Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C01782g8.257ON73070336500.0
TDEL0F038408.257ON72670125710.0
SAKL0H17160g8.257ON73970525170.0
Kwal_56.236078.257ON72569824370.0
KLTH0G13794g8.257ON72569524370.0
KLLA0F19041g8.257ON76374324100.0
Suva_2.2698.257ON72570121510.0
Skud_4.3708.257ON71469221370.0
YDR109C8.257ON71569521300.0
Smik_4.3558.257ON70469821210.0
NDAI0J014008.257ON58853418100.0
Kpol_392.98.257ON59452717360.0
Ecym_43138.257ON59752517350.0
TBLA0E044008.257ON58953217260.0
NCAS0B038708.257ON59653017090.0
KAFR0B055608.257ON60553216890.0
KNAG0H032608.257ON58051916300.0
CAGL0B01727g8.257ON57752216060.0
AGR092W8.257ON59652815700.0
TPHA0B032408.257ON58552115050.0
Suva_14.931.111ON5435345128e-56
Skud_14.891.111ON5695304628e-49
ZYRO0F16016g1.111ON5425384591e-48
TDEL0C059001.111ON5435404512e-47
YNL249C (MPA43)1.111ON5425344467e-47
Smik_14.861.111ON5435324372e-45
SAKL0C03432g1.111ON5475354212e-43
KLTH0F03080g1.111ON5335324132e-42
Kwal_33.135301.111ON5345374096e-42
KNAG0F006601.111ON5355373593e-35
KLLA0C02937g1.111ON5165053052e-28
NCAS0A007801.111ON5495831636e-11
KAFR0F029502.385ON34287723.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C01782g
         (730 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} simila...  1410   0.0  
TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {O...   994   0.0  
SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} simi...   974   0.0  
Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {...   943   0.0  
KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} simi...   943   0.0  
KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]...   932   0.0  
Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON...   833   0.0  
Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON...   827   0.0  
YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON} P...   825   0.0  
Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON...   821   0.0  
NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8....   701   0.0  
Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON} (24389..26...   673   0.0  
Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar t...   672   0.0  
TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa] ...   669   0.0  
NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257    662   0.0  
KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON} Anc_8...   655   0.0  
KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.2...   632   0.0  
CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {...   623   0.0  
AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic ho...   609   0.0  
TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.2...   584   0.0  
Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {O...   201   8e-56
Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {O...   182   8e-49
ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} simi...   181   1e-48
TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON} Anc_1...   178   2e-47
YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON} ...   176   7e-47
Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {O...   172   2e-45
SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {...   166   2e-43
KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {...   163   2e-42
Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {...   162   6e-42
KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {O...   142   3e-35
KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {...   122   2e-28
NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {O...    67   6e-11
KAFR0F02950 Chr6 complement(583768..584796) [1029 bp, 342 aa] {O...    32   3.7  

>ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 730

 Score = 1410 bits (3650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 679/703 (96%), Positives = 679/703 (96%)

Query: 28  EQRMIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYC 87
           EQRMIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYC
Sbjct: 28  EQRMIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYC 87

Query: 88  VKTVVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQ 147
           VKTVVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQ
Sbjct: 88  VKTVVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQ 147

Query: 148 ETAEINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGL 207
           ETAEINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGL
Sbjct: 148 ETAEINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGL 207

Query: 208 GTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRS 267
           GTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRS
Sbjct: 208 GTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRS 267

Query: 268 NFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKG 327
           NFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKG
Sbjct: 268 NFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKG 327

Query: 328 KLGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALL 387
           KLGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALL
Sbjct: 328 KLGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALL 387

Query: 388 AHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGN 447
           AHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGN
Sbjct: 388 AHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGN 447

Query: 448 RSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMS 507
           RSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMS
Sbjct: 448 RSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMS 507

Query: 508 GGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTDLRKRRA 567
           GGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTDLRKRRA
Sbjct: 508 GGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTDLRKRRA 567

Query: 568 SSLGSKDQAIAXXXXXXXXXXXXXQTDQPSPYTAPHATSSSHMGGGSYFPIVGSDAAANL 627
           SSLGSKDQAIA             QTDQPSPYTAPHATSSSHMGGGSYFPIVGSDAAANL
Sbjct: 568 SSLGSKDQAIAGLGKGGLSKLSELQTDQPSPYTAPHATSSSHMGGGSYFPIVGSDAAANL 627

Query: 628 SPGXXXXXXXXXXXPVTFKSVKSTTQENLAEKTDTNSNGEELWKVMYDMTGGGKVVRPNP 687
           SPG           PVTFKSVKSTTQENLAEKTDTNSNGEELWKVMYDMTGGGKVVRPNP
Sbjct: 628 SPGEAIAETEDEEEPVTFKSVKSTTQENLAEKTDTNSNGEELWKVMYDMTGGGKVVRPNP 687

Query: 688 DTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRVEANLKAQITK 730
           DTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRVEANLKAQITK
Sbjct: 688 DTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRVEANLKAQITK 730

>TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {ON}
           Anc_8.257 YDR109C
          Length = 726

 Score =  994 bits (2571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/701 (69%), Positives = 569/701 (81%), Gaps = 15/701 (2%)

Query: 28  EQRMIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYC 87
           EQ MIYY+GVDVGTGSARAC+ID+ GNI+SLAEKPIQREELKP YITQSS+EIW +IC+C
Sbjct: 29  EQAMIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHC 88

Query: 88  VKTVVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQ 147
           VK+VVRDSGV +ERIHGIGFDATCSLV V+ +D  +V VGP F N DQNI+LWMDHRA+ 
Sbjct: 89  VKSVVRDSGVPVERIHGIGFDATCSLVVVDDED-KEVGVGPVFANNDQNIVLWMDHRAIA 147

Query: 148 ETAEINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGL 207
           ET EIN+TN   LKYVGGQMS+EMEIPKIKWLKN++P+E+F+   FFDLAD+LT+KAT  
Sbjct: 148 ETNEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNK 207

Query: 208 GTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAK-LGGSVKPKGDDHR 266
            TRSF S+VCKQGL+P+GVEGS  GWS +FLN I+LPELV N F +    +     D   
Sbjct: 208 DTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTT 267

Query: 267 SNFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEK 326
            +FLSAG+YVGAL  EAA +LGL  HCVVGSGVIDAYAGWVGTVAAQTD E+P+LA+ ++
Sbjct: 268 HSFLSAGEYVGALDEEAAEELGLPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADR 327

Query: 327 GKLGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGAL 386
            K G+D+ATGRLAAVAGTSTCH+ALSRDP+FV GVWGPYRDVMA GFW AEGGQSCTGAL
Sbjct: 328 TKKGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGAL 387

Query: 387 LAHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHG 446
           LAHV+STHPA+T+L HLS++A +SKFDYLNSRLE LV  R +RSVVALAKHL+FYGDYHG
Sbjct: 388 LAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHG 447

Query: 447 NRSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFM 506
           NRSPIAD +MRAAIIGQSMDNS+DDLA+ YLGACEFIAQQTRQIVE MC +GH IS+IFM
Sbjct: 448 NRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFM 507

Query: 507 SGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTDLRKRR 566
           SGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASES+N+HH K+++ +RR
Sbjct: 508 SGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFNSHHAKSEITRRR 567

Query: 567 ASSLGSKDQAI--AXXXXXXXXXXXXXQTDQPSPYTAPHATSSSHM---GGGSY-FPIVG 620
            SSL + D +   +             + D PSPYTAPHATSS+       GS+ FP+VG
Sbjct: 568 KSSLTNLDPSSLPSASGKGPLSQLGKMKPDLPSPYTAPHATSSTSQIAATSGSFPFPVVG 627

Query: 621 SDAAANLSPGXXXXXXXXXXXPVTFKSVKSTTQENLAEKTDTNSNGEELWKVMYDMTGGG 680
             + A                PV+FK  ++T+QE LA +   N NG+ LW VMY MTGGG
Sbjct: 628 ESSEA------ITEEANDSEGPVSFKPTRATSQEGLATRNPPN-NGDALWDVMYQMTGGG 680

Query: 681 KVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRVE 721
           KVVRP+P+ +PDRVLLNAKYKIFLDMA++QR+YR AID+VE
Sbjct: 681 KVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVE 721

>SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein of unknown function and similar to
           uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 739

 Score =  974 bits (2517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/705 (67%), Positives = 552/705 (78%), Gaps = 16/705 (2%)

Query: 28  EQRMIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYC 87
           + +M YY+GVDVGTGSARAC+ID+MGNI+SLAE+PIQR+ELKP+YITQSS+EIW AICYC
Sbjct: 29  QNKMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYC 88

Query: 88  VKTVVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQ 147
           VK+VV+DSGV  E+IHGIGFDATCSLV V      +V VGPDF N +QNIILWMDHRA+ 
Sbjct: 89  VKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAID 148

Query: 148 ETAEINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGL 207
           ET EIN+TN   LKYVGGQMS+EMEIPKIKWLKN++PREKF    FFDLAD+LT+KATGL
Sbjct: 149 ETKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGL 208

Query: 208 GTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRS 267
            TRS+ S+VCKQGLLP+GVE S  GWS EFL  I L +L  +DF KLGGS+K  G    S
Sbjct: 209 ETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLGGSIKSDGSGG-S 267

Query: 268 NFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKG 327
            FLSAG+ +G+L P AA +LGL  HCVVGSGVIDAYAGWVGTVAA+TD +IPEL + +  
Sbjct: 268 TFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNE 327

Query: 328 KLGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALL 387
           K G+D ATGRLAAVAGTSTCH+A+S+DPIFV GVWGPYRDVMAPGFWCAEGGQSCTGALL
Sbjct: 328 KTGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALL 387

Query: 388 AHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGN 447
           AHVL+ HPAYT+L HLS++A +SKFDYLNSRLE L   R  RSVVALAKHLFFYGDYHGN
Sbjct: 388 AHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGN 447

Query: 448 RSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMS 507
           RSPIAD +MRAA+IGQSMDNS+DDLA+ YLGACEFIAQQTRQIVE M  SGH I++IFMS
Sbjct: 448 RSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMS 507

Query: 508 GGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTDLRKRRA 567
           GGQCRNGLLMRLLADCTGLPI+IPRYIDAAVVFGSALLGAVASES+N +H    L +RR 
Sbjct: 508 GGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLNHKSGSLSRRRK 567

Query: 568 SSLGS-----KDQAIAXXXXXXXXXXXXXQTDQPSPYTAPHATSSSHM----GGGSYFPI 618
           SSL       KD                   D PSPYTAP AT+S+       GG  FP+
Sbjct: 568 SSLSGKYEEFKDSMEIPKKNFLSKLGGTASGDLPSPYTAPSATASTSQIASTVGGFPFPV 627

Query: 619 VGSDAAANLSPGXXXXXXXXXXXPVTFKSVKSTTQENLA-EKTDTNS-NGEELWKVMYDM 676
              D+ A +               ++F S K+T QE LA EK  + S  G+ LW VMY+M
Sbjct: 628 TSDDSVAIIE----EDDPEEANAALSFGSKKATAQEQLALEKEKSASGKGDALWDVMYNM 683

Query: 677 TGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRVE 721
           TGGGKVV+P+ D +PDRVLL+AKYKIFLDMA TQR+YR A+D+VE
Sbjct: 684 TGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVE 728

>Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {ON}
           YDR109C - Hypothetical ORF [contig 176] FULL
          Length = 725

 Score =  943 bits (2437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/698 (65%), Positives = 544/698 (77%), Gaps = 7/698 (1%)

Query: 28  EQRMIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYC 87
           +Q+M+YYIGVDVGTGSARAC+IDSMGNI+SLAE+PIQRE+LKP +ITQSS+EIW A+C+C
Sbjct: 29  QQKMLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHC 88

Query: 88  VKTVVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQ 147
           VK+VVRDSGV  E+IHGIGFDATCSLV V      +V VGPDF+N +QNIILWMDHRA++
Sbjct: 89  VKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIE 148

Query: 148 ETAEINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGL 207
           ET +IN+T    LKYVGGQMS+EMEIPKIKWLKNH+P  KF++  FFDLAD+LT+KA+G 
Sbjct: 149 ETEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGK 208

Query: 208 GTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRS 267
            TRSF S+VCKQGLLP+GVEGS  GWS EFL  I L + + +DF K+GGSVK    D   
Sbjct: 209 ETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVK--NSDKGK 266

Query: 268 NFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKG 327
           NFLSAG++VGA+ P  A +LGL++HCVVGSGVIDAYAGWVGTVAA+TD  IP L K ++ 
Sbjct: 267 NFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQE 326

Query: 328 KLGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALL 387
           K+G+D+ATGRLAAVAGTSTCH+A+SRDPIFV GVWGPYRD +A  FWCAEGGQSCTGALL
Sbjct: 327 KVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALL 386

Query: 388 AHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGN 447
           AHV++THPAYT+L  L+++A +SKFDYLNSRLE L   +K RSVV LA+HLFFYGDYHGN
Sbjct: 387 AHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGN 446

Query: 448 RSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMS 507
           RSPIAD +MRAAIIGQSMDNS+DDLAL YLGACEFIAQQTRQIVE M  SGH++++IFMS
Sbjct: 447 RSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMS 506

Query: 508 GGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTDLRKRRA 567
           GGQCRNGLLMRLLADCTGLPI+IPRYIDAAVVFGSALLGAVASES++   T ++L   R 
Sbjct: 507 GGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSELSVSRK 566

Query: 568 SSL-GSKDQAIAXXXXXXXXXXXXXQTDQPSPYTAPHAT-SSSHMGGGSYFPIVGSDAAA 625
           SS+ G                      D PSPYTAP AT S+S +     FP    D   
Sbjct: 567 SSIAGHPTDGSQPKKSAVSKLGQFGSDDLPSPYTAPSATASTSQIASTVGFPFPTPDDPY 626

Query: 626 NLSPGXXXXXXXXXXXPVTFKSVKSTTQENLAEKTDTNS--NGEELWKVMYDMTGGGKVV 683
            L               + FK+  S  ++++ ++    S  NG+ +W VMY+MTGGGKVV
Sbjct: 627 ALGEQTEPDADNDNSSELNFKA-HSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTGGGKVV 685

Query: 684 RPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRVE 721
           +P P+ NPDR LL+ KYKIFLDMA TQR+YR+ ++ VE
Sbjct: 686 QPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVE 723

>KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 725

 Score =  943 bits (2437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/695 (65%), Positives = 542/695 (77%), Gaps = 7/695 (1%)

Query: 28  EQRMIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYC 87
           +Q+M+YY+GVDVGTGSARAC+IDSMGNI+SLAE+PIQRE+LK  +ITQSS+EIW A+C+C
Sbjct: 29  QQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHC 88

Query: 88  VKTVVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQ 147
           VK+VVRDSGV  E+IHGIGFDATCSLV V  +   +V VGPDF N DQNIILWMDHRA++
Sbjct: 89  VKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIE 148

Query: 148 ETAEINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGL 207
           ET  IN+T    LKYVGGQMS+EMEIPKIKWLKNH+P  KFN+  FFDLAD+LT+KA+G 
Sbjct: 149 ETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGK 208

Query: 208 GTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRS 267
            TRSF S+VCKQGLLP+GVEGS  GWS EFL  I L EL+ +DF ++GGSVK    D   
Sbjct: 209 ETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVK--NSDKGK 266

Query: 268 NFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKG 327
           NFLSAG+++GA+    A +LGL++HCVVGSGVIDAYAGWVGTVAA+TD  IP L K ++ 
Sbjct: 267 NFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQE 326

Query: 328 KLGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALL 387
           K+G+D+ATGRLAAVAGTSTCH+A+SRDPIFV GVWGPYRD +A  FWCAEGGQSCTGALL
Sbjct: 327 KVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALL 386

Query: 388 AHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGN 447
           AHVL+THPAYT+L  L+++A +SKFDYLNSRLE L   +K RSVV LAKHLFFYGDYHGN
Sbjct: 387 AHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGN 446

Query: 448 RSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMS 507
           RSPIAD +MRAAIIGQSMDNS+DDLAL YLGACEFIAQQTRQIV+ MC SGH++S+IFMS
Sbjct: 447 RSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMS 506

Query: 508 GGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTDLRKRRA 567
           GGQCRNGLLMRLLADCTGLPI+IPRYIDAAVVFGSALLGAVASES++   T + L   R 
Sbjct: 507 GGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSALSVSRK 566

Query: 568 SSL-GSKDQAIAXXXXXXXXXXXXXQTDQPSPYTAPHAT-SSSHMGGGSYFPIVGSDAAA 625
           SS+ G    A                 D PSPYTAP AT S+S +     FP    + A 
Sbjct: 567 SSIAGEPANAGQPKKSAVSKFGQLGGDDLPSPYTAPSATASTSQIASTIGFPFPTPEDAY 626

Query: 626 NLSPGXXXXXXXXXXXPVTFKSVKSTTQENLAEKTDTNS--NGEELWKVMYDMTGGGKVV 683
            +               + FK+  S  ++++ ++    S  NG+ +W VMY+MTGGGKVV
Sbjct: 627 AIDEHVEQEKDEGESTELNFKA-HSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTGGGKVV 685

Query: 684 RPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAID 718
           +P  + N DRVLLNAKYKIFLDMA TQR+YR+ +D
Sbjct: 686 QPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVD 720

>KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]
           {ON} similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 763

 Score =  932 bits (2410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/743 (62%), Positives = 548/743 (73%), Gaps = 59/743 (7%)

Query: 28  EQRMIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYC 87
           E++M+YY+GVDVGTGSARAC+ID++GNI+SLAE+PIQR ELKP YITQSS+EIW+AICYC
Sbjct: 31  ERKMVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYC 90

Query: 88  VKTVVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQ 147
           VK VVRDSGVD   IHGIGFDATCSLV V++ +  DV VGPDF +  QNIILWMDHRA++
Sbjct: 91  VKNVVRDSGVDPRTIHGIGFDATCSLVVVDNNN-EDVGVGPDFTDNLQNIILWMDHRAIE 149

Query: 148 ETAEINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGL 207
           ET EIN+T    LKYVGGQMS+EMEIPKIKWLKN++P +KF    FFDLAD+LT+KATG 
Sbjct: 150 ETEEINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGS 209

Query: 208 GTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRS 267
             RS+ S+VCKQGLLPLGVEGS NGWS EFL  I L EL+A+DFAKLGGSV        +
Sbjct: 210 EIRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVT------ET 263

Query: 268 NFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKG 327
            FLSAG+ +G L+ E+AA+LGL+ HCVVGSGVIDAYAGWVGTVAA+TD EIP L K ++ 
Sbjct: 264 TFLSAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEV 323

Query: 328 KLGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALL 387
           K G+D+ATGRLAAVAGTSTCH+A+S+DPIFV GVWGPYRDVMAPGFW AEGGQSCTGALL
Sbjct: 324 KHGIDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALL 383

Query: 388 AHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGN 447
           AHVL+THPAY +L  LS++A +SKFDYLNSRLE L   RK  SVVALAKHLFFYGDYHGN
Sbjct: 384 AHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGN 443

Query: 448 RSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMS 507
           RSPIAD +MRAAIIGQSMDNS+DDL++ YLGACEFIAQQTRQIVE MC SGH +++IFMS
Sbjct: 444 RSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMS 503

Query: 508 GGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYN------------A 555
           GGQCRNGLLMRLLADCTGLPI+IPRYIDAAVVFGSALLGAVASES+N            A
Sbjct: 504 GGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNACAKLEETASDPA 563

Query: 556 HHTKTDLRKRRASSLGSKDQAI---------------------------AXXXXXXXXXX 588
             +  D+  RR SSL  KD  I                                      
Sbjct: 564 TTSNKDVSIRRKSSLSRKDAGIIGDGSRSRSGSAASGLGHGGGNTLKPLTSFAKAQKKTN 623

Query: 589 XXXQTDQPSPYTAPHATSSS---HMGGGSYFPIVGSDAAANLSPGXXXXXXXXXXXPVTF 645
                D PSPYTAP ATSS+      GG  FP++ S+  A +               +TF
Sbjct: 624 DLKFADMPSPYTAPSATSSTAQISTTGGYPFPVMASNEEAIIDEMEEENEDESL---LTF 680

Query: 646 KSVKSTTQENLAEKTDTNS-------NGEELWKVMYDMTGGGKVVRPNPDTNPDRVLLNA 698
            +    ++E      + N+         ++LW+VMY+MTGGGKVV P  +  PDR+LLNA
Sbjct: 681 DAKTEKSKEAATSAANHNNAKVLRDVTKDKLWEVMYNMTGGGKVVWPTEEDAPDRLLLNA 740

Query: 699 KYKIFLDMANTQRQYRSAIDRVE 721
           KYKIFLDMA TQ++YR  +D V+
Sbjct: 741 KYKIFLDMAATQQKYRKLVDEVK 763

>Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON}
           YDR109C (REAL)
          Length = 725

 Score =  833 bits (2151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/701 (59%), Positives = 506/701 (72%), Gaps = 32/701 (4%)

Query: 33  YYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKTVV 92
           +++GVDVGTGS RAC+ID  G I+SLAEKPI+REE++  +ITQSSKEIW A+C+CVK V+
Sbjct: 43  FHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAVL 102

Query: 93  RDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETAEI 152
           ++S VD +++HGIGFDATCSLV V++ D   + VGPDF N DQNIILWMDHRA++ET EI
Sbjct: 103 QESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETEEI 162

Query: 153 NSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTRSF 212
           NST    LKYVGGQMS+EM+IPKIKWLKN++  E F D  FF+L D+LT+KATG   RSF
Sbjct: 163 NSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENRSF 222

Query: 213 NSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFLSA 272
            S+VCKQG LP GVE S  GWS EFLN I L EL  NDF +LGGS++ K      NFLSA
Sbjct: 223 ASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDK-----KNFLSA 277

Query: 273 GQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLGVD 332
           G+ VG L   +A +LGL  HC+VGSG+IDAYAGWVGTVAA+    IP L++ E  K  ++
Sbjct: 278 GECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDIN 337

Query: 333 KATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLS 392
            A GRLAAVAGTSTCH+ LS+DPIFV GVWGPYRDV+A  FW AEGGQSCTGALLAHV+ 
Sbjct: 338 SAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVIK 397

Query: 393 THPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRSPIA 452
           THPA+T+L  L+++A +S F+YLNS LE LV  R ERSVV+LAKH FFYGDYHGNRSPIA
Sbjct: 398 THPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPIA 457

Query: 453 DNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGGQCR 512
           D  MRA IIGQSMDNSV+DLA+ YLGACEFI+QQTRQI+E M ++GH I +IFMSGGQCR
Sbjct: 458 DPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQCR 517

Query: 513 NGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTDLRKRRASSLGS 572
           NGLLMRLLADCTGLPI+IPRYIDAAVVFGSALLGA ASE+ +  + KT  + RR SSL  
Sbjct: 518 NGLLMRLLADCTGLPIMIPRYIDAAVVFGSALLGAAASEASDLANEKTICQTRR-SSLSQ 576

Query: 573 KDQAIAXXXXXXXXXXXXXQT---DQPSPYTAPH------ATSSSHMGGGSYFPIVGSDA 623
           K++ +              Q    D   P + P       AT +SH+      PIV    
Sbjct: 577 KEKVVNDPYKPIQNLSGEDQNLAFDVSPPNSTPSYIKNIPATLNSHIS-----PIVERQL 631

Query: 624 AANLSPGXXXXXXXXXXXPVTFKSVKSTTQENLAEKTDTNSNGEELWKVMYDMTGGGKVV 683
              +S                 K   ++T     +K   NS G+ LWKVM ++TG  KVV
Sbjct: 632 HVVVSARNRND-----------KDTSTSTVTRGLQKERCNS-GDLLWKVMQELTGEAKVV 679

Query: 684 RPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRVEANL 724
            PN  T+PDR+LL+ KY+IFLDMA  QR+YR+ +DRVE  L
Sbjct: 680 NPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVEIPL 720

>Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON}
           YDR109C (REAL)
          Length = 714

 Score =  827 bits (2137), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/692 (57%), Positives = 501/692 (72%), Gaps = 18/692 (2%)

Query: 33  YYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKTVV 92
           +Y+GVDVGTGSARAC+ID  GN++SLAEKPI+REEL+P +ITQSS+EIW A+C+CVK V+
Sbjct: 39  FYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAVI 98

Query: 93  RDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETAEI 152
           ++S VD +R+HG+GFDATCSLV V++ D   V VGPDF   DQNIILWMDHRA++ET EI
Sbjct: 99  QESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEEI 158

Query: 153 NSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTRSF 212
           NS+    LKYVGGQMS+EMEIPKIKWLKN++  E F D  FFDL D+LT+KATG   RSF
Sbjct: 159 NSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRSF 218

Query: 213 NSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFLSA 272
           +S+VCKQG LP GVEGSN GWS EFLN I L EL+ +DF KLGGS++     H+ NFLSA
Sbjct: 219 SSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLR-----HKKNFLSA 273

Query: 273 GQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLGVD 332
           G+ +G+L  +AA +LGL ++CVV SG+IDAYAGWVGTVAA+ +  I  LA+ E      +
Sbjct: 274 GECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNYN 333

Query: 333 KATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLS 392
            A GRLAAVAGTSTCH+ LS+DPIFV G+WGPYRDV+A GFW AEGGQSCTG LL HV+ 
Sbjct: 334 GAIGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIK 393

Query: 393 THPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRSPIA 452
            HPAYT+L  L+ +AG+SKF+YLNS LE +V  R ERSV++LA+HLFFYGDYHGNRSPIA
Sbjct: 394 IHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSPIA 453

Query: 453 DNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGGQCR 512
           D+ MRA IIGQSMDNSV+DLA+ YL ACEFI+QQTRQIVE+M KSGH I +IFMSGGQCR
Sbjct: 454 DSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCR 513

Query: 513 NGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTDLRKRRASSLGS 572
           N LL RLLADC+GLPI+IPRYID AVVFGSALLGA ASE+++    +  L  +++SS   
Sbjct: 514 NDLLTRLLADCSGLPIVIPRYIDGAVVFGSALLGAAASEAFDLAKGRRTLTTKKSSSAQE 573

Query: 573 KDQAIAXXXXXXXXXXXXXQTDQPSPYTAPHATSSSHMGGGSYFPIVGSDAAANLSPGXX 632
                               +D    Y  P++ SS+      +   +   +  ++S    
Sbjct: 574 FFINSYPSPQNSAMRHQNLASDVTCSYNLPNSISSAPDTMNRHSSTISKQSRGDMSSEES 633

Query: 633 XXXXXXXXXPVTFKSVKSTTQENLAEKTDTNSNGEELWKVMYDMTGGGKVVRPNPDTNPD 692
                         ++ +    +L EK    +    LWKVM ++TG  K V PN  T+PD
Sbjct: 634 SKG-----------TLNTVALRSLEEKRYRGTG--ILWKVMQELTGDAKAVNPNKATHPD 680

Query: 693 RVLLNAKYKIFLDMANTQRQYRSAIDRVEANL 724
           R+LL+ KY+IFLDMA TQ++YR  +D +E + 
Sbjct: 681 RILLDTKYQIFLDMAETQKRYRHMVDNLEESF 712

>YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON}
           Putative kinase
          Length = 715

 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/695 (58%), Positives = 502/695 (72%), Gaps = 23/695 (3%)

Query: 33  YYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKTVV 92
           +Y+GVDVGTGSARAC+ID  GN++SLAEKPI+RE+L   +ITQSS+EIW+A+CYCV+TVV
Sbjct: 39  FYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVV 98

Query: 93  RDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETAEI 152
            +SGVD ER+ GIGFDATCSLV V++ +  ++ VGPDF N DQNIILWMDHRA++ET EI
Sbjct: 99  EESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEI 158

Query: 153 NSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTRSF 212
           NS+    LKYVGGQMS+EMEIPKIKWLKN++    F D  FFDL D+LT+KATG   RSF
Sbjct: 159 NSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSF 218

Query: 213 NSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFLSA 272
            S+VCKQG LP+GVEGS+ GWS EFLN I L EL  NDF +LGGS++ K      NFL+A
Sbjct: 219 CSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREK-----KNFLTA 273

Query: 273 GQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLGVD 332
           G+ +  L  +AA  LGL +HCVV SG+IDAYAGWVGTVAA+ +  +  LA+ E  K   +
Sbjct: 274 GECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFN 333

Query: 333 KATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLS 392
            A GRLAAVAGTSTCH+ LS++PIFV GVWGPYRDV+A GFW AEGGQSCTG LL H+++
Sbjct: 334 GAIGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLIT 393

Query: 393 THPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRSPIA 452
           THPA+T+L H++  AG+SKF+YLN  LE LV  RK RSV++LAKHLFFYGDYHGNRSPIA
Sbjct: 394 THPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIA 453

Query: 453 DNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGGQCR 512
           D  MRA IIGQSMDNS++DLA+ YL ACEFI+QQTRQI+E+M KSGH I++IFMSGGQCR
Sbjct: 454 DPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCR 513

Query: 513 NGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTDLRKRRASSLGS 572
           N LLMRLLADCTGLPI+IPRY+DAAVVFGSALLGA ASE ++    K  L+ +++S   +
Sbjct: 514 NSLLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDFDYTREKRTLKGQKSSQTKT 573

Query: 573 KDQAIAXXXXXXXXXXXXXQTDQ-PSPYTAPHATSSSHMGGGSY-FPIVGSDAAANLSPG 630
           +    +              T+   SP+    +T S+     +Y  PI         S  
Sbjct: 574 ERFNDSYSSIQKLSMEDRNSTNGFVSPHNLQLSTPSAPAKINNYSLPICTQQPLDKTSEE 633

Query: 631 XXXXXXXXXXXPVTFKSVKSTTQENLAEKTDTNSNGEE-LWKVMYDMTGGGKVVRPNPDT 689
                              +  QE+L E      NG   LWKVM ++TG  ++V PN  T
Sbjct: 634 SSKDASL------------TVGQESLGE---GRYNGTSFLWKVMQELTGNARIVNPNEKT 678

Query: 690 NPDRVLLNAKYKIFLDMANTQRQYRSAIDRVEANL 724
           +PDR+LL+ KY+IFLDM  TQR+YR  +D+VE + 
Sbjct: 679 HPDRILLDTKYQIFLDMIETQRKYRRMVDKVEGSF 713

>Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON}
           YDR109C (REAL)
          Length = 704

 Score =  821 bits (2121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/698 (58%), Positives = 502/698 (71%), Gaps = 27/698 (3%)

Query: 28  EQRMIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYC 87
           E    +Y+GVDVGTGS RAC+ID  GNI+SLAEKPI+REEL   +ITQSS+EIW+A+CYC
Sbjct: 25  ESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYC 84

Query: 88  VKTVVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQ 147
           V+ V++++GVD  RIHGIGFDATCSLV V++ D  ++ VGPDF N DQNIILWMDHRA++
Sbjct: 85  VRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMK 144

Query: 148 ETAEINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGL 207
           ET EIN + +  LKYVGGQMS+EMEIPKIKWLKN++    F D  FFDL D+LT++ATG 
Sbjct: 145 ETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGK 204

Query: 208 GTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRS 267
             RSF+S VCKQG LP GVEGSN GWS +FL+ I L EL  NDF KLGGS++     ++ 
Sbjct: 205 ENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLR-----NQK 259

Query: 268 NFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKG 327
           NFLSAG+ +G L  +AA  LGL ++CVV SG+IDAYAGWVGTVAA+ + EI  L + E  
Sbjct: 260 NFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDY 319

Query: 328 KLGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALL 387
           K   + A GRLAAVAGTSTCH+ LS+  IFV G+WGPYRDV+A GFW AEGGQSCTG LL
Sbjct: 320 KHDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLL 379

Query: 388 AHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGN 447
            HV++THPA++ L  L+++A +SKF+YLNS LE LV  RKERSV+ LAKHLFFYGDY GN
Sbjct: 380 DHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGN 439

Query: 448 RSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMS 507
           RSPIAD  MRA IIGQSMDNS+DDLA+ YLGACEFI+QQTRQI+E+M KSGH I+++FMS
Sbjct: 440 RSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMS 499

Query: 508 GGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTDLRKRRA 567
           GGQCRNGLLMRLLADCTGLPI+IPRYID AVVFGSALLGA AS+ +       DL KRR 
Sbjct: 500 GGQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVF-------DLNKRR- 551

Query: 568 SSLGSKDQAIAXXXXXXXXXXXXXQTDQPSPYTAPHATSSSHMGGGSYFPIVGSDAAANL 627
             + SK  ++                  PS    P    S+++           +A A  
Sbjct: 552 RVIKSKKSSLVQTEFLEGLY--------PSIQNLPLENHSTNVVASYKLACSNLNAPART 603

Query: 628 SPGXXXXXXXXXXXPVTFKSVKSTT----QENLAEKTDTNSNGEELWKVMYDMTGGGKVV 683
           S              ++ KS K  +    +ENL E+ D + N   LWKVM ++TG  KV+
Sbjct: 604 SSDLFPISKEQPADMISDKSSKGISLDKGRENLEEERDIDKN--ILWKVMQELTGNAKVI 661

Query: 684 RPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRVE 721
            PN  T+PDR+LL+ KY+IFLDM  TQR YR  +D+VE
Sbjct: 662 CPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVE 699

>NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8.257
          Length = 588

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/534 (61%), Positives = 411/534 (76%), Gaps = 9/534 (1%)

Query: 28  EQRMIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYC 87
           E+ + YYIGVDVGTGS RAC+ID +G I S AE  I R+ELK   ITQSS+EIW A+C+C
Sbjct: 2   EKDIYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFC 61

Query: 88  VKTVVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQ 147
           VK VV + G   +++ GIGFDATCSLV V+      V VGPDF + +Q+IILWMDHRA++
Sbjct: 62  VKKVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALK 121

Query: 148 ETAEINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGL 207
           ET EINSTN   LKYVGGQMSIEME+PKIKWLK HM ++ F    F+DLAD+LT+KATG 
Sbjct: 122 ETKEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGR 181

Query: 208 GTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRS 267
            TRSF S VCKQG++P+GVEGS  GWS +FL  IDL EL  ND+AKLGGSV      H  
Sbjct: 182 KTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGS---HGR 238

Query: 268 NFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKG 327
           NFL+AG+Y+  L+ +A  +L L+  C+VGSG+IDAYAGW+GTV + T  ++ +L +    
Sbjct: 239 NFLTAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGT-VDLEQLFR---- 293

Query: 328 KLGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALL 387
            +G+  A GRLAAVAGTSTCH+ LS+DPIFVPGVWGPY+D +  G+WC EGGQSCTGALL
Sbjct: 294 -VGMANAIGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALL 352

Query: 388 AHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGN 447
            HVL THP+Y +LE +SE  G++KFDYLN+RL  +     ERSV+ LAKH+FFYGD HGN
Sbjct: 353 QHVLQTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGN 412

Query: 448 RSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMS 507
           RSP+AD +M+ AI+G SMD S+D+LA  YL ACEFIAQQ RQI+E MC +GH IS+I+MS
Sbjct: 413 RSPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMS 472

Query: 508 GGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTD 561
           GGQCRN LLM+LLADC+GL +IIP YID+AVVFG+A+LGA AS+ Y  + +++D
Sbjct: 473 GGQCRNSLLMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESD 526

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 659 KTDTNSNGEE-LWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAI 717
           ++DT  N E  LW  M  MT  G  + P P  +PDR+LL+AKYKIFLDMA+ Q++YR+ +
Sbjct: 524 ESDTVINTENILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIV 583

Query: 718 DRVE 721
           D VE
Sbjct: 584 DAVE 587

>Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON}
           (24389..26173) [1785 nt, 595 aa]
          Length = 594

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/527 (59%), Positives = 398/527 (75%), Gaps = 3/527 (0%)

Query: 31  MIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKT 90
           M +YIGVDVGTGS RAC+I+  G I+SL  K I +EELKP YITQSS+EIW  IC CV  
Sbjct: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60

Query: 91  VVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETA 150
           V+++S +    + GIGFDATCSLV ++ +   +V VGP+FE+ ++NIILWMDHRAV+ET 
Sbjct: 61  VLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETD 120

Query: 151 EINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTR 210
           EIN+T    LKYVGG+MS+EME+PKIKWLKN++    F++  FFDL D+LTYKAT    R
Sbjct: 121 EINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVR 180

Query: 211 SFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFL 270
           SF+S+VCKQGLLPLGVEGS+ GWS EF   IDL EL +++F+ +GGS+    +   +N  
Sbjct: 181 SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIH--SEQLENNIR 238

Query: 271 SAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLG 330
           S G+YVG LS  +A +LGL   C+VGSG+IDAYAGWVGTVAA+  EEI  +   +     
Sbjct: 239 SVGEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKV-EEIGTINNDDDASSK 297

Query: 331 VDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLAHV 390
           +D + G LA +AGTSTCH+ LS  PIFV G+WGPYRDV++  FWCAEGGQSCTGALL H+
Sbjct: 298 LDSSIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHI 357

Query: 391 LSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRSP 450
           L+THPAY +L    E   +  F++LN+RL  L      RS+++L KH F YGDYHGNRSP
Sbjct: 358 LTTHPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSP 417

Query: 451 IADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGGQ 510
           I+D +MRAAIIGQSMD S+D LA+ YL ACEFI+QQ+RQI+  + K+GH I  I+MSGGQ
Sbjct: 418 ISDESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQ 477

Query: 511 CRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHH 557
            RN LLMRLLADCTGLP++IPRYIDA+V+FGSA+LGAVA ++YN  H
Sbjct: 478 ARNQLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKH 524

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 38/67 (56%), Positives = 45/67 (67%), Gaps = 3/67 (4%)

Query: 661 DTNSN---GEELWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAI 717
           D N N   G+ LW  M  +T  G V+ PN   +PDRVLLNAKYKIFLDMA TQR+YR  I
Sbjct: 526 DGNKNWDHGKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQI 585

Query: 718 DRVEANL 724
           D +EA+ 
Sbjct: 586 DEIEASF 592

>Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar to
           Ashbya gossypii AGR092W
          Length = 597

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/525 (62%), Positives = 395/525 (75%), Gaps = 20/525 (3%)

Query: 33  YYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKTVV 92
           +YIGVDVGT S RAC++D  G I+SLA KPI R+E++P Y+TQSS EIW AIC+C++ ++
Sbjct: 4   HYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKII 63

Query: 93  RDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETAEI 152
            DS V  + I GIGFDATCSLV +       V VGP+F++ +Q+IILWMDHRA+ E  EI
Sbjct: 64  CDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNEI 123

Query: 153 NSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTRSF 212
           NST H  LKYVGG+MSIEM+IPKIKWLKN++P+ KF+   F+DL DFLTY+ATG   RSF
Sbjct: 124 NSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRSF 183

Query: 213 NSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFLSA 272
            S+VCK GLLPLGV+GS  GW  +    I L EL   +F+KLGG V        SNFLSA
Sbjct: 184 CSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTA----SNFLSA 239

Query: 273 GQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQ----TDEEIPELAKCEKGK 328
           G YVG LS EAAADLGL   C+V SG+IDAYAGWVGT+AA     +D +  ELA      
Sbjct: 240 GDYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQESELA------ 293

Query: 329 LGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLA 388
                 + RLA VAGTSTCH+ +S+ P F+ GVWGPYRD + PG+W  EGGQSCTGALLA
Sbjct: 294 ------SSRLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLA 347

Query: 389 HVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNR 448
           HVL +HPAY  L  L+++ G+SKFD++N+RLE L   R  +SV AL KHLFFYGDYHGNR
Sbjct: 348 HVLKSHPAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNR 407

Query: 449 SPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSG 508
           SPIAD  MRA IIGQSMD SVDDLA+  LGACEFIAQQTRQIVE + +SGH I+SI+MSG
Sbjct: 408 SPIADPNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSG 467

Query: 509 GQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESY 553
           GQCRN +L++LLA+CT LPI++P+YIDAAVVFGSALLG  ASE Y
Sbjct: 468 GQCRNLVLIKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKY 512

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (67%)

Query: 669 LWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRVE 721
           LW VM ++TG G+++ P+   + +  LL+ KY+IFLDM  TQ++YR  + R E
Sbjct: 542 LWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRAE 594

>TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa]
           {ON} Anc_8.257 YDR109C
          Length = 589

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/532 (59%), Positives = 403/532 (75%), Gaps = 3/532 (0%)

Query: 31  MIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKT 90
           M YYIGVDVGTGSARACLID  G+I+S+ E  I R+ELKP YITQS+ +IW+ IC C++ 
Sbjct: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRN 60

Query: 91  VVRDSGVD--IERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQE 148
           ++++S VD    +I GIGFDATCSLV +NSK   +V VGP+FE+ DQN+ILWMDHRA+ E
Sbjct: 61  ILQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120

Query: 149 TAEINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLG 208
           T EINST+   LKYVGGQMS+EMEIPKIKWLKN+M    + D  F DL DFLTYKATG  
Sbjct: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180

Query: 209 TRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSN 268
            RSF S+VCKQGLLPLGVEGS  GW+ EFL  I L +L+ ++F KLGG VK +    + +
Sbjct: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVK-QDSQGKVS 239

Query: 269 FLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGK 328
           F +AG+++G LS +++  +G++  C V SG+IDAYAGW+GT+AA T E I +L   +   
Sbjct: 240 FSTAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNL 299

Query: 329 LGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLA 388
            G+  ++GRLA VAGTSTCH++L+  PIFVPGVWGPYRDV+   FWCAEGGQSCTGALL 
Sbjct: 300 NGMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQ 359

Query: 389 HVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNR 448
           HVL THPAY +L  +S+   +S F+ LN+++  L + R     V L K+LFFYGD+HGNR
Sbjct: 360 HVLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNR 419

Query: 449 SPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSG 508
           SP+AD  MR  IIG SMD+S++DL   YLGACEFIAQQTR IV+IM KSG+N+ S++MSG
Sbjct: 420 SPVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSG 479

Query: 509 GQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKT 560
           GQCRN LLM+L+++C GLP++IP+ ID AVVFGSAL+GA ASE   +H   T
Sbjct: 480 GQCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSKSHSDNT 531

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%)

Query: 661 DTNSNGEELWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAID 718
           +T    + LW VM  MTG G VV P   ++    LL  KY+I+LDM  TQ++YRS ++
Sbjct: 530 NTKKPDQILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587

>NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257
          Length = 596

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/530 (59%), Positives = 402/530 (75%), Gaps = 6/530 (1%)

Query: 33  YYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKTVV 92
           YY+G+DVGTGS RAC++DS GN++SL EK I REELKP +ITQS++EIW A C+CVKT +
Sbjct: 16  YYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAI 75

Query: 93  RDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETAEI 152
               VD   + GIGFDATCSLVA+       V VGP+FEN D N+ILWMDHRAV+E  EI
Sbjct: 76  EQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEI 135

Query: 153 NSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTRSF 212
           N+TN   LKYVGG MS+EM+IPKIKWLKN+M    F    FF+LAD+LT+KATG  TRSF
Sbjct: 136 NATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSF 195

Query: 213 NSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFLSA 272
            S VCKQG LP GVEGS+ GWS EFL+ I L +L  N +  LGG++K   +D + NF S+
Sbjct: 196 CSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALK---NDSQDNFQSS 252

Query: 273 GQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLGVD 332
           G+ +G LS EA  +LGL+++CVVG+G+IDAYAG +GT+AA T E   ++       +G+ 
Sbjct: 253 GKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAA-TSEGSHQIKN--DSSIGLQ 309

Query: 333 KATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLS 392
            A GRLA+VAGTSTCH+ LS+DP+FVPGVWGPYRDV+A G+WCAEGGQ+CTG LL++VLS
Sbjct: 310 NAIGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLS 369

Query: 393 THPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRSPIA 452
            HPA+ +L + S  A + KF YLN+ L+ L    K  S + LAKH+FFYGDY GNRSP A
Sbjct: 370 IHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYA 429

Query: 453 DNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGGQCR 512
           D  M AAIIGQSM++++++LA+ YL ACEFIAQQTRQIVE + K+G ++S I+MSGGQCR
Sbjct: 430 DPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCR 489

Query: 513 NGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTDL 562
           N LLM+LL+DCTGLPI++P+Y+DAAVVFG+A+LGA A  S  +   + D 
Sbjct: 490 NKLLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATADASRKSVEIECDF 539

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (67%)

Query: 666 GEELWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRVE 721
           G  LW+ M  MT  G ++ PN   +PDR LL+ KY+IFLDMA TQR+YR  +D ++
Sbjct: 540 GFMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDID 595

>KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON}
           Anc_8.257 YDR109C
          Length = 605

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/532 (59%), Positives = 392/532 (73%), Gaps = 11/532 (2%)

Query: 32  IYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKTV 91
            ++IGVDVGTGS RAC+ID  G+I++L +KPI REELKP +ITQSS+EIW +IC+CV+ V
Sbjct: 19  FHFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKV 78

Query: 92  VRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETAE 151
           + D+ +   ++ GIGFDATCSL  V+      + VGP F   DQNII+WMDHRA QET E
Sbjct: 79  IADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDE 138

Query: 152 INSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTRS 211
           INS     LKYVGG+MSIEME+PKIKWLKNHMPRE F   VFFDL D+LT+KATG+  RS
Sbjct: 139 INSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRS 198

Query: 212 FNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFLS 271
             S+VCKQGLLP+GVEGS  GWS  FL+   LPEL+ N+F ++GG     G++ R NFLS
Sbjct: 199 LCSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGP----GNNSR-NFLS 253

Query: 272 AGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLGV 331
           AG+YV  LS  +   LGL + CVVGSG+IDAYAG +GT+AA+ DE     A+ +    G 
Sbjct: 254 AGEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDES----ARTQDDANGQ 309

Query: 332 D--KATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLAH 389
           D   A GRLAAVAGTSTCH+ LS  PIFV GVWGPY+D++A  +WCAEGGQSCTG LL H
Sbjct: 310 DLQNAIGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKH 369

Query: 390 VLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRS 449
           V++THPAY +L+  +  + L  F+ LN  +  L   +   +++ L K LF YGDYHGNRS
Sbjct: 370 VITTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRS 429

Query: 450 PIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGG 509
           PIAD  MRA+IIGQSMD +V+ LAL YL ACEFIA QTR I+  M ++GH+I SI+MSGG
Sbjct: 430 PIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGG 489

Query: 510 QCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTD 561
           QCRN +LM LLAD TGLP++IP+YIDAAVVFG+AL+GA A + +N   T  D
Sbjct: 490 QCRNNILMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFNQCETNDD 541

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%)

Query: 669 LWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAID 718
           LW  M  MTG G  + P  + +  + LLN KYKI++DMA TQ++YRS ID
Sbjct: 550 LWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLID 599

>KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.257
           YDR109C
          Length = 580

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/519 (57%), Positives = 382/519 (73%), Gaps = 13/519 (2%)

Query: 33  YYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKTVV 92
           YYIGVDVGTGSARA ++   G  ++L E PI+R+EL+  +ITQSS EIWSA+C+CV+ VV
Sbjct: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65

Query: 93  RDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETAEI 152
             SGV+   + GIGFDATCSLVAV++  G  VPVGP+F++  QNIILWMDHRA +ET  I
Sbjct: 66  TKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAI 125

Query: 153 NSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTRSF 212
           N+T    LKYVGGQMS+EME+PKIKWLK HMPR +F    FFDL D+LT+ AT    RSF
Sbjct: 126 NATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSF 185

Query: 213 NSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFLSA 272
            S+VCKQGLLP GV+GS   WS EFL  + L EL+  +F +LGG+ + K       FL+A
Sbjct: 186 CSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESK-----PKFLTA 240

Query: 273 GQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLGVD 332
           GQ VG L+ EA+   GL+  C+V SGVIDAYAGW+G+V A+ D+             G+D
Sbjct: 241 GQPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQS--------HKSSGLD 292

Query: 333 KATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLS 392
            A  RLA +AGTSTCH+ LS+ P FVPGVWGPYRDV+ PG+WCAEGGQSCTGALLAH+L 
Sbjct: 293 VAITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILE 352

Query: 393 THPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRSPIA 452
           THPA+ +L  L+    +S F+YL   L+ L+  R+ R+V+ L++  F YGD+HGNRSP+A
Sbjct: 353 THPAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLA 412

Query: 453 DNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGGQCR 512
           D +MRA +IGQSMD S++ LA++YL ACEFIA QTRQIVE M ++GH +  ++MSGGQCR
Sbjct: 413 DPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCR 472

Query: 513 NGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASE 551
           N LLM+L+AD  G+P+++P+Y D  VVFG+ALL   AS+
Sbjct: 473 NSLLMQLIADSVGVPVVLPKYTDCCVVFGAALLACCASK 511

 Score = 54.7 bits (130), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%)

Query: 668 ELWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRV 720
            LW +M  MT  G  V PN D++ +R  ++AKY IFLDM   Q+ YRS +D+V
Sbjct: 523 RLWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQV 575

>CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {ON}
           similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109c
          Length = 577

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/522 (56%), Positives = 376/522 (72%), Gaps = 11/522 (2%)

Query: 31  MIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKT 90
           M YYIGVDVG+GS RAC++D  G ++S+A + I +EE  P ++TQSS EIW A+CYCVK+
Sbjct: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60

Query: 91  VVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETA 150
            + +S V+   I GIGFDATCSLV +N      V  GP+F+N +QNII+WMDHRA++ET 
Sbjct: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETK 120

Query: 151 EINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTR 210
           EIN +  P LKYVGGQMS+EMEIPKIKWLKNHM  E+F   VF DL D+LT+ A+G+ TR
Sbjct: 121 EINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTR 180

Query: 211 SFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFL 270
           S+ S+VCKQG LP GVEGS+ GWS EFL  I L E+  ++F  LGG       +   NF 
Sbjct: 181 SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGP------NESGNFT 234

Query: 271 SAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLG 330
            AG  +  +S        +   C+VGSG+IDAYAGW+GTVA+ T  E+P      K  + 
Sbjct: 235 YAGNQLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASST-IEVPN----NKEVVD 289

Query: 331 VDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLAHV 390
           +++  GRLAAVAGTSTCH+ LS+  IFVPGVWGPYRDV+ P +WCAEGGQS TGALLAH+
Sbjct: 290 IEECAGRLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHI 349

Query: 391 LSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRSP 450
           LS HP+  +L +L +   + KF +LN+ +  L       + + L K  F YGDYHGNRSP
Sbjct: 350 LSIHPSANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSP 409

Query: 451 IADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGGQ 510
           IAD  MRAAIIGQSMD S+DDLA  YL ACEFIA QT+ I++ +  +GH I +I+MSGGQ
Sbjct: 410 IADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQ 469

Query: 511 CRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASES 552
           CRN +LM+L+A+CTGLP+IIP+YID+AVVFGSA+LGA+A  S
Sbjct: 470 CRNNILMQLIANCTGLPLIIPKYIDSAVVFGSAILGAMAYSS 511

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (60%), Gaps = 1/64 (1%)

Query: 657 AEKTDTNSNGEEL-WKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRS 715
           + K +++  G +L W  M +MT  G  V P  + + +R L+N K+KIFLDMA TQ+ YR 
Sbjct: 511 SSKNNSDKGGADLLWSTMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQ 570

Query: 716 AIDR 719
            ++ 
Sbjct: 571 LVEN 574

>AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR109C and
           Non-syntenic homolog of Saccharomyces cerevisiae YNL249C
           (MPA43)
          Length = 596

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/528 (57%), Positives = 375/528 (71%), Gaps = 12/528 (2%)

Query: 33  YYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKTVV 92
           YY+GVDVGT  ARAC+ID  G I++  + PI R + K  +ITQSS EIW A+C  V+  V
Sbjct: 9   YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAV 68

Query: 93  RDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETAEI 152
            +S V ++ + GI FDATCSLV ++     +V VGPDF +  QN+ILWMDHRAV E +EI
Sbjct: 69  AESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASEI 128

Query: 153 NSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTRSF 212
           NST H VL+YVGG+MS+EM++PKIKWL+ HMPR +F    F+DL DFLTY+ATG+ +RSF
Sbjct: 129 NSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRSF 188

Query: 213 NSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFLSA 272
            S+VCK GL+P GV+ S +GWS EFL  I L EL  + F +LGG++   G    S F SA
Sbjct: 189 CSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPG----SEFRSA 244

Query: 273 GQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLGVD 332
           G+ VG LS  AAA LGL   CVVGSGVIDAYAGWVGTV A  D         E G  GV+
Sbjct: 245 GEPVGLLSEAAAASLGLTPRCVVGSGVIDAYAGWVGTVGASPD------GARESG--GVE 296

Query: 333 KATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLS 392
           +  GRLAAVAGTSTC + LS+ P FV GVWGPYRDV+A G+WC EGGQSCTGALLAH L 
Sbjct: 297 ELAGRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLH 356

Query: 393 THPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRSPIA 452
           THPAYT+L   ++  GL+ FDY+N RL+ L      RS+ ALAKH F YGDYHGNRSP+A
Sbjct: 357 THPAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLA 416

Query: 453 DNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGGQCR 512
           D +MRAA++G SMD S DDLAL  L A EFIA Q R I++ M  +G ++ ++++SGGQ R
Sbjct: 417 DPSMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQAR 476

Query: 513 NGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKT 560
           N LL +LLAD    P++ PR++ AAVVFGSALL A A E+Y A+   T
Sbjct: 477 NPLLTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNAT 524

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 37/54 (68%)

Query: 668 ELWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRVE 721
            LW++M  +T  G VV P+PD +PD  LL AKYK+FL+MA  Q+ YR  +D VE
Sbjct: 540 RLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVE 593

>TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.257
           YDR109C
          Length = 585

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/521 (54%), Positives = 369/521 (70%), Gaps = 6/521 (1%)

Query: 31  MIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKT 90
           M  YIGVDVGTGSARAC+ +  G I+++  K I ++EL+  +ITQSS EIW AI   +K 
Sbjct: 1   MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR 60

Query: 91  VVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETA 150
           V+  S VD   I GI FDATCSLV  +      + VGP+F++ +QNIILWMDHRA  ET 
Sbjct: 61  VIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETD 120

Query: 151 EINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTR 210
            INSTN   LKYVGG+MS+E E+PKIKWLK+H+  E F+  VF DLADFLTYKATG    
Sbjct: 121 LINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVH 180

Query: 211 SFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFL 270
           SF+S+VCKQGLLP GVEGS  GWS EFL  I L EL  N+F KLGGS+  K      NFL
Sbjct: 181 SFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLK----EGNFL 236

Query: 271 SAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLG 330
             G  VG +  + A    L +HCVVG+GVIDAY+GWVGTVA+   + +   +  E  K  
Sbjct: 237 IPGDLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNK-- 294

Query: 331 VDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLAHV 390
           ++ + GR+A V+GTSTCH+ LS+ P+F+ GVWGPYRDV+A   W  EGGQS TGALL ++
Sbjct: 295 IEGSLGRIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNI 354

Query: 391 LSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRSP 450
           + THPAY +LE ++     + F YL+ +LE L   RK  SV  L K++F YGDY+GNRSP
Sbjct: 355 IETHPAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSP 414

Query: 451 IADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGGQ 510
           +AD  M   IIGQ+MD+S++DLA++YL ACEFIA QTR I++ +   GH I++I+MSGG 
Sbjct: 415 LADPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGH 474

Query: 511 CRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASE 551
           C+N LLM L+++C  LP+++ +YID++VVFG+A+LG+VA++
Sbjct: 475 CKNKLLMELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAK 515

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 669 LWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRV 720
           LW  M  MT  G ++ P  + +  R  L AKY+++LDM +T  +YR  ++ V
Sbjct: 532 LWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEV 583

>Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  201 bits (512), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 153/534 (28%), Positives = 250/534 (46%), Gaps = 84/534 (15%)

Query: 35  IGVDVGTGSARACLIDSMGNIM-SLAEKPIQREELKPTYITQSSKEIW------SAICYC 87
           IG+D+G+ SAR  + D   +++ ++A++P+        Y   SSK+ W      + I   
Sbjct: 9   IGIDIGSSSARVGIYDYYNDVLLAMAQEPV-------PYYHDSSKKSWKFWQKSTEIIKA 61

Query: 88  VKTVVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQ 147
           ++   ++  +    +   G  ATCSL A+  KD  +  + P + N D N+I WMD  AV 
Sbjct: 62  LQNCFQELKITQYNVRSCGVSATCSL-AIFQKDLTNGNLIP-YPNED-NVIFWMDSSAVD 118

Query: 148 ETAEINST-NHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATG 206
           E   +N   +  +L Y+GG+   EM IPK+K+  N     +      FDL  ++ Y+   
Sbjct: 119 ECEWLNEKCSQQLLDYLGGKFIPEMGIPKLKYFLNEHSHNQEKQFHIFDLHQYIAYELGR 178

Query: 207 LGTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHR 266
           L   + +    ++ +  +G +G  +GWS  F N          D  KL  +V        
Sbjct: 179 LYRWNTDELSARENINGIGNDGEASGWSSSFYN----------DIMKLPSNVT------- 221

Query: 267 SNFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEK 326
                    +G     +         C      ID+YA W    +       P L     
Sbjct: 222 ---------IGLTGLNSNNSSSTTTVC----SCIDSYASWFAVSS-------PNLE---- 257

Query: 327 GKLGVDKATGRLAAVAGTSTCHVALSRDPIF---VPGVWGPYRDVMAPG--FWCAEGGQS 381
                      L  +AGTSTC++  S  P+    +PGVWGP+  ++     +     GQS
Sbjct: 258 ---------ASLFMIAGTSTCYMYGS--PVTTTKIPGVWGPFDTILETNGNYSVYTAGQS 306

Query: 382 CTGALLAHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFY 441
           CTG L+ H+  +HPA   ++     +G   ++ L + ++  +  +  +S+  LAKH+FFY
Sbjct: 307 CTGKLIEHLFKSHPAARKIQR----SGEDIYEVLENSIQ-DIEKKNRKSIHILAKHMFFY 361

Query: 442 GDYHGNRSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIM--CKSGH 499
           GDY GNR+P AD+ MR + IG+S D S+ +L  +Y+   EF++ QT+ I++      SG 
Sbjct: 362 GDYEGNRTPFADSQMRGSFIGESTDTSILNLTYKYVSMLEFLSFQTKLIIDTFQGQNSGA 421

Query: 500 NISSIFMSGGQCRNGLLMRLLADCT-GLPIIIP-RYIDAAVVFGSALLGAVASE 551
            I  + +SG Q +NG L+ L++    G+ I  P   ID   V G+ +LG  A+E
Sbjct: 422 RIEELRVSGSQAKNGRLLSLISLVNDGIKIKRPNENIDLMGVMGAYMLGKSANE 475

>Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {ON}
           YNL249C (REAL)
          Length = 569

 Score =  182 bits (462), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 150/530 (28%), Positives = 246/530 (46%), Gaps = 76/530 (14%)

Query: 35  IGVDVGTGSARACLIDSMGN-IMSLAEKPI---QREELKPTYITQSSKEIWSAICYCVKT 90
           IG+DVG+ SAR  + +   + ++ +A++P+   Q          Q S EI  A+  C++ 
Sbjct: 34  IGIDVGSSSARVGIYNYENDALLGMAQEPVPYYQDSSRTSWKFWQRSTEIIKALQKCLQK 93

Query: 91  VVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETA 150
           +     +    +   G  ATCSL A+  KD  +  + P + N D N+I WMD  A+ E  
Sbjct: 94  L----KITEYNVKSCGVSATCSL-AIFEKDKRNGSLIP-YPNED-NVIFWMDSSAIDECK 146

Query: 151 EINS-TNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGT 209
           ++N+  +  +L ++GG    EM IPK+K+  N     +      FDL  ++ Y+ + L  
Sbjct: 147 QLNAECSQQLLDFLGGSFVPEMGIPKLKYFLNEYSHNQDKQFHIFDLHQYIAYELSHLYQ 206

Query: 210 RSFNSSVCKQGLLPLGVEGSNNGWSGEFL-NLIDLPELVANDFAKLGGSVKPKGDDHRSN 268
            +    + ++    +GV+G  +GWS  F  N++ LP                      SN
Sbjct: 207 WNNEVLLKRENNKMVGVDGEASGWSPSFYENIMHLP----------------------SN 244

Query: 269 FLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGK 328
            +        +    A    +A   +V S  ID+YA W    +       P L       
Sbjct: 245 VI--------IGSNGATCKKIASSAIVRS-CIDSYASWFAVSS-------PHLET----- 283

Query: 329 LGVDKATGRLAAVAGTSTCHV-ALSRDPIFVPGVWGPYRDVMAPG--FWCAEGGQSCTGA 385
                    L  +AGTSTC++       I +PGVWGP+  ++     F     GQSCTG 
Sbjct: 284 --------SLFMIAGTSTCYMYGTPITDIKIPGVWGPFDSILDSNSHFSVYAAGQSCTGK 335

Query: 386 LLAHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYH 445
           L+ H+  THP   ++  L   A + +   +  R  + +  +  +SV    K +FFYGDY 
Sbjct: 336 LIEHLFVTHPCAKEI--LKRGADIYQ---VLERTIHDIEKQNGQSVHVFTKDIFFYGDYE 390

Query: 446 GNRSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKS--GHNISS 503
           GNR+P AD  M+ + IG++ D S+ +L  +Y+   EF++ QTR I++   +   G  I  
Sbjct: 391 GNRTPFADPRMKGSFIGETTDTSILNLIHKYICILEFLSFQTRLIIDTFKRQNIGMCIQE 450

Query: 504 IFMSGGQCRNGLLMRLLADC-TGLPIIIPR-YIDAAVVFGSALLGAVASE 551
           + +SG Q +N  L+ L++    G+ I  P+  +D   V G+ LL   A+E
Sbjct: 451 LRISGSQAKNKRLLSLISLVNNGITINKPKDNVDLMGVRGAYLLAKSANE 500

 Score = 35.0 bits (79), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 688 DTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRV 720
           D++  R LL AKY+I LDMA  Q++Y   ID V
Sbjct: 531 DSSLLRRLLWAKYRIHLDMAKQQQRYHKLIDEV 563

>ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein
          Length = 542

 Score =  181 bits (459), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 156/538 (28%), Positives = 239/538 (44%), Gaps = 91/538 (16%)

Query: 35  IGVDVGTGSARACLIDSMGN-IMSLAEKPIQREELKPTYIT---------QSSKEIWSAI 84
           IG+D+G+ S R  L +   + I++   K +      P Y T         QSS+EI +AI
Sbjct: 10  IGIDLGSSSVRVSLFNFQNDQIIAYKIKTV------PYYFTPESTNWKYTQSSREILTAI 63

Query: 85  CYCVKTVVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHR 144
             C + +     +D   I   G  ATCSL    +KD A +P   D  +PD+N++ WMD  
Sbjct: 64  DQCFQEL----NIDKHEIKSCGVGATCSLAIFQTKDNALIPWNLD--DPDKNVVFWMDSI 117

Query: 145 AVQETAEINSTNHP-VLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYK 203
           A++ET E+N    P V  ++GG    EM +PK++   + +     N T  F++ D   Y 
Sbjct: 118 AIKETQEVNKLATPEVQAHMGGSFVPEMAVPKLRHFIDILKNTDNNST--FEIIDLHRYI 175

Query: 204 ATGLGTRS--FNSSVCK-QGLLPLGVEGSNNGWSGEFL-NLIDLPELVANDFAKLGGSVK 259
           A  L  ++    ++VC    L  +G +G   GWS  F  N++ LP  +          + 
Sbjct: 176 AMSLAQQNGWDYTNVCNFPNLNEIGHDGELAGWSSAFYENVLQLPPNIV---------IG 226

Query: 260 PKGDDHRSNFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIP 319
           P      S                 +  GL       S  ID Y+ W   + +       
Sbjct: 227 PTKHSQHS-----------------SKQGLK-----VSSCIDCYSNWFALLPSNLQ---- 260

Query: 320 ELAKCEKGKLGVDKATGRLAAVAGTSTCHV-ALSRDPIFVPGVWGPYRDVM--APGFWCA 376
                             L  V GTSTC++ A S     +PGVWGP+ ++   +  F   
Sbjct: 261 ----------------NSLFIVGGTSTCYLYASSEFSHHIPGVWGPFSNIFDRSDQFSIY 304

Query: 377 EGGQSCTGALLAHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAK 436
           E GQSCTG L+ H+  THPA +   H+        F  +N  +E  V    + S+    K
Sbjct: 305 EAGQSCTGKLIEHLFKTHPASS---HIDTRDWPHLFSQINDFIEK-VEQNTQDSIHMQTK 360

Query: 437 HLFFYGDYHGNRSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIM-- 494
           H+FFYGD  GNR+P AD +M    IG++ D S  +L  +Y+   EFIA Q + ++ I   
Sbjct: 361 HMFFYGDLDGNRTPYADPSMSGMFIGETTDTSFRNLVYKYVSILEFIAFQIKHMLAIFNT 420

Query: 495 CKSGHNISSIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVV--FGSALLGAVAS 550
                +IS++   G   +N  L+ LLA       I    +D A++  +GS L+G  ++
Sbjct: 421 LNGDEDISNLQFCGSLAKNKRLLNLLALLNPRLRIAMPEMDVALMGAYGSYLMGKAST 478

>TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON}
           Anc_1.111 YNL249C
          Length = 543

 Score =  178 bits (451), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 156/540 (28%), Positives = 248/540 (45%), Gaps = 93/540 (17%)

Query: 35  IGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYI----------TQSSKEIWSAI 84
           IG+D+G+ S R  L     ++M      +Q  + K +Y           TQS+ EI   I
Sbjct: 6   IGIDLGSSSVRVGLFTLEDDLM------VQCVKQKISYYYHGDSALWEYTQSTDEIMKVI 59

Query: 85  CYCVKTVVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHR 144
             C+     D  +D   I   G  ATCS+     +     P      +  QN+I WMD+ 
Sbjct: 60  ERCL----HDLKIDEYNIKSCGVSATCSMALFIKEHNHLEPFNTISGSHRQNVIFWMDNS 115

Query: 145 AVQETAEINSTNHPVLK-YVGGQMSIEMEIPKIKWLKNHMPRE---KFNDTVFFDLADFL 200
           +  E   +N+     L+ ++GG+   EM IPKI  L N++      +    V  DL  +L
Sbjct: 116 SKTECKLLNNLCEKRLRDFMGGKFIPEMGIPKINRLINYLKSSDDLQNLSVVAMDLHRYL 175

Query: 201 TYKATGLGTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKP 260
            Y+       +F+  +       +G +G  +GWS +F   ID  ++ +N      G   P
Sbjct: 176 AYEIAKRFKWNFDRLLNTTNFNEIGHDGELSGWSSKFY--IDTLKIPSNITI---GPEPP 230

Query: 261 KGDDHRSNFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPE 320
             DD         +Y            G+   C      ID Y+ W+ ++ + T EE   
Sbjct: 231 LEDDF--------EYCK----------GIVASC------IDCYSSWL-SLCSPTPEE--- 262

Query: 321 LAKCEKGKLGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVM--APGFWCAEG 378
                            L  V GTSTC++  +     +PGVWGP+ D++  +  +   EG
Sbjct: 263 ----------------SLFIVGGTSTCYLYATTRMKTIPGVWGPFTDILDNSNTYAVYEG 306

Query: 379 GQSCTGALLAHVLSTHPAYTDLEHLSESAGLSKFDY--LNSRLEYLVNARKE---RSVVA 433
           GQSCTG L+ H+L THPA         S+ ++K D+  L  ++E  ++A +E   RS+  
Sbjct: 307 GQSCTGKLIEHLLQTHPA---------SSSIAKDDWPLLLEKIEQEISAIEEQTGRSIHF 357

Query: 434 LAKHLFFYGDYHGNRSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEI 493
             KH+FFYGD+ GNR+P AD  M    IG++ D S ++L L+Y+   EF+A Q + ++ I
Sbjct: 358 KTKHMFFYGDFQGNRTPYADPEMSGMTIGETTDVSFNNLILRYICILEFLAFQIKYMISI 417

Query: 494 MCKS--GHNISSIFMSGGQCRNGLLMRLLADC-TGLPIIIPRY-IDAAVVFGSALLGAVA 549
             K+     I+ I + G Q +N  L+ L++    G  I +P+  ++ + V G+ LLG  A
Sbjct: 418 FNKAQGQDKITEIRICGSQAKNKRLLSLISLLHEGGTIKLPKTDVELSGVSGAFLLGKSA 477

 Score = 35.8 bits (81), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%)

Query: 685 PNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRV 720
           P+    P  +LL AKY+I LDMA  Q  YR  I+++
Sbjct: 502 PSSINQPLSMLLEAKYEIHLDMAKQQLIYREMINKI 537

>YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON}
           MPA43Putative protein of unknown function; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 542

 Score =  176 bits (446), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 147/534 (27%), Positives = 244/534 (45%), Gaps = 84/534 (15%)

Query: 35  IGVDVGTGSARACLIDSMGN-IMSLAEKPI---QREELKPTYITQSSKEIWSAICYCVKT 90
           IG+DVG+ SAR  + +   + ++ +A++P+   Q    K     Q S EI  A+  C++ 
Sbjct: 9   IGIDVGSSSARIGVYNYYNDALLEMAQEPVPYYQDSSKKSWKFWQKSTEIIKALQKCLQK 68

Query: 91  V-VRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQET 149
           + +R+       +   G  ATCSL A+  +D     + P + N D N+I WMD  AV E 
Sbjct: 69  LNIREY-----EVKSCGVSATCSL-AIFERDRTSNMLIP-YPNED-NVIFWMDSSAVNEC 120

Query: 150 AEIN-STNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLG 208
             +N      +L Y+GG+   EM +PK+K+  +     +      FDL  ++ Y+ + L 
Sbjct: 121 QWLNMQCPQQLLDYLGGKFVPEMGVPKLKYFLDEYSHLRDKHFHIFDLHQYIAYELSRLY 180

Query: 209 TRSFNSSVCKQGLLPLGVEGSNNGWSGEFL-NLIDLPELVANDFAKLGGSVKPKGDDHRS 267
             +    + ++ L  +G +G  +GWS  F  N+I+LP  V+                   
Sbjct: 181 EWNIEGLLGRENLNGIGNDGEVSGWSSSFYKNIINLPSNVS------------------- 221

Query: 268 NFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKG 327
                   +G  S  A   +       V    ID+YA W    +       P L      
Sbjct: 222 --------IGTTSLVANKHIS----TTVVRSCIDSYASWFAVAS-------PHLETS--- 259

Query: 328 KLGVDKATGRLAAVAGTSTCHV-ALSRDPIFVPGVWGPYRDVMAP--GFWCAEGGQSCTG 384
                     L  +AGTS+C++   +     +PGVWGP+  ++     F     GQSCTG
Sbjct: 260 ----------LFMIAGTSSCYMYGTTISDTRIPGVWGPFDTILDNRGDFSVYAAGQSCTG 309

Query: 385 ALLAHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKER---SVVALAKHLFFY 441
            L+ H+  +HP    +  L + A + +       LE  +   ++    S+  L K +FFY
Sbjct: 310 KLIEHLFESHPCARKI--LKDGADIYQV------LEQTIRDIEKNNGLSIHILTKDMFFY 361

Query: 442 GDYHGNRSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHN- 500
           GDY GNR+P AD  ++ + IG+S D S+ +L  +Y+   EF++ QT+ I++       N 
Sbjct: 362 GDYEGNRTPFADPRIKGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTFQNENSNI 421

Query: 501 -ISSIFMSGGQCRNGLLMRLLADC-TGLPIIIPRY-IDAAVVFGSALLGAVASE 551
            I  + +SG Q +N  L+ L++    G+ II P+  +D   + G+ +L   A E
Sbjct: 422 HIKELRISGSQAKNERLLSLISLVNNGVAIIKPKENVDMMGIKGAYVLAKSAKE 475

>Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  172 bits (437), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 143/532 (26%), Positives = 241/532 (45%), Gaps = 80/532 (15%)

Query: 35  IGVDVGTGSARACLIDSMGN-IMSLAEKPI---QREELKPTYITQSSKEIWSAICYCVKT 90
           IG+D+G+ SAR  +     + ++ +A++P+   Q    K     Q S EI  A+  C + 
Sbjct: 9   IGIDLGSSSARVGIYSYYNDALLGMAQEPVPYYQDFTKKSWKFWQKSTEIIEALQKCFQK 68

Query: 91  VVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETA 150
           +     +    +   G  ATCSL        ++  +    EN   N+I WMD  A  E  
Sbjct: 69  L----KITEYNVKSCGVSATCSLAIFERVHTSEALIPYPNEN---NVIFWMDSSATDECE 121

Query: 151 EINS-TNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGT 209
            +N+  +  +L Y+GG+   EM IPK+K+  N     +      FDL  ++ Y+   L  
Sbjct: 122 WLNAECSKQLLDYLGGRFVPEMGIPKLKYFLNEYSHRQDKRFHIFDLHQYIAYELGRLYQ 181

Query: 210 RSFNSSVCKQGLLPLGVEGSNNGWSGEFL-NLIDLPELVANDFAKLGGSVKPKGDDHRSN 268
            + +  +  + +  +G +G  +GWS  F  N++++P  V          + P        
Sbjct: 182 WNIDGLLRGENINGIGNDGEASGWSSSFYKNIMNIPSNVI---------IGP-------- 224

Query: 269 FLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGK 328
                  VG +S +  +         V    ID+YA W            P L +     
Sbjct: 225 -------VGLVSKKVIS-------TTVVRSCIDSYASWFAVSP-------PFLER----- 258

Query: 329 LGVDKATGRLAAVAGTSTCHVALSRDPIF---VPGVWGPYRDVM--APGFWCAEGGQSCT 383
                    L  +AGTS+C+  +   P+    +PGVWGP+ +++     F     GQSCT
Sbjct: 259 --------SLFMIAGTSSCY--MYGTPVSNTKIPGVWGPFNNILDDKGDFSVYAAGQSCT 308

Query: 384 GALLAHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGD 443
           G L+ H+  +HP    +      +G   +  L   + + +  +K  S+  LAK +FFYGD
Sbjct: 309 GKLIEHLFESHPCARKIL----KSGADIYQVLEQTI-HGIEKKKGLSIHILAKDMFFYGD 363

Query: 444 YHGNRSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIM--CKSGHNI 501
           Y GNR+P AD  M+ + IG++ D S+ +L  +Y+   EF++ QT+ I++     K+   I
Sbjct: 364 YEGNRTPFADPRMKGSFIGETTDTSILNLTYKYISILEFLSFQTKLIIDTFQSQKACIRI 423

Query: 502 SSIFMSGGQCRNGLLMRLLADC-TGLPIIIPR-YIDAAVVFGSALLGAVASE 551
             + +SG Q RN  L+ L++    G+ I  PR  +D   + G+ +L   A+E
Sbjct: 424 QELRISGSQARNERLLSLISLVNNGMSINRPRDNVDMMGIKGAYILAKSANE 475

>SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
          Length = 547

 Score =  166 bits (421), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 162/535 (30%), Positives = 243/535 (45%), Gaps = 95/535 (17%)

Query: 35  IGVDVGTGSARACLIDSMGN--IMSLAEKPIQREELKPT-YITQSSKEIWSAICYCVKTV 91
           +GVD+G+ S R   I S+ N  ++ + E+P++      +   TQS+ EI +A+  C+  +
Sbjct: 13  VGVDLGSSSVRVG-IYSLENDSLLHVVERPVRYYSCGSSGRFTQSTGEIMAALQECLDEL 71

Query: 92  -VRDSGVDIERIHGIGFDATCSLVA--VNSKDGADVPV---GPDFENPDQNIILWMDHRA 145
            +R  G     I   G  ATCS+    V + DG+  P+   G D  + D+N++ WMD  A
Sbjct: 72  GLRPGG---RSIVSCGVAATCSMAVFTVEAGDGSLAPLDMSGLD-GSSDKNVVFWMDSVA 127

Query: 146 VQETAEINS--TNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYK 203
            +    ++   + H      GG +  EM +PK+  L    P         FDL  ++ Y 
Sbjct: 128 SEACDALDKRVSTHVKAALCGGFIP-EMGVPKLLHLVGQFPGRSLE---VFDLHKYIAYD 183

Query: 204 ATGLGTRSFNSSVCKQGLLP----LGVEGSNNGWSGEFL-NLIDLPELVANDFAKLGGSV 258
                 R +   +      P    +G +G   GW  EF  N++ LP  VA         V
Sbjct: 184 L----ARRYGWDMAALANRPNSNGIGHDGEVGGWPQEFYRNVLKLPATVA---------V 230

Query: 259 KPKGDDHRSNFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEI 318
            P      S F   GQ VG  S                   ID YA W G  + Q ++  
Sbjct: 231 GPA-----STF--KGQRVGVAS------------------CIDCYASWFGVCSTQPEQS- 264

Query: 319 PELAKCEKGKLGVDKATGRLAAVAGTSTCHV-ALSRDPIFVPGVWGPYRDVM--APGFWC 375
                              L  VAGTSTC++ A +     +PG+WGP+ +++      W 
Sbjct: 265 -------------------LFLVAGTSTCYLYASAASKTVLPGMWGPFTNLLDGEEARWS 305

Query: 376 A-EGGQSCTGALLAHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVAL 434
             E GQS TG LL H+  THPA  D  +  ++  L  F  L  R+  +  A    S+  L
Sbjct: 306 VYEAGQSTTGRLLEHLFETHPAARD--YAGDTGRL--FKDLEDRIADM-EADSGCSIHHL 360

Query: 435 AKHLFFYGDYHGNRSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVE-I 493
           A+H+F YG+  GNR+P AD  M    +G++ D S  +LAL+Y+   EF+A QTRQIVE  
Sbjct: 361 ARHMFLYGELQGNRTPYADPRMCGMFVGETTDTSFANLALKYVVVLEFLAFQTRQIVEGF 420

Query: 494 MCKSGHNISSIFMSGGQCRNGLLMRLLADCTG-LPIIIP-RYIDAAVVFGSALLG 546
              +   I  + ++G Q RN  L+ L++   G +P+ +P R    A V G+ LLG
Sbjct: 421 RTGAAAAIGELRVAGSQARNRRLLSLMSLVNGNMPVRVPARAAPLAGVRGAYLLG 475

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (67%)

Query: 693 RVLLNAKYKIFLDMANTQRQYRSAIDRVEAN 723
           R LL AKY I LDMA  Q++YRS ID V A 
Sbjct: 517 RRLLEAKYAIHLDMAQVQQRYRSEIDAVIAQ 547

>KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43
          Length = 533

 Score =  163 bits (413), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 148/532 (27%), Positives = 238/532 (44%), Gaps = 79/532 (14%)

Query: 35  IGVDVGTGSARACLID-SMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKTVVR 93
           +G+D+G+ + R  + D     ++ +  KP+         +TQSS +I SAI  C+    +
Sbjct: 11  LGIDLGSTAVRVGIYDLKTDKLIDIVAKPVPYTNHGGNRVTQSSTDIMSAIHGCI----Q 66

Query: 94  DSGVDIERIHGIGFDATCSLVAVNSKDGADVP---VGPDFENPDQNIILWMDHRAVQETA 150
           D   D++ +   G  ATCSL AV ++D  D+    +    + P  N++ WMD  A  E  
Sbjct: 67  DLNPDLKSVLSCGVAATCSL-AVFTQDIEDLKPLDIHGVKQEPCHNVVFWMDSSATLECE 125

Query: 151 EINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTR 210
            +N T   + +++GG    EM IPK+  +    P  + +    FDL  ++ Y+       
Sbjct: 126 IVNKTAGRLKEFMGGSFVPEMGIPKLASIFKK-PEAEGHKLEVFDLHSYIAYELAIKYGW 184

Query: 211 SFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFL 270
             +  + K     +G +G   GW   F N  D+ +L AN   K+G               
Sbjct: 185 DTSRIINKPNENRIGHDGELKGWDAGFYN--DVLKLPAN--VKIGP-------------- 226

Query: 271 SAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLG 330
                + AL+ E+   +         +  ID Y+ W    ++  +               
Sbjct: 227 -----IHALNTESPVRV---------ASCIDCYSNWFSMCSSSPNNS------------- 259

Query: 331 VDKATGRLAAVAGTSTCHV-ALSRDPIFVPGVWGPYRDVM----APGFWCAEGGQSCTGA 385
                  L   AGTSTC++ A + +   +PGVWGP+ +++    A  +   E GQS TG 
Sbjct: 260 -------LFMAAGTSTCYLYANTENKGCIPGVWGPFTNILDGSEAKEWSVYEAGQSTTGK 312

Query: 386 LLAHVLSTHPAYTDLEHLSESAGLSK-FDYLNSRLEYLVNARKERSVVALAKHLFFYGDY 444
           L+ H+  THPA       + S   SK F  + S +E L     E SV   +KH+F YG+ 
Sbjct: 313 LIEHLFETHPAAR-----AYSMDKSKLFSAIESAIEKLEQDFGE-SVHFRSKHMFTYGEL 366

Query: 445 HGNRSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSI 504
            GNR+P  D++M    IG++ D S  DL L+Y+   EF+A Q + I E        I  I
Sbjct: 367 QGNRTPYCDSSMSGMFIGETTDTSFQDLVLKYVTILEFLAFQVKHIKECF---KAEIKDI 423

Query: 505 FMSGGQCRNGLLMRLLADCTG-LPIIIP-RYIDAAVVFGSALLGAVASESYN 554
            ++G Q +N  L+ L +     + + IP +  D   V G+ LLG  A ++ N
Sbjct: 424 RIAGSQAKNTRLLTLFSLVNDQITVKIPAQRTDYMGVEGAYLLGKAAHKNIN 475

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 22/28 (78%)

Query: 693 RVLLNAKYKIFLDMANTQRQYRSAIDRV 720
           + LL AKYKI+LDMA TQ +YR+ +D V
Sbjct: 506 KQLLEAKYKIYLDMAQTQMRYRAMVDSV 533

>Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {ON}
           YNL249C (MPA43) - Overexpression leads to increased
           levels of the lyase PDC1 [contig 116] FULL
          Length = 534

 Score =  162 bits (409), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 153/537 (28%), Positives = 232/537 (43%), Gaps = 103/537 (19%)

Query: 35  IGVDVGTGSARACLID-SMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKTVVR 93
           +G+D+G+   R    +      +++  + +   E +    TQSS EI  AI  C +++  
Sbjct: 8   LGIDLGSTGVRVGAYNLETDEPIAVVSRTVNYYEQEKGRYTQSSAEIMRAIVECFESL-- 65

Query: 94  DSGVDIERIHGIGFDATCSLVAV--NSKDGADVPVGPDFEN----PDQNIILWMDHRAVQ 147
              +DI  +   G  ATCSL     NS  G   P G  +E+     DQN++ WMD  A++
Sbjct: 66  --NIDIWAVQSCGVAATCSLAVFIRNSTKGLQ-PFGV-YEDLRPLNDQNVVFWMDSNAIE 121

Query: 148 ETAEINSTNHPVLKYVGGQMSIEMEIPKIKWL-----KNHMPREKFN--DTVFFDLADFL 200
           E + IN        Y GG    EM +PK+        KN+   E F+    V +DLA+  
Sbjct: 122 ECSNINDLAINEKAYFGGSFIPEMGVPKLASFLKSCSKNNSDFEVFDLHTYVAYDLANRY 181

Query: 201 TYKATGLGTRSFNSSVCKQGLLPLGVEGSNNGWSGEFL-NLIDLPELVANDFAKLGGSVK 259
            + A+ L  R  ++ +        G +G   GW  EF    + LP  V          + 
Sbjct: 182 GWDASFLINRPNHNGI--------GHDGEIKGWKDEFYEKTLKLPPNV---------RIG 224

Query: 260 PKGDDHRSNFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIP 319
           P   + R             SP   A              ID Y+ W    ++      P
Sbjct: 225 PLCINRR------------FSPVKVA------------SCIDCYSSWFSMFSS-----TP 255

Query: 320 ELAKCEKGKLGVDKATGRLAAVAGTSTCHVALSRDPI-FVPGVWGPYRDVM----APGFW 374
           E +               L   AGTSTC++  +  P   +PG+WGP+ D++     P + 
Sbjct: 256 ERS---------------LFMAAGTSTCYLYANNKPSECLPGIWGPFTDILDSKDPPSWS 300

Query: 375 CAEGGQSCTGALLAHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVAL 434
             E GQS TG L+ H+  +HPA            L   + L +RLE  +N  +++S  ++
Sbjct: 301 VYEAGQSTTGKLIEHLFESHPA--------AKPYLEDRNVLFNRLETEINLIEQQSAESV 352

Query: 435 ---AKHLFFYGDYHGNRSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIV 491
               KH+F YG+  GNR+P  D  M    IG+S D S  DL L+Y+   EF+A Q R I 
Sbjct: 353 HFKTKHMFNYGELQGNRTPYCDPEMSGMFIGESADTSFRDLTLKYVTVLEFLAFQVRHIK 412

Query: 492 EIMCKSGHNISSIFMSGGQCRNGLLMRLLADCT-GLPIIIP-RYIDAAVVFGSALLG 546
           E +   G  I+ I ++G Q +N  L+ L++    G  + IP    D   V G+ LLG
Sbjct: 413 ECL---GAPINDIRVAGSQAKNNRLLSLISFVNHGSRVRIPATRADYVGVQGAYLLG 466

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 688 DTNPDRVLLNAKYKIFLDMANTQRQYRSAID 718
           + N  R L   KYKI+L+MA TQRQYR  ++
Sbjct: 500 EENKLRALFEIKYKIYLNMAQTQRQYREMVN 530

>KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {ON}
           Anc_1.111 YNL249C
          Length = 535

 Score =  142 bits (359), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 149/537 (27%), Positives = 236/537 (43%), Gaps = 101/537 (18%)

Query: 35  IGVDVGTGSARACLI----DSMGNIMSLAEKPI----QREELKPTYITQSSKEIWSAICY 86
           IG+D+G+ S R  +     DS+  + S   KP+    +         TQ S EI +AI  
Sbjct: 8   IGIDLGSSSVRVGIYSLHDDSLLGVFS---KPVPYYYESNRTSLWEYTQDSAEILTAIKE 64

Query: 87  CVKTVVRDSGVDIER--IHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHR 144
           C          D+++  +   G  ATCSLV +  + G D       E   +N++ WMD  
Sbjct: 65  CFDMA------DLQKYDVKSCGVAATCSLV-LCERSGDDT--FQHCEGDSRNVVFWMDSM 115

Query: 145 AVQETAEINS-TNHPVLKYVGGQMSIEMEIPKI-KWLKNHMPREKFN-DTVFFDLADFLT 201
           A +ET  +N+     +L ++GG    EM IPK+ ++LK+     K N     FDL  ++ 
Sbjct: 116 AKEETNSLNARCPQDILGHMGGGFIPEMGIPKLSRFLKSISDEPKGNIQWEVFDLHKYVA 175

Query: 202 YKATG---LGTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLN-LIDLPELVANDFAKLGGS 257
           YK        T   ++     G+   G +G   GWS  F + ++ LP  V     K    
Sbjct: 176 YKLAQEYCWNTERLSNHPNSNGI---GHDGELAGWSKSFYDKIVRLPPNVTIGCPK---- 228

Query: 258 VKPKGDDHRSNFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEE 317
                                 + E    L + D C      ID Y+ W   + +     
Sbjct: 229 ----------------------TIENEDSLVIVDSC------IDCYSSWFSPLQS----- 255

Query: 318 IPELAKCEKGKLGVDKATGRLAAVAGTSTCHV---ALSRDPIFVPGVWGPYRDVMAPGFW 374
                        ++K T  L  VAGTSTC++      +    V G+WGP+ D++     
Sbjct: 256 -------------LNKNT--LFLVAGTSTCYIYSPGTMKTETSVKGIWGPFTDILGANKV 300

Query: 375 CAEGGQSCTGALLAHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVAL 434
             E G SC+G L+ H+ ++HP+   L +LS          L S+LE  +N  + ++  ++
Sbjct: 301 VYESGSSCSGKLIEHLFTSHPSAISL-NLSTGQ-------LISKLEEEINIWETQNATSI 352

Query: 435 ---AKHLFFYGDYHGNRSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIV 491
              A + F YGD  GNR+P  D  MR   IG+S D S  DL ++Y+   E +A QT+ +V
Sbjct: 353 HFEACNNFLYGDLDGNRTPFGDPYMRGMFIGESPDTSFRDLLVKYVCILECLAFQTKLMV 412

Query: 492 EIMCKSGHNISSIFMSGGQCRNGLLMRL--LADCTGLPIIIPRYIDAAVVFGSALLG 546
           +   K  ++I+ +F+ G Q +N  L++L  L +   L ++     D   V G+ LLG
Sbjct: 413 DNFEKL-NSINELFICGSQAKNTRLLKLISLINDNALILVPKEKEDLMGVEGAYLLG 468

>KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
           and similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 516

 Score =  122 bits (305), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 125/505 (24%), Positives = 214/505 (42%), Gaps = 94/505 (18%)

Query: 35  IGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTY------ITQSSKEIWSAICYCV 88
           IGVD+G+   R  + D   +  SL +   + +E  P +      ITQ + +I +A+    
Sbjct: 6   IGVDLGSTEFRIGIFDYYTD--SLVK---ETKEKVPYFRHGNGIITQCTSDILTAVEKAF 60

Query: 89  KTVVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVG--PDFENPDQNIILWMDHRAV 146
            T+     +    I  +G  ATCS+V    KD   +P     D      +II WM   A+
Sbjct: 61  NTLY----IQEYNICSLGVGATCSMVVGKQKDENLIPFNLIHDKNGRYHDIIFWMHSAAI 116

Query: 147 QETAEINS-TNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKAT 205
           +ET  +N+ T+  +L + GG+   EM IPK+  L N + ++  +     DL  +L +K +
Sbjct: 117 EETEYLNNITDESILCHFGGKFFPEMAIPKLLHL-NKLYKD--DGLTVLDLHIWLLWKIS 173

Query: 206 -GLGTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDD 264
             LG +     V +     +G +G   GWS EF   + L ++       +G +   K ++
Sbjct: 174 LKLGHKEL-MPVQEPNSNGIGHDGELFGWSKEFYEHLQLNKIF------IGNNAVIKKNE 226

Query: 265 HRSNFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKC 324
                                          G   ID YA W                +C
Sbjct: 227 Q-----------------------------FGDSCIDCYASWF---------------QC 242

Query: 325 EKGKLGVDKATGRLAAVAGTSTCHVALSR-DPIFVPGVWGPYRDVMA--------PGFWC 375
               +        L  VAGTSTC +  S     F+PG+WGP++D++           +  
Sbjct: 243 WSTAM----LNRTLFVVAGTSTCFLYASDCFESFIPGIWGPFKDILVNRKHISKHDNYSV 298

Query: 376 AEGGQSCTGALLAHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALA 435
            E G S TG LL  +LSTHPA  D       + ++  + +  +++ L+     +S+  + 
Sbjct: 299 YEAGISRTGVLLEKLLSTHPAVKD-------SDVNFLETVEHKID-LIEQSDTQSIHLMI 350

Query: 436 KHLFFYGDYHGNRSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMC 495
           K+ FF+ DY    S         +I+ +  + ++ DLAL+Y+   E +A Q   ++    
Sbjct: 351 KNTFFHEDYEEFESSFVQKDTSGSILKEGYNPTLKDLALKYVVIIETLAFQIVDVINAFE 410

Query: 496 KSGHNISSIFMSGGQCRNGLLMRLL 520
           +    IS + ++G Q +N  L+++L
Sbjct: 411 EGHITISKLLITGSQAKNSRLLQIL 435

>NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {ON}
           Anc_1.111 YNL249C
          Length = 549

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 126/583 (21%), Positives = 224/583 (38%), Gaps = 124/583 (21%)

Query: 35  IGVDVGTGSARACLIDSMG--NIMSLAEKPIQREE--LKPTYITQSSKEIWSAICYCVKT 90
           IG+DVG+ S R  + +      I ++ ++ + + E   K  + TQ++  +  +I     T
Sbjct: 5   IGIDVGSTSVRIGIFNYEDGTTIKTIVKEMLYKHEPDSKLWHYTQNAFVMRDSIF----T 60

Query: 91  VVRDSGVDIERIHGIGFDATCSLVAVNSKDGAD----VPVGPDFENPDQNIILWMDHRAV 146
            + +  V+   +   G  ATCS+V +     AD    + +  +  N   +II W DH A 
Sbjct: 61  ALEELHVNSYIVKICGVSATCSMVFLQRDSPADHLRPLTIIHEETNNTDSIIFWKDHTAQ 120

Query: 147 QETAEINS-----------TNHPVLKYVGGQMSI--EMEIPKIKWLKNHMPREKFNDTV- 192
            E   +N+             + +L  +G +     EM IPK+  L N + +E F +T  
Sbjct: 121 PEAQRLNNKLRTANEGLSGKENKILSTLGSRSGFIGEMAIPKLSRLIN-LIKEGFYETPH 179

Query: 193 FFDLADFLTYKATGLGTRSFNSSVCKQ---GLLPLGVEGSNNGWSGEFLNLIDLPELVAN 249
             ++ D   Y A  L  +   ++V  Q    +  +G++G   GW   F            
Sbjct: 180 ILEVYDLHVYIAQTLAQKYDWNTVHLQNKPNVNGIGIDGELQGWDLSF------------ 227

Query: 250 DFAKLGGSVKPKGDDHRSNFLSAGQYVGALSPEAAADLGLADHCVVGS-------GVIDA 302
                                    YV AL PE +  + +    V+           ID 
Sbjct: 228 -------------------------YVWAL-PETSFPICIGPSKVINETSIVRPKSCIDC 261

Query: 303 YAGWVGTVAAQTDEEIPELAKCEKGKLGVDKATGRLAAVAGTSTCHV-ALSRDPIFVPG- 360
           YA W  T A   D+                     L   AGTSTC + A+ R  +   G 
Sbjct: 262 YASWFSTDACTKDD--------------------TLFMAAGTSTCCLYAMPRSALEYFGE 301

Query: 361 -------VWGPYRDVMAPGFWCA-EGGQSCTGALLAHVLSTHPAYTDLEHLSESAGLSK- 411
                   WGP+ +V+      + E G S TG LL  + + H        ++ S  +++ 
Sbjct: 302 QQQPLSLFWGPFTNVLDKDKKSSFEIGFSETGILLEKLFNKH-------QITASWSVAES 354

Query: 412 FDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRSPIADNTMRAAII--GQSMDNSV 469
            +Y+ +++   +  RK+   + L   ++ +  Y     P   +T     +     + +S 
Sbjct: 355 INYVENQIA--IYERKKSHSIYLEPEIYLFLKYLTLNKPSGRDTPDTPDLFGNDGVTDST 412

Query: 470 DDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGGQCRNGLLMRLLA---DCTGL 526
             L  +Y+   E++A Q   ++    K    I+ + +SG Q +N  L+ L+    D T +
Sbjct: 413 LGLIFKYIAILEYLAYQVSNLILQFQKEKIIINHLVLSGSQAQNKRLLDLILFMHDGT-I 471

Query: 527 PIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTDLRKRRASS 569
            II+P        FG+        ++Y  H +  D  K R ++
Sbjct: 472 DIIVPA---EDWKFGAMKGAFYLGKAYFLHQSIVDFLKSRKNA 511

>KAFR0F02950 Chr6 complement(583768..584796) [1029 bp, 342 aa] {ON}
           Anc_2.385 YMR144W
          Length = 342

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 11/87 (12%)

Query: 91  VVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQ--- 147
           ++R + VD+ +I GI FD++ S V +N+ +           N   N++  +   A Q   
Sbjct: 206 LLRQNSVDVSQIEGISFDSSTSSVRINTSESIS-------RNKKSNMLRTLGVLATQVLN 258

Query: 148 ETAEINSTNHPVLKYVG-GQMSIEMEI 173
           +  E  S N  +L+ +G G    E EI
Sbjct: 259 DNTEDTSANQTILQPIGKGDDETEAEI 285

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,242,308
Number of extensions: 2949419
Number of successful extensions: 6431
Number of sequences better than 10.0: 33
Number of HSP's gapped: 6484
Number of HSP's successfully gapped: 62
Length of query: 730
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 613
Effective length of database: 40,065,477
Effective search space: 24560137401
Effective search space used: 24560137401
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)