLLVYGNDK-TQGDSYQAS 1070
            W  +S   + +S T +  +  +S+E +             D LL+ G  + ++    ++ 
Sbjct: 1009 WTRVSVPGTDSSATSISSVQFISMEGT------------DDALLLLGEFRHSEFGDIKSI 1056

Query: 1071 IYDYYSWTPLFIANSKSENSNSGPNIFMNQDVSDFFISEQMLPNPTNHTXXXXXXXXXXX 1130
            +Y++  W P ++         +G ++FMN+D+S   I++  L N T              
Sbjct: 1057 VYNFRDWIP-YLLYVDGPRQGTG-HLFMNRDISLHNIAQIPLLNSTRVLTNQSFASSTSS 1114

Query: 1131 XXXXXGDKKHRAS--------HKVDRGYVVLIGLALAXXXXXXXXXXXXXXAYMFGEDIG 1182
                      + S          VDRG+VVLIGLALA              AY+F +++G
Sbjct: 1115 SVSSTSTTLPKVSTTHSKPGRRIVDRGFVVLIGLALALATVSVMGVAGVLLAYIFRDNVG 1174

Query: 1183 -GYEFLSPPAEGTKAAETAPPAK 1204
              Y+ L+P  +      T PP K
Sbjct: 1175 DSYQTLNPRMDENAMVNTLPPEK 1197

>KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084C RAX2 N-glycosylated protein involved in the
            maintenance of bud site selection during bipolar budding
            localization requires Rax1p
          Length = 1200

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/1230 (34%), Positives = 668/1230 (54%), Gaps = 81/1230 (6%)

Query: 15   ITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNS 74
            +  GSQLS++++LLN S  + P  D     +  L  + +F++LT   YTGQ+NFT   N 
Sbjct: 17   MVRGSQLSNIEKLLNISRYEAPNWD-----SPDLTYMNNFEELTVISYTGQQNFTVQANE 71

Query: 75   STDSHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLT 134
            S+    L+YYSNDTF++L   S +T +  IVPL EDSFILSG+G I+G  L++Q+  NLT
Sbjct: 72   SS----LLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVALEQQILLNLT 127

Query: 135  DLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIG 194
             L+  PIF   +  V  IL     V F GNF+ S  ++TGH  VLW+   N+T L PF G
Sbjct: 128  SLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVANTTELFPFKG 187

Query: 195  FGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDVELGLAIPL 254
            FG+NS VNS+++L+ DNILFAG+F E+ +  LL+    G+  +SS  + T ++   ++PL
Sbjct: 188  FGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQE--FGNATNSSHEDLTSLQFDQSVPL 245

Query: 255  QNANWTSSSSQFDADDFICPDPERESWLQS-GTSGSLACSLPQETTPYKIRIYNSPVEDN 313
            + ++ T  + Q  +D  +CP   +  W  S     +L   L  E  P K+RIYNS  E++
Sbjct: 246  KLSSITGENVQ--SDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIYNSVEENS 303

Query: 314  EVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEAXXXXXXVENMTTFS 373
            E+SLFRI+  P+ GI+NL+Y+DP  GEL+ CDA+CPL + + L +               
Sbjct: 304  EISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAAPKSVGI- 362

Query: 374  DNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLN 433
            +NN+T++KW   +QEFAFVN++P++ ++FVAL+SYGSN  L S + F++   +YANNS N
Sbjct: 363  NNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMVYANNSYN 422

Query: 434  QPACGKMQSYSNATISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPGNYSIKL 493
            +P C  +  YS A +S+++W       TY+ST+ ++D  NIP VTFHP I YPG Y+  +
Sbjct: 423  EPNCESVTEYSKAELSSDNWYTTDESDTYISTN-IDD--NIPYVTFHPNITYPGRYTFNI 479

Query: 494  YTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPKVTL 553
            YTPGCL D +C++R IVNVT+ D   NE L+S +IY+ NNE K+D L+ G L S+P++ +
Sbjct: 480  YTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSLGSAPEIIV 539

Query: 554  EYHSPIYPNNPTSVVVADYISLEAKSFDHFEKHKKDIT--LNGIFQYQISNFTKNI--TK 609
             +   I  ++  SV+V D + +  +  D       D T  LNG+FQY  +N T +I  T 
Sbjct: 540  TWDKAIGESD--SVMVVDRLGVITEYIDTISISSNDTTFHLNGLFQYNTANVTASIFSTN 597

Query: 610  ESIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSSKSFNL 669
            ++  + +L  FPL     +++L+A+   ND +L+  + +  A+++L+    + SS+    
Sbjct: 598  DTFNDYALYNFPL-----DANLYAASLNND-ILIGGNFNGIAKVELNDEALISSSQKLGT 651

Query: 670  ASQVRGIGSYSDGLILFGDY---NSSQRQPLALSFNG-SFNSYDKINRSVERFTNIDLKG 725
            +    GI  YS+GL+L G Y   N S+ +   LS++G +FNS+ +++  ++R  N  + G
Sbjct: 652  SGYTTGIFEYSNGLLLSGTYQVENDSRHE--ILSYDGNAFNSFGQLDEPIDRIVNFTIDG 709

Query: 726  TELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPVS 785
             ELL+FDN + +NVS+  YVSN++ F ++  SAG N+  D +  G+        L G  S
Sbjct: 710  HELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLKRSVGELNGLAS 769

Query: 786  LFQNGSAVSSNIKD---NINPYMGAYLNDTLTAYAYKDGS----DSRIVFSNGDEGP--- 835
            L  +G   S  + +   ++ PY  AY+NDT  AYA ++GS      R++ +N +      
Sbjct: 770  LSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVLITNTNSSSHML 829

Query: 836  -WRWTNSIETMIYRNRDALLAX----XXXXXXXXXXXXXXXXTTSEVLANETLDKGAEVN 890
              +W+  I   +Y N   +LA                     T  E +A         VN
Sbjct: 830  QIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENVARVNFSTNERVN 889

Query: 891  SMILFGKNSTLLIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSE- 949
            SM+ F  N+++L+GG++   +  CN LCLYNY+ K W++F NDSITG + Q+Q  +  + 
Sbjct: 890  SMVSFSSNNSILVGGSYEIDN--CNDLCLYNYQTKEWTSFLNDSITGDIRQMQFADEGKT 947

Query: 950  LLIAGSLRVNGTSDVNLVSVNITGQGMKTLLRGWEGPLRSFVV---SEDRLVVWNDTSLM 1006
            LL+ G ++ N  S++ L+SV +      T+  G E PL SFV    S D ++   ++ ++
Sbjct: 948  LLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTE-PLLSFVPIDDSTDNIIAQMNSEIL 1006

Query: 1007 AYDNTSWRHIST-----SNSTSFTKLQDIHQVSLEHSLEKRAXXXXXXXLDGLLVYGNDK 1061
              ++ +W          S  + F  L            +KR        L+G L    + 
Sbjct: 1007 RLESGTWSSFGPQLNNDSIVSGFKVLSGTES-------KKRDEGSHIVLLEGTL----NS 1055

Query: 1062 TQGDSYQASIYD--YYSWTPLFIANSKSENSNSGPNIFMNQDVSDFFISEQMLPNPTNHT 1119
            ++  +  + +YD     W P F+ +   E   S P+    Q+V+D ++S       +N++
Sbjct: 1056 SEWGNLTSVVYDGSTQKWQPYFVISDPKEQE-SLPSSSFFQNVNDLYLSSSQTVLQSNNS 1114

Query: 1120 XXXXXXXXXXXXXXXXGDKKHRASHKVDRGYVVLIGLALAXXXXXXXXXXXXXXAYMFGE 1179
                               K +   K+DRG++VLIGLALA               Y F  
Sbjct: 1115 DTSASSTPTPSTTSSSHSTKDK---KIDRGFIVLIGLALALATVAVIGLIGALICYFFIN 1171

Query: 1180 DIGGYEFLSPPAEGTKAAETAPPAKSSKFL 1209
            +  GYE L P     +  +T PP K  KF+
Sbjct: 1172 N-NGYESLKPRINQDEMLDTVPPEKLMKFI 1200

>CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084c
          Length = 1156

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/1187 (35%), Positives = 636/1187 (53%), Gaps = 47/1187 (3%)

Query: 38   LDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNSSTDSHGLIYYSNDTFLQLANGSN 97
            L+ +SSRN  ++LLG  +   +Y Y GQ+NFT+  +SS +   LIYYSN+T L+L     
Sbjct: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTA-SSSQNELELIYYSNNTLLRLDAVPT 60

Query: 98   DTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLTDLSFKPIFQEGLTEVNSILVDQP 157
            D +++ I+P  +D FILSG G I G  L RQ+  NLT LS++PIF++ L  V SI VD  
Sbjct: 61   DVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNE 120

Query: 158  LVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIGFGQNSTVNSIIRLDRDNILFAGN 217
            +VYFGG+ T++N   +G SVV WNS  NS+SLLPF GFG NSTVNSIIRL+ +N+LF G 
Sbjct: 121  VVYFGGDITYNNNGVSGRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLENNNLLFTGQ 180

Query: 218  FYELDDVKLLENHILGSNNSSSKSNWTDVELGLAIPLQNANWTSSSSQFDADDFICPDPE 277
            F +L++   +       N S S     D E+G  I L+ A W +++S  D D FICP+ +
Sbjct: 181  FAKLENNSFVSKTNRTRNFSISME---DSEVGQQISLRQATW-NANSNLDVDAFICPNSD 236

Query: 278  RESWLQSGTSGSLACSLPQETTPYKIRIYNSPVEDNEVSLFRILAEPTKGILNLSYVDPE 337
            +++W   G+ G + C+ P   T  KIRIYN+P+ DN++SLFR++A P  GILNL+Y+DP 
Sbjct: 237  QQAWYSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPI 296

Query: 338  EGELRYCDAFCPLYNRQRLEEAXXXXXXVENMTTFSDNNTTDIKWGRDFQEFAFVNNVPI 397
              ++++C   CPL+ R+ L  A        ++  F +NN+T+IKW   +QEFAFVN +PI
Sbjct: 297  SHDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPI 356

Query: 398  SSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLNQPAC---GKMQSYSNATISNNDWR 454
            +S++FVA +SY  NVGLS +Q +Q    I+ NNS N+P C     + SY    +S N W 
Sbjct: 357  TSLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASY--VKLSGNGWF 414

Query: 455  QGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPGNYSIKLYTPGCLGDGTCNQRAIVNVTL 514
               N  +YL+ SY+ +QG  P +T+   I  PG Y + L TPGC  D TC+ R IVNVT 
Sbjct: 415  TVANDNSYLANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTT 474

Query: 515  WDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPKVTLEYHSPIYPNNPTSVVVADYIS 574
            +D  +   L S +IY+NNN LKYD+++ G L +S  V +EY+S I  N  T+ VV   + 
Sbjct: 475  FDNSNGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATVVVGVVD 534

Query: 575  LEAKSF-DHFEKHKKD----ITLNGIFQYQISNFT--KNITKESIGNTSLDVFPLSYFSN 627
            +   S    F   + D    + LNGIF+Y  SNFT         I  T LD F +S F+ 
Sbjct: 535  VVRVSISSEFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNFNK 594

Query: 628  NSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSSKSFNLASQVRGIGSYSDGLILFG 687
             +S+FA + +N  L L  +     E+      SV S+++ NL+  + G+ S  +GL++FG
Sbjct: 595  GASIFA-VDQNQNLYLGSTNGSVYELNSLNGSSVPSTEN-NLSGLINGMYSVEEGLVIFG 652

Query: 688  DYNSSQRQPLALSFNGSFNSYDKI-NRSVERFTNIDLKGTELLVFDNEFFYNVSSQSYVS 746
                  R+  A+  N S    D + N S++   N  L G+ LLVFDN   +N++S     
Sbjct: 653  SIAHRGREYGAVILNKSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTSFMVFE 712

Query: 747  NTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPVSLFQNGSAVSSNIKDNINPYMG 806
            NT+  +L + +AG+N+N D++  G + +         + +  NG+    ++ DN      
Sbjct: 713  NTSYRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTIEGA 772

Query: 807  AYLNDTLTAYAYKDGSDSRIVFSNGDEGPWRWTNSIETMIYRNRDALLAXXXXXXXXXXX 866
             YLNDT   Y+   G+ +    S+    PW W +++  + Y N   LL            
Sbjct: 773  IYLNDTKALYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLLGAIQENSNKSQI 832

Query: 867  XXXXXXTTSEV--LANETLDKGAEVNSMILFGKNSTLLIGGNFSFSDAHCNGLCLYNYKN 924
                  ++  +    N T+ K   +N+++ F  N+T L+GG+FS S+  C GLCLYNY N
Sbjct: 833  VLIDLFSSQVINDTGNLTMHK---INAIVNFASNATALVGGDFSLSNPACVGLCLYNYNN 889

Query: 925  KRWSTFANDSITGQVTQVQLRNSSELLIAGSLRVNGTSDVNLVSVNITGQGMKTLLRGWE 984
              WS+F N+SITG ++Q++  N +++L++G L VN T+D+NL+S+N+T      LL    
Sbjct: 890  SNWSSFLNNSITGNISQIKF-NDTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNS 948

Query: 985  GPLRSFVVSEDRLVVWNDTSLMAYDNTSWRHISTSNSTSFTKLQDIHQVSLEHSLEKRAX 1044
              L  F++  + +V WN T +   + T W +++  +  +   +  I     + +      
Sbjct: 949  VVLDDFILVRNLVVGWNSTDIFIRNVTQWSNLNIFDDGTNATINRIENFGADSN------ 1002

Query: 1045 XXXXXXLDGLLVYGN-DKTQGDSYQASIYDYYSWTPLFIANSKSENSNSGPNIFMNQDVS 1103
                     L++YG  D  +  +  A IYD+ SW P F  +  S+ +   P  F ++D S
Sbjct: 1003 -------PALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVVSQTAT--PLFFADRDQS 1053

Query: 1104 DFFISEQMLPNPTNHTXXXXXXXXXXXXXXXXGDKKHRASHKVDRGYVVLIGLALAXXXX 1163
             +  +  ++P+                       K +   +K+ RG+VVLIGLALA    
Sbjct: 1054 SYGNTRHVVPDHI----IVSSSHSSSAPSSSSSHKTNEKPYKIRRGFVVLIGLALALATL 1109

Query: 1164 XXXXXXXXXXAYMFGEDIGG-YEFLSPPAEGTKAAETAPPAKSSKFL 1209
                      A +F   + G Y+ +        A     P K  + L
Sbjct: 1110 IVLGITGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIRVL 1156

>Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] {ON}
            YLR084C (RAX2) - YLR084C [contig 176] FULL
          Length = 1213

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/1225 (34%), Positives = 669/1225 (54%), Gaps = 58/1225 (4%)

Query: 15   ITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNS 74
            + +G+ L+ ++  L   N +VP LDL+ S N+ ++LLG+FQ+L +Y+YTGQ+NFT  ++ 
Sbjct: 17   LCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRYTGQDNFTG-ISD 75

Query: 75   STDSHGLIYYSNDTFLQLANG--SNDT-DIKQIVPLGEDSFILSGSGHIDGYNLQRQLHY 131
                  LIY+SN T L+L++   SN++  +  ++PL +DSFILSG+G I G  L  Q+ +
Sbjct: 76   EKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISGAVLDHQVVF 135

Query: 132  NLTDLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLP 191
            NL+DLS+  IF + L+ VN+I V+    YFGG+F F    Q  H +++W+  KN    LP
Sbjct: 136  NLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIVWDFVKNEVETLP 195

Query: 192  FIGFGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDVELGLA 251
            F G G++S VNSI+ LD +NILFAGNF  +D+   L N  LG N++S  +     EL   
Sbjct: 196  FGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSAL-NSTLGINSTSDSA----PELSHK 250

Query: 252  IPLQNANWTSSSSQFDADDFICP-DPERESWLQSGTSGSLACSLPQETTPYKIRIYNSPV 310
            IPL+ A WTS  S    DD +CP +    +WL +GT+G    S+     P K+R++N+  
Sbjct: 251  IPLKTAKWTSDGS-LQKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIRPSKLRLHNART 309

Query: 311  EDNEVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEAXXXXXXVENMT 370
             D EVSLFR++  P+ GI+NL+Y+DP  GELR CDA+CPL + Q L  A       + + 
Sbjct: 310  LDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAKSKAASTDQVE 369

Query: 371  TFSDNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANN 430
                NN T ++W   +Q+FAFVN+VP++S+ F+AL SYGS+VG++ ++ ++   S+YAN+
Sbjct: 370  FL--NNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYEDDFSVYAND 427

Query: 431  SLNQPACGKMQSYSNATISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPGNYS 490
            S N P C    +YS A++S + W QG + + Y+ T  VE+    P VTF+PQI Y G Y+
Sbjct: 428  SFNVPDCSSTSNYSKASLSASQWDQGSSDEDYVYT-LVENSQEAPSVTFYPQIVYSGLYT 486

Query: 491  IKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPK 550
            I + TPGCL DG+C  R++VN +LWD ++   LSS  IY+NN+  KYD L+ G+L++  K
Sbjct: 487  INVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLYSGYLENEVK 546

Query: 551  VTLEYHSPIYPNNPTSVVVADYISLEAKSFDH--FEKHKKDITLNGIFQYQISNFTKNIT 608
            V LEY   I     + ++VA  IS+    FD   F    K   LNG+  Y +SN +  + 
Sbjct: 547  VVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGKLNGLLHYSLSNSSSYLQ 606

Query: 609  K-ESIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSSKSF 667
              +S  +T L  + +S F+ NS+ F   ++N  +L A S  K +++++D+ + V +  + 
Sbjct: 607  NFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFA-SSGKVSKLEIDQQFDVRTVTTE 665

Query: 668  NLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVERFTNIDLKGTE 727
             +  +V G+ ++S+GL + G ++ S +   A  +NGSF      + +V  FTN  L G E
Sbjct: 666  EVGDEVSGVFAFSEGLGVIGTFDGSTKG--AKFYNGSFFDIPLSHSNVTTFTNFTLDGAE 723

Query: 728  LLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPVSLF 787
            L+   N +  N ++ +   N+++ +L+  SAG N  G+ +F G+++ N+Y +L G   + 
Sbjct: 724  LVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGSLTRNEYTDLNGSFFI- 782

Query: 788  QNGSAVSSNIKDNINP--YMGAYLNDTLTAYAYKDGSDSRIVFSNGDEG----------- 834
             + S  SS ++ +     Y   Y++++ T YA+ D S      +NG  G           
Sbjct: 783  SSNSQSSSRLRGSQGRIWYDATYIDNSTTGYAFYDPSS-----TNGSYGVSIYKDMAKER 837

Query: 835  --PWRWTNSIETMIYRNRDALLAXXXXXXXXXXXXXXXXXTTSEVLANETLDKGAEVNSM 892
               +RWTN + +M+Y    +LLA                 TT E  A         +NS+
Sbjct: 838  DLSYRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNLTTGEDTATFEWKTNVSINSL 897

Query: 893  ILFGKNSTLLIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLI 952
            I F +N+++L+GG+F+ S+++C+GLCL++Y+ K WS F ++ I G +  +++ N S L++
Sbjct: 898  IFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIHSMKIFNKSSLVL 957

Query: 953  AGSLRVNGTSDVNLVSVNITGQGMKTLLRGWEGPLRSFVV--SEDRLVVWNDTSLMAYDN 1010
             G   +N T  VNL S+++T      L +G E  L    V    D LV  +   L    N
Sbjct: 958  GGFFDINDTKQVNLASMSLTDGSYNILHQGTETILDFIFVDGKVDNLVAVSANDLFRLTN 1017

Query: 1011 TSWRHISTS--NSTSFTKLQDIHQVSLEHSLEKRAXXXXXXXLDGLLVYGNDKTQGDSYQ 1068
             +W  IS    +S+ F  L +   +      +KR        + G L++   KT G    
Sbjct: 1018 NNWESISAQFDDSSVFGGLSEF-PIQQGGQNKKREEEKNSLLITGDLLH---KTYG-KIS 1072

Query: 1069 ASIYDYYSWTPLFIANSKSENSNSGPN-IFMNQDVSDFFISEQMLPNPTN---HTXXXXX 1124
            A++YD+  W P F     +     G + I+ N+D+S  F  + +L +       +     
Sbjct: 1073 AALYDFNDWIPYFSTTPATSTDGLGQSRIYSNKDISSAFNYQGVLQSSRGGNSSSVPSGT 1132

Query: 1125 XXXXXXXXXXXGDKKHRASHKVDRGYVVLIGLALAXXXXXXXXXXXXXXAYMFGEDIGGY 1184
                       G KK    +K+ RG+VVLIGLALA               + FG+    Y
Sbjct: 1133 SSPTSSSPSQLGAKK----NKIARGFVVLIGLALAMGTLAVMGVIGIALTFFFGKSSDKY 1188

Query: 1185 EFLSPPAEGTKAAETAPPAKSSKFL 1209
            + L P A+ ++  +T PP K  +F+
Sbjct: 1189 QSLEPRADESEMIDTVPPEKLMRFI 1213

>Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar to
            Ashbya gossypii AGR095W
          Length = 1212

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/1225 (34%), Positives = 645/1225 (52%), Gaps = 59/1225 (4%)

Query: 15   ITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNS 74
            +  GSQ++ +    N +    P LDL++ RN  L +  DFQ   +Y Y GQ+ FT   + 
Sbjct: 17   LAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTYKGQQIFTGLADE 76

Query: 75   STDSHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLT 134
              +S  LIYYSN+T++QLA   +  +IK+IVP G+DSFILSG G  +G+ L+ QL YNL+
Sbjct: 77   RKNS--LIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRGVFEGHRLEHQLIYNLS 134

Query: 135  DLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIG 194
                  I +E L  VN IL D  +VYFGG FT+++G+ +GHSVV W++   S+SLLPF G
Sbjct: 135  SFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDATDKSSSLLPFYG 194

Query: 195  FGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDVELGLAIPL 254
            FGQ S VN+II+LD  NILF G F  +D+  LL +  +   +SS  SN T++E      L
Sbjct: 195  FGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNV---SSSFLSNSTNIETNALASL 251

Query: 255  QNANWTSSSSQFDADDFICPDPERESW-LQSGTSGSLACSLPQETTPYKIRIYNSPVEDN 313
            + ++     +  ++  F+CP+   +SW +   T G L   +  + TP KIRIYNS   +N
Sbjct: 252  RFSSLVHDGT-LNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSKIRIYNSKDSNN 310

Query: 314  EVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEE-AXXXXXXVENMTTF 372
            +V+LFRI+  P++ I+N++YVDP  G L  CDA+CPL     L   A      V  M  F
Sbjct: 311  QVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENSTSSV--MAAF 368

Query: 373  SDNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSL 432
             +NN   +KW   +QEFAFVN VPI  + F+A+ S+G NVGL   + FQ+    Y NN+L
Sbjct: 369  PNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEYDTYVNNTL 428

Query: 433  NQPACGKMQSYSNATISNND-WRQGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPGNYSI 491
            NQP C   Q++  + +S +  W QGL  Q+Y++TS+   +   P VT  P I YPG Y++
Sbjct: 429  NQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGK---PSVTLTPSIPYPGIYTL 485

Query: 492  KLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPKV 551
             L TPGCL D TC  R IVNVT+    +   L +  IY+NN  LKYD L+ G+L  SP V
Sbjct: 486  NLVTPGCLTDNTCAFRGIVNVTI-RAQNGTHLMNRWIYQNNENLKYDPLFRGYLDDSPNV 544

Query: 552  TLEYHSPIYPNNPTSVVVADYISLEAKSFDHFEKH---KKDITLNGIFQYQISNFTKNIT 608
             LE+  PI P    +V+VAD ++    S +  E          LNG+FQY  SNFT    
Sbjct: 545  VLEWIGPIDPAAANNVMVADRVTSIIDSIEDLEMKNGTSNSNLLNGLFQYAASNFTNTNL 604

Query: 609  KESIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLA----DSKSKAAEIKLDKNWSVDSS 664
               +G+T++D +P+    ++SSLF  +Y NDTL +     D  +K +  K D N  +   
Sbjct: 605  STLVGSTNIDQYPVRNIPHSSSLFGQIY-NDTLFIGSPSIDGLAKISRRKDDWNDIIVDP 663

Query: 665  KSFNLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVERFTNIDLK 724
            +  +    V GI  YS+GL L    N +     +LSFNGS ++  + N       N+ + 
Sbjct: 664  QLIDTEGPVTGIFPYSNGLALTVHSNQTNMAS-SLSFNGSISTIFRSNAPSLSILNLTID 722

Query: 725  GTELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPV 784
            G+E+LVFDN + YNVSSQS +SN+    LS+ SAG N   DLI +G V    +    G +
Sbjct: 723  GSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNVQSTKHFVPNGAI 782

Query: 785  SLFQNGSAVSS----NIKDNINPYMGAYLNDTLTAYAYKD---GSDSRIVFSNGDEGPWR 837
            ++  + + V +    ++ D I  Y G ++ND+ +AYAY     GS    +   G+  P  
Sbjct: 783  AIDADSNEVVTSGLPSVDDGI-IYRGLFINDSSSAYAYYSKSLGSSKGGIVVYGEHEPEY 841

Query: 838  WT---NSIETMIYRNRDALLAXXXXXXXXXXXXXXXXXTTSEVLA-NETLDKGAEVNSMI 893
             +   +++  M+Y     LLA                  +++     ET + G  +N+M+
Sbjct: 842  LSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDLSADFAPIKETFEIGEVINTMV 901

Query: 894  LFGKNSTLLIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIA 953
            LFG+N TLL+GG  +F+   C  LCLYNY    W+ F + +ITG + Q+Q  + + L++A
Sbjct: 902  LFGRNYTLLVGG--TFTRNGCRDLCLYNYATNNWTRFMDGNITGDIRQLQFLDGNTLMVA 959

Query: 954  GSLRVNGTSDVNLVSVNITGQGMKTLLRGWEGPLRSFVV----SEDRLVVWNDTSLMAYD 1009
            G L  + + D+ LV ++++   + + L+G        V+    S   L+  +   +  + 
Sbjct: 960  GLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELIAHDGNQVFHFV 1019

Query: 1010 NTSWRHISTSNSTSFTKLQDIHQVSLEHSLEKRAXXXXXXXLDGLLVYGNDKTQ--GDSY 1067
            +  W++IS   S   T++  +  +S + S             + +++ GN  +   GD  
Sbjct: 1020 DGQWKNISPDTSGQ-TQINGLTLLSTDFSQRNSIMKRDRVGNELVVINGNFSSPDYGD-I 1077

Query: 1068 QASIYDYYSWTPLFIANSKSENSNS---GPNIFMNQDVSDFFISEQMLPNPTNHTXXXXX 1124
             A  YD+  W P + +  +  NS+       +F+N+DVS    S+  L N  ++      
Sbjct: 1078 NAMYYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLSNDNDNDDTPAA 1137

Query: 1125 XXXXXXXXXXXGDKKHRASHKVDRGYVVLIGLALAXXXXXXXXXXXXXXAYMFGEDIGGY 1184
                         +KH  + K+ + +VVLI LALA              AY+FG D   Y
Sbjct: 1138 SEPATH-------EKH--TKKLAKIFVVLIALALALATVAVLGVVGVLFAYLFG-DHNAY 1187

Query: 1185 EFLSPPAEGTKAAETAPPAKSSKFL 1209
            E L P     +  +T PP K  KF+
Sbjct: 1188 EPLKPRINEAEMLKTVPPEKLMKFI 1212

>AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR084C (RAX2)
          Length = 1201

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/1230 (33%), Positives = 617/1230 (50%), Gaps = 80/1230 (6%)

Query: 15   ITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNS 74
            +  GS L  + Q  +  + Q P+LDL+++RN+ L +  DFQ   +Y Y GQ+ FT     
Sbjct: 17   VVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFEYYNYKGQQLFTGQEQH 76

Query: 75   STDSHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLT 134
               S  LIYYS  T++QLA   +DT +++IVP G DSFILSG+G +    L+ QL YNL+
Sbjct: 77   QGSS--LIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTGKLQDQRLEHQLMYNLS 134

Query: 135  DLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIG 194
             L    I  + L  VN ILVD  +VYFGG FT+S+G+++GHS V WN+   +TSLLPF G
Sbjct: 135  TLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQWNATSRTTSLLPFGG 194

Query: 195  FGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDVELGLAIPL 254
            FG+ S+VN+I++L    +LF G F  L+     E   + ++    + N T +E      L
Sbjct: 195  FGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEKPQLNVTTIETNALTSL 254

Query: 255  QNANWTSSSSQFDADDFICPDPERESWL--QSG---TSGSLACSLPQETTPYKIRIYNSP 309
            + +  T S    D   FICP    +SW    SG     G L   +     P KIRIYNS 
Sbjct: 255  RYSTIT-SDGHLDKGKFICPTSNDDSWFVPHSGDGPARGELNIKVLHRIIPSKIRIYNSK 313

Query: 310  VEDNEVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEAXXXXXXVENM 369
               NE+ LFRI+  P++ I+N++Y+DP  GEL  CDA+CPL  R  L          +  
Sbjct: 314  KNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNLTSKAAESGPADVA 373

Query: 370  TTFSDNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYAN 429
               +D     IKW  D+QEFAF+N + +  ++F+AL SYG+NVGL   + FQ+    Y N
Sbjct: 374  RLVNDEKVL-IKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGVELFQTEYDAYVN 432

Query: 430  NSLNQPACGKMQSYSNATISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPGNY 489
            ++LNQP CG+ Q  S  + + N W QG    +YLS + VE     P V   P I + G Y
Sbjct: 433  STLNQPNCGE-QQLSPFSTTANIWHQGATDASYLSANVVESN---PMVNVKPVIPHSGTY 488

Query: 490  SIKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSP 549
            ++ LYTPGC  DGTC+ R IVNVTL   +    L +  IY+NN  LKYD L+ GHL  +P
Sbjct: 489  TLNLYTPGCEDDGTCDYRGIVNVTLLASNGTT-LMTRWIYQNNYRLKYDPLYTGHLDPNP 547

Query: 550  KVTLEYHSPIYPNNPTSVVVADYISLEAKSFDHFE--KHKKDITLNGIFQYQIS------ 601
             V +E+ SPI       ++VAD +S    S D  +  +H ++ +LNG+FQY  +      
Sbjct: 548  TVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPREKSLNGLFQYTPAGSSLDN 607

Query: 602  NFTKNITKESIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLD-KNWS 660
               K I K+          P +      SL   +Y+   +L   S    A +     +W+
Sbjct: 608  GIQKYINKD----------PQTDMPEGVSLVGQVYDGKLILGVKSTGHIAVVTPKGTDWN 657

Query: 661  -VDSSKSFNLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVERFT 719
             VD ++  ++   + GI  YS GL+  G +N S     AL ++G+F S+  +N       
Sbjct: 658  DVDVTRQ-DVPGSLNGISPYSKGLVFTGKFNLSSGPSSALHYDGNFGSFFDLNSETSSII 716

Query: 720  NIDLKGTELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYEN 779
            N+ + G+ELL+F+N+F YN S+   ++ ++ F LS  SA  N+N DL+F+G+++D  + +
Sbjct: 717  NMTIDGSELLLFNNKFIYNTSTSQMLT-SSMFQLSALSAAANSNNDLLFTGSIADIKHGS 775

Query: 780  LQGPVSLFQNGSAVSSNIK--DNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNG--DEGP 835
              G V+L   G+  +S          + G YLNDT TAYAY   S +  V + G   E P
Sbjct: 776  AHGAVALDAEGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVATGGVVIETP 835

Query: 836  ---WRWTNSIET---MIY-RNRDALLAXXXXXXXXXXXXXXXXXTTSEVLANETLDKGAE 888
               +  +N+I T   MIY +  + L+                   T + +A E L+ G  
Sbjct: 836  GNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEVAREKLNPGER 895

Query: 889  VNSMILFGKNSTLLIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSS 948
            +NS++LFG+++TLL+GG  SF    C+ LCLYN+  + WS FA+  I+G++ Q+Q  N+ 
Sbjct: 896  INSIVLFGEDNTLLVGG--SFEKDGCHDLCLYNFVKRSWSAFASGLISGEIKQLQFVNNR 953

Query: 949  ELLIAGSLRVNGTSDV-----NLVSVNITGQGMKTLLRGWEGPLRSFVVSEDRLVVWNDT 1003
             L+  GS+ V    ++     +LV   +  Q  +   R +   L +   S D  V  +  
Sbjct: 954  NLIAVGSMTVQSRPNILFLNFDLVRSRVVEQHEQPNGRAFNSVL-TIGDSGDEYVAEDGK 1012

Query: 1004 SLMAYDNTSWRHISTSNSTSFTKLQDIHQVSLEHSLEKRAXXXXXXXLDGLLVYGN-DKT 1062
             +  Y  + W+ + T  S    ++  I  + L +   +         L  ++++G  + +
Sbjct: 1013 QVWHYSGSEWKTV-TPLSGGQIRIDGISLLMLNNPRSQNKRNRVGNEL--VVIHGQMNSS 1069

Query: 1063 QGDSYQASIYDYYSWTPLF--IANSKSENSN-SGPNIFMNQDVSDFFISEQMLPNPTNHT 1119
            +     A  Y++ +W P +  I +S  E  N     IF+NQD+S               T
Sbjct: 1070 EYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQDIS-------------RQT 1116

Query: 1120 XXXXXXXXXXXXXXXXGDKKHRASHKVDRGYVVLIGLALAXXXXXXXXXXXXXXAYMFGE 1179
                             + K     K+ +GYVVLI L LA              AY FG 
Sbjct: 1117 TTSLPLEVVVSDSPPTAEPK----RKLAKGYVVLIALGLALATIALLGIIGVILAYAFG- 1171

Query: 1180 DIGGYEFLSPPAEGTKAAETAPPAKSSKFL 1209
            D   Y+ L P     +  +T PP K  KF+
Sbjct: 1172 DHNAYQPLKPRINEDEMLKTVPPEKLMKFI 1201

>Suva_4.194 Chr4 complement(345321..346406) [1086 bp, 361 aa] {ON}
           YDL055C (REAL)
          Length = 361

 Score = 35.4 bits (80), Expect = 0.87,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 34/67 (50%), Gaps = 2/67 (2%)

Query: 157 PLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIGFGQNSTVNSIIRLDRDNILFAG 216
           P V  G N T  +G +   SVVL NS   + +L+     G NSTV    RL+ D +L  G
Sbjct: 271 PDVVIGPNVTIGDGVRITRSVVLCNSTIKNHALVKSSIVGWNSTVGQWCRLEGDTVL--G 328

Query: 217 NFYELDD 223
           +  E+ D
Sbjct: 329 DDVEVKD 335

>TDEL0C02560 Chr3 (445830..447269) [1440 bp, 479 aa] {ON} Anc_1.483
           YEL040W
          Length = 479

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 5/58 (8%)

Query: 730 VFDNEFFYNVSSQSY--VSNTTRFSLSVWSAGQNTN--GDLIFSGAVSDNDYENLQGP 783
           +F NE  YN +SQ Y      +R  LS+W AG +TN  G + ++G + D D ++L+ P
Sbjct: 225 LFRNET-YNETSQRYEFPQTPSRVQLSIWPAGNSTNAPGTIAWAGGLIDWDADDLKDP 281

>Skud_4.199 Chr4 complement(351168..352253) [1086 bp, 361 aa] {ON}
           YDL055C (REAL)
          Length = 361

 Score = 33.5 bits (75), Expect = 3.0,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 2/67 (2%)

Query: 157 PLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIGFGQNSTVNSIIRLDRDNILFAG 216
           P V  G N T  +G +   SVVL NS   + SL+     G NSTV    RL+   +L  G
Sbjct: 271 PDVVIGPNVTIGDGVRITRSVVLCNSTIKNHSLVKSTIVGWNSTVGQWCRLEGVTVL--G 328

Query: 217 NFYELDD 223
           +  E+ D
Sbjct: 329 DDVEVKD 335

>Smik_4.179 Chr4 complement(332129..333214) [1086 bp, 361 aa] {ON}
           YDL055C (REAL)
          Length = 361

 Score = 33.5 bits (75), Expect = 3.0,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 2/67 (2%)

Query: 157 PLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIGFGQNSTVNSIIRLDRDNILFAG 216
           P V  G N T  +G +   SVVL NS   + SL+     G NSTV    RL+   +L  G
Sbjct: 271 PDVVIGPNVTIGDGVRITRSVVLCNSTIKNHSLVKSTIVGWNSTVGQWCRLEGVTVL--G 328

Query: 217 NFYELDD 223
           +  E+ D
Sbjct: 329 DDVEVKD 335

>YDL055C Chr4 complement(355674..356759) [1086 bp, 361 aa] {ON}
           PSA1GDP-mannose pyrophosphorylase (mannose-1-phosphate
           guanyltransferase), synthesizes GDP-mannose from GTP and
           mannose-1-phosphate in cell wall biosynthesis; required
           for normal cell wall structure
          Length = 361

 Score = 33.5 bits (75), Expect = 3.0,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 2/67 (2%)

Query: 157 PLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIGFGQNSTVNSIIRLDRDNILFAG 216
           P V  G N T  +G +   SVVL NS   + SL+     G NSTV    RL+   +L  G
Sbjct: 271 PDVVIGPNVTIGDGVRITRSVVLCNSTIKNHSLVKSTIVGWNSTVGQWCRLEGVTVL--G 328

Query: 217 NFYELDD 223
           +  E+ D
Sbjct: 329 DDVEVKD 335

>YDR141C Chr4 complement(734901..739997) [5097 bp, 1698 aa] {ON}
           DOP1Golgi-localized, leucine-zipper domain containing
           protein; involved in endosome to Golgi transport,
           organization of the ER, establishing cell polarity, and
           morphogenesis; detected in highly purified mitochondria
           in high-throughput studies
          Length = 1698

 Score = 33.9 bits (76), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 4/62 (6%)

Query: 337 EEGELRYCDAFCPL-YNRQRLEEAXXXXXXVENMTTFSDNNTTDIKWGRDFQEFAFVNNV 395
           E G L   + F PL Y+ ++ ++       ++   TF DN  T+I WG+ FQE   + N+
Sbjct: 422 EIGSLVIPELFIPLLYSSEKFKQ---NEQIMKTARTFFDNTETNIIWGKLFQELEDIKNL 478

Query: 396 PI 397
            I
Sbjct: 479 KI 480

>KNAG0D04310 Chr4 (780803..781888) [1086 bp, 361 aa] {ON} Anc_4.231
           YDL055C
          Length = 361

 Score = 33.1 bits (74), Expect = 5.0,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 2/67 (2%)

Query: 157 PLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIGFGQNSTVNSIIRLDRDNILFAG 216
           P V  G N T   G +   SVVL NS  ++ SL+     G NSTV    RL+   +L  G
Sbjct: 271 PDVVIGPNVTIGEGVRIERSVVLANSTISNHSLVKSTIVGWNSTVGKWCRLEGVTVL--G 328

Query: 217 NFYELDD 223
           +  E+ D
Sbjct: 329 DDVEVQD 335

>TBLA0A08130 Chr1 complement(2009133..2010218) [1086 bp, 361 aa]
           {ON} Anc_4.231 YDL055C
          Length = 361

 Score = 32.3 bits (72), Expect = 6.6,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 40/91 (43%), Gaps = 13/91 (14%)

Query: 144 EGLTEVNSILVDQ-----------PLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPF 192
           +G   V S+LVD            P V  G N    +G++   SV+L NS     +L+  
Sbjct: 247 KGTNVVGSVLVDSTAKIASTAKIGPNVTIGPNVIIGDGARIAGSVILANSNVKDHALVKN 306

Query: 193 IGFGQNSTVNSIIRLDRDNILFAGNFYELDD 223
              G NSTV    RL+   +L  G+  E+ D
Sbjct: 307 TIVGWNSTVGKWARLEGCTVL--GDDVEVKD 335

>NDAI0D04440 Chr4 complement(1043289..1044374) [1086 bp, 361 aa]
           {ON} Anc_4.231 YDL055C
          Length = 361

 Score = 32.3 bits (72), Expect = 6.8,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 27/57 (47%)

Query: 157 PLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIGFGQNSTVNSIIRLDRDNIL 213
           P V  G N T  +G +   SVVL NS     SL+     G NSTV    RL+   +L
Sbjct: 271 PNVVIGPNVTIGDGVRIERSVVLANSNIKEHSLVKSTIVGWNSTVGRWCRLEGVTVL 327

>NCAS0A02430 Chr1 (459091..460176) [1086 bp, 361 aa] {ON} Anc_4.231
           YDL055C
          Length = 361

 Score = 32.3 bits (72), Expect = 8.0,   Method: Composition-based stats.
 Identities = 25/70 (35%), Positives = 32/70 (45%), Gaps = 7/70 (10%)

Query: 157 PLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIGFGQNSTVNSIIRLDRDNILFAG 216
           P V  G N T  +G +   SVV+ NS     SL+     G NSTV    RL+   +L   
Sbjct: 271 PDVVIGPNVTIGDGVRIERSVVMANSSVKEHSLVKSTIVGWNSTVGRWCRLEGVTVLG-- 328

Query: 217 NFYELDDVKL 226
                DDVK+
Sbjct: 329 -----DDVKV 333

>KLLA0E05853g Chr5 complement(520702..522591) [1890 bp, 629 aa] {ON}
           similar to uniprot|P47147 Saccharomyces cerevisiae
           YJR110W YMR1 Phosphatidylinositol 3-phosphate
          Length = 629

 Score = 32.3 bits (72), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 57/122 (46%), Gaps = 17/122 (13%)

Query: 70  SPLNSSTDSHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQL 129
           S LNS   S  L Y      ++L   S DT +K IV    +S IL      DG++   Q+
Sbjct: 330 SMLNSDKSSSWLKY------IKLLLSSTDTLVKSIV--FNNSNILVHCS--DGWDRTAQI 379

Query: 130 HYNLTDLSFKPIFQ--EGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNST 187
             +L  LS  P ++  EG      +LV++  + FG  F   +G  + HSV   NS + S 
Sbjct: 380 T-SLVQLSLDPYYRTIEGFM----VLVEKDWLAFGHRFCERSGHLSSHSVFHDNSTRLSI 434

Query: 188 SL 189
           +L
Sbjct: 435 AL 436

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
           (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score = 32.3 bits (72), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 710 KINRSVERFTNIDLKGTEL--LVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLI 767
           ++  S+ER   ++ K +EL  L+ D +   NVS++   +  TRF+    SA  N N DLI
Sbjct: 860 QLEESLERLKPLETKISELNILIEDKDNIINVSNEKAENWKTRFNELTLSAKNNDNEDLI 919

Query: 768 -FSGAVSDNDYEN 779
                V +   EN
Sbjct: 920 NLQKQVEEKSKEN 932

>Skud_12.277 Chr12 complement(513291..514559) [1269 bp, 422 aa] {ON}
           YLR213C (REAL)
          Length = 422

 Score = 32.0 bits (71), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 44/102 (43%), Gaps = 5/102 (4%)

Query: 679 YSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVERFT-NIDLKGTELLVFDNEFFY 737
           YS G++   DY   QR P+      ++++Y+ I+   ER    +D +    ++  + +  
Sbjct: 235 YSQGML---DYTRMQRYPVGADTWSTYHNYE-IDWDSERIIWYVDGRMARTVLKKDTWDP 290

Query: 738 NVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYEN 779
                 Y     R  ++VW  G  TNG    + A    D+EN
Sbjct: 291 INKEYRYPQTPMRLEVAVWPGGSETNGPGTINWAGGLIDWEN 332

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 134,263,765
Number of extensions: 6399738
Number of successful extensions: 14487
Number of sequences better than 10.0: 73
Number of HSP's gapped: 14702
Number of HSP's successfully gapped: 76
Length of query: 1209
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1088
Effective length of database: 39,606,813
Effective search space: 43092212544
Effective search space used: 43092212544
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 72 (32.3 bits)