Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C01738g8.258ON41441421580.0
TDEL0F038508.258ON41942016160.0
NCAS0B049908.258ON42042115800.0
Smik_12.1448.258ON43843815690.0
YLR085C (ARP6)8.258ON43843815640.0
KAFR0B027008.258ON42042015470.0
Suva_10.1698.258ON43843815490.0
Skud_12.1538.258ON43843815390.0
Kpol_543.368.258ON42742715020.0
Kwal_56.238328.258ON41941914970.0
TBLA0H014608.258ON44244314850.0
KLTH0G13772g8.258ON42042314810.0
NDAI0B019608.258ON43943914790.0
SAKL0H17138g8.258ON41942014710.0
AGR091W8.258ON41041114340.0
Ecym_43128.258ON41141014310.0
CAGL0L12166g8.258ON42141614270.0
KNAG0G020108.258ON42442214230.0
KLLA0F19063g8.258ON41542113950.0
TPHA0A018308.258ON42142213750.0
NCAS0C037008.23ON3754152552e-23
TBLA0C004408.23ON3754152533e-23
TPHA0D002508.23ON3754152523e-23
TDEL0C004708.23ON3754152524e-23
CAGL0K12694g8.23ON3754152524e-23
Suva_6.188.23ON3754152524e-23
Smik_6.398.23ON3754152524e-23
YFL039C (ACT1)8.23ON3754152524e-23
ZYRO0F02772g8.23ON3754152514e-23
KNAG0L002508.23ON3754152515e-23
KAFR0D009408.23ON3754152515e-23
SAKL0B00968g8.23ON3754152506e-23
NDAI0G030408.23ON3754152506e-23
ABR222W8.23ON3764152507e-23
Kpol_1058.158.23ON3754152472e-22
Ecym_15208.23ON3764152463e-22
KLTH0G18832g8.23ON3754152463e-22
KLLA0D05357g8.23ON3754152453e-22
Skud_6.318.23ON3603662382e-21
Kwal_14.11098.23ON3603662312e-20
Ecym_63852.117ON3774192153e-18
NDAI0G029003.161ON3913622153e-18
SAKL0E11814g2.117ON3794222128e-18
TBLA0F008703.161ON3913622064e-17
KLTH0F06490g3.161ON3913622041e-16
AFR051W2.117ON4054082031e-16
NCAS0C035503.161ON3923622012e-16
Smik_4.2063.161ON3913622003e-16
ZYRO0B04928g3.161ON3913622003e-16
KLLA0E22925g2.117ON3804151993e-16
YDL029W (ARP2)3.161ON3913621994e-16
Suva_4.2203.161ON3913621985e-16
KNAG0K01130na 1ON3933661985e-16
CAGL0K01595g3.161ON3913621961e-15
SAKL0C07370g3.161ON3913621951e-15
Skud_4.2223.161ON3913621942e-15
Ecym_52373.161ON3913621942e-15
ADR316W3.161ON3913621932e-15
KLLA0C03850g3.161ON3913621933e-15
NCAS0B071302.117ON3814251923e-15
TDEL0D046103.161ON3913621923e-15
Kwal_33.141773.161ON3372961852e-14
ZYRO0G05676g2.117ON3813641852e-14
Kpol_479.253.161ON3913621843e-14
Kpol_1023.188.23ON3193171823e-14
KAFR0C01040na 1ON3372961754e-13
TPHA0A009203.161ON3913621721e-12
NDAI0B044602.117ON3814111711e-12
Smik_8.2102.117ON3844111665e-12
Skud_8.1902.117ON3844051649e-12
TPHA0I013002.117ON3794151641e-11
YHR129C (ARP1)2.117ON3843581594e-11
Suva_15.3262.117ON3843591585e-11
KLTH0B05940g2.117ON3834261585e-11
Kwal_33.146422.117ON3834211552e-10
KNAG0I018602.248ON7531541553e-10
TBLA0B010702.117ON3834121533e-10
TDEL0B048102.117ON3734091471e-09
KAFR0F005902.117ON3864111471e-09
TDEL0C041402.248ON7491581454e-09
CAGL0H09042g2.117ON3873951435e-09
YNL059C (ARP5)2.248ON7551541421e-08
Ecym_32852.248ON7461541411e-08
Skud_14.2722.248ON7551541411e-08
ADL253C2.248ON7511591411e-08
Kpol_1003.162.248ON7491531411e-08
ZYRO0G01936g1.514ON4613161392e-08
NDAI0G055801.287ON5152251382e-08
SAKL0E08602g2.248ON7471541383e-08
NDAI0D010602.248ON7531521374e-08
KNAG0B001701.514ON4533341355e-08
Suva_14.2812.248ON7551521348e-08
KNAG0H036502.117ON3874111338e-08
Kwal_23.48482.248ON7451591349e-08
Ecym_31531.514ON4583341311e-07
SAKL0D12804g1.514ON4563341312e-07
KLTH0G09482g2.248ON7451541322e-07
AFR419C1.514ON4553341302e-07
NCAS0A122701.514ON4543161292e-07
KLLA0F03421g2.248ON747851302e-07
Smik_14.2672.248ON7551541293e-07
TBLA0D036801.514ON4583161283e-07
Suva_12.1541.514ON4493341284e-07
Smik_10.3551.514ON4493341284e-07
KLLA0B13904g1.514ON4563161284e-07
YJR065C (ARP3)1.514ON4493341284e-07
Kpol_1056.161.514ON4603161275e-07
AFR105C1.287ON4792201275e-07
KLTH0C02508g1.514ON4513341266e-07
Skud_10.2891.514ON4493161266e-07
Kwal_14.23771.287ON4812201266e-07
NDAI0A039701.514ON4623161267e-07
TPHA0C031602.248ON755861267e-07
KLTH0H09702g1.287ON4812201267e-07
KAFR0D037001.514ON4493341258e-07
TBLA0E038602.248ON7591541251e-06
CAGL0F00517g1.514ON4543161231e-06
TPHA0O010401.514ON4583191231e-06
Kwal_27.99581.514ON4453341231e-06
TDEL0F004701.514ON4613161232e-06
KAFR0J011602.248ON7511541232e-06
CAGL0J10054g2.248ON7541541214e-06
Smik_10.1611.287ON4892161178e-06
YJL081C (ARP4)1.287ON4892161179e-06
KNAG0B019201.287ON5052351152e-05
ZYRO0A01584g2.248ON7481551143e-05
Suva_6.1541.287ON4892161124e-05
KLLA0D02288g1.287ON5202191097e-05
Ecym_63301.287ON4802221081e-04
CAGL0M03201g1.287ON4932301081e-04
TBLA0D053601.287ON5961571081e-04
TDEL0C031207.448ON4384481071e-04
Skud_10.1321.287ON4882191062e-04
NCAS0G030502.248ON7432121053e-04
Kpol_282.41.287ON5011531034e-04
TDEL0D015501.287ON480911000.001
SAKL0F13772g7.448ON4222811000.001
NCAS0B060601.287ON497227980.002
SAKL0D05874g1.287ON497149970.002
ACR184C7.448ON401264970.002
ZYRO0G21428g1.287ON483226960.003
KAFR0A015601.287ON48591940.006
YPR034W (ARP7)7.448ON477307930.007
Smik_13.2032.593ON467211890.020
TPHA0I010301.287ON503151890.023
ZYRO0G17182g7.448ON465323870.040
Kwal_27.105527.448ON351211830.11
Smik_16.2787.448ON476306830.12
Suva_16.3647.448ON480307800.24
CAGL0K05335g7.448ON52983790.36
YMR033W (ARP9)2.593ON467211780.44
NDAI0A013007.448ON565154770.56
Suva_13.2022.593ON467211760.72
Skud_13.1892.593ON467211750.93
Kpol_520.117.448ON48892751.1
KNAG0H005702.593ON469214741.3
KNAG0B021107.448ON48544731.8
TBLA0H028002.593ON48442722.4
KLLA0E06315g7.448ON438137713.4
Skud_16.3217.448ON47981703.6
TPHA0B014607.448ON485198696.0
NDAI0G049001.455ON1444106688.6
KAFR0D010308.50ON73091688.7
Ecym_35681.484ON51288679.5
TBLA0C008402.638ON42435679.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C01738g
         (414 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...   835   0.0  
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...   627   0.0  
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...   613   0.0  
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...   608   0.0  
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...   607   0.0  
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...   600   0.0  
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...   601   0.0  
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...   597   0.0  
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...   583   0.0  
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...   581   0.0  
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...   576   0.0  
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...   575   0.0  
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...   574   0.0  
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...   571   0.0  
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...   556   0.0  
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...   555   0.0  
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...   554   0.0  
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...   552   0.0  
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...   541   0.0  
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...   534   0.0  
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   102   2e-23
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   102   3e-23
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   101   3e-23
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   101   4e-23
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   101   4e-23
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   101   4e-23
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   101   4e-23
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   101   4e-23
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...   101   4e-23
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   101   5e-23
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   101   5e-23
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...   100   6e-23
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   100   6e-23
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   100   7e-23
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...   100   2e-22
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...    99   3e-22
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...    99   3e-22
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...    99   3e-22
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    96   2e-21
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...    94   2e-20
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    87   3e-18
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    87   3e-18
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    86   8e-18
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    84   4e-17
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    83   1e-16
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    83   1e-16
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    82   2e-16
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    82   3e-16
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    82   3e-16
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    81   3e-16
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    81   4e-16
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    81   5e-16
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    81   5e-16
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    80   1e-15
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    80   1e-15
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    79   2e-15
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    79   2e-15
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    79   2e-15
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    79   3e-15
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    79   3e-15
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    79   3e-15
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    76   2e-14
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    76   2e-14
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    75   3e-14
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...    75   3e-14
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    72   4e-13
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    71   1e-12
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    70   1e-12
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    69   5e-12
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    68   9e-12
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    68   1e-11
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    66   4e-11
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    65   5e-11
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    65   5e-11
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    64   2e-10
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    64   3e-10
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    64   3e-10
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    61   1e-09
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    61   1e-09
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    60   4e-09
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    60   5e-09
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    59   1e-08
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    59   1e-08
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    59   1e-08
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    59   1e-08
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    59   1e-08
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...    58   2e-08
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    58   2e-08
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    58   3e-08
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    57   4e-08
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...    57   5e-08
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    56   8e-08
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    56   8e-08
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    56   9e-08
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...    55   1e-07
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...    55   2e-07
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    55   2e-07
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...    55   2e-07
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...    54   2e-07
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    55   2e-07
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    54   3e-07
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...    54   3e-07
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...    54   4e-07
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...    54   4e-07
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...    54   4e-07
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...    54   4e-07
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....    54   5e-07
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    54   5e-07
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...    53   6e-07
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...    53   6e-07
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    53   6e-07
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514     53   7e-07
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    53   7e-07
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    53   7e-07
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...    53   8e-07
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    53   1e-06
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...    52   1e-06
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....    52   1e-06
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...    52   1e-06
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...    52   2e-06
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    52   2e-06
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    51   4e-06
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    50   8e-06
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    50   9e-06
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    49   2e-05
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    49   3e-05
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    48   4e-05
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    47   7e-05
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    46   1e-04
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    46   1e-04
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    46   1e-04
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    46   1e-04
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    45   2e-04
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    45   3e-04
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    44   4e-04
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    43   0.001
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    43   0.001
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    42   0.002
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    42   0.002
ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON} S...    42   0.002
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    42   0.003
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    41   0.006
YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}  ARP7Compo...    40   0.007
Smik_13.203 Chr13 (331960..331989,332074..333447) [1404 bp, 467 ...    39   0.020
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    39   0.023
ZYRO0G17182g Chr7 (1417793..1419190) [1398 bp, 465 aa] {ON} simi...    38   0.040
Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {...    37   0.11 
Smik_16.278 Chr16 (516276..517706) [1431 bp, 476 aa] {ON} YPR034...    37   0.12 
Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034...    35   0.24 
CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} simil...    35   0.36 
YMR033W Chr13 (337788..337817,337904..339277) [1404 bp, 467 aa] ...    35   0.44 
NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {O...    34   0.56 
Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 ...    34   0.72 
Skud_13.189 Chr13 (324460..324489,324579..325952) [1404 bp, 467 ...    33   0.93 
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    33   1.1  
KNAG0H00570 Chr8 complement(91418..92827) [1410 bp, 469 aa] {ON}...    33   1.3  
KNAG0B02110 Chr2 complement(399743..401200) [1458 bp, 485 aa] {O...    33   1.8  
TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.5...    32   2.4  
KLLA0E06315g Chr5 complement(567309..568625) [1317 bp, 438 aa] {...    32   3.4  
Skud_16.321 Chr16 (604148..605587) [1440 bp, 479 aa] {ON} YPR034...    32   3.6  
TPHA0B01460 Chr2 complement(325847..327304) [1458 bp, 485 aa] {O...    31   6.0  
NDAI0G04900 Chr7 (1179776..1184110) [4335 bp, 1444 aa] {ON} Anc_...    31   8.6  
KAFR0D01030 Chr4 (212780..212792,212864..215043) [2193 bp, 730 a...    31   8.7  
Ecym_3568 Chr3 (1077825..1079363) [1539 bp, 512 aa] {ON} similar...    30   9.5  
TBLA0C00840 Chr3 complement(172404..173678) [1275 bp, 424 aa] {O...    30   9.9  

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score =  835 bits (2158), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/414 (97%), Positives = 402/414 (97%)

Query: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60
           MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP
Sbjct: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60

Query: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120
           HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF
Sbjct: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120

Query: 121 EEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWVV 180
           EEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWVV
Sbjct: 121 EEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWVV 180

Query: 181 PVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVSPVSYF 240
           PVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVSPVSYF
Sbjct: 181 PVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVSPVSYF 240

Query: 241 ESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETFFHPEIPQ 300
           ESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETFFHPEIPQ
Sbjct: 241 ESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETFFHPEIPQ 300

Query: 301 LLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCT 360
           LLKPG            PEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCT
Sbjct: 301 LLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCT 360

Query: 361 VHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQNWM 414
           VHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQNWM
Sbjct: 361 VHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQNWM 414

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/420 (70%), Positives = 346/420 (82%), Gaps = 7/420 (1%)

Query: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60
           MES P+VVDNGSYE+KFG      P RA NALARDKFG+ YLSNQI  IKDISSV F+RP
Sbjct: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60

Query: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120
           HE+GQLTSWEL+S +WDYCFFNP+EF+GFDLKDSKGQHL+ SETCMT+PELSKNMDQVVF
Sbjct: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFASMFKSPIAGFAPFGR---PSIAISGKGDDQP-NRKAEPDAYEPFQLVIDVGFNC 176
           EEYEF S+ K+PI+GF PF +    +  ISGKGD +     +E   YEPFQ+VID GFNC
Sbjct: 121 EEYEFDSLLKAPISGFMPFSKHTENTKVISGKGDSESGTSTSETKDYEPFQMVIDSGFNC 180

Query: 177 TWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVSP 236
           TWVVP+IKG+P+YKAVKKLD+GGRF+NGLLKETLSFRHYNVMDETILVNNIKE CLF+SP
Sbjct: 181 TWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFMSP 240

Query: 237 VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETFFHP 296
           VSYF+SF  K+QTAVEYVLPDFQT+FLGYV D K P  +D+QTV L+DELFSVPETFFHP
Sbjct: 241 VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFFHP 300

Query: 297 EIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPTD 356
           EI QLLKPG            PE LRPLM+ NI+CTGGNFNLP+F  RLATELQRQLPTD
Sbjct: 301 EIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTD 360

Query: 357 WTCTVHLPSGPK--ELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQNWM 414
           W+  ++LP  PK  EL GW SM++F ++ LY  ARV+R+EY+EHGV+W T++RFGYQNW+
Sbjct: 361 WSAKIYLPQ-PKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQNWI 419

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/421 (68%), Positives = 340/421 (80%), Gaps = 8/421 (1%)

Query: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60
           MES PI +DNGSYEIKFGT DL +P+RA NA A DK+ + YLSNQIK IKDI+SV FRRP
Sbjct: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60

Query: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120
           HE GQLTSWELES+IWDY  FNPDEF GFDL D KG+HL+ SETCMT+PELSKNMDQVVF
Sbjct: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFASMFKSPIAGFAPFG--RPSIAISGKGD-----DQPNRKAEPDAYEPFQLVIDVG 173
           EEYEF S +KS IAGF  F   + +  ISGK +     D  N+  E + Y  +QLVID G
Sbjct: 121 EEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKE-YNDYQLVIDSG 179

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLF 233
           FNCTW++PVIKG+PYYKAVKKLDIGGRFL+GLLKETLSFRHY+VMDETILVNNIKENCLF
Sbjct: 180 FNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLF 239

Query: 234 VSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETF 293
           VSP SYF+SFK+K +TAVEYVLP+FQT+FLG+V+D  KPLP+++QT++L DELFSVPETF
Sbjct: 240 VSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSVPETF 299

Query: 294 FHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQL 353
           FHPEI ++LKPG            PE LRPL++GN+VCTGGNFNLP+FATRL +ELQRQL
Sbjct: 300 FHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQL 359

Query: 354 PTDWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQNW 413
           PTDW C   +P+   EL+GW +MA F ++  Y   RVTREEY+EHG DW T++RFGYQNW
Sbjct: 360 PTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGYQNW 419

Query: 414 M 414
           +
Sbjct: 420 I 420

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/438 (66%), Positives = 338/438 (77%), Gaps = 24/438 (5%)

Query: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60
           ME+ PIV+DNGSYEIKFG    E P RA NALA+DKFG+ YLSN IK IKDISSV FRRP
Sbjct: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120
           HE GQLT WELES IWDYCFFNP EF+GFDLK+ KG HLV SE+CMT+PELSK+ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFASMFKSPIAGFAPFGRP----SIAISGKGDDQP---NRKAEPDA----------- 162
           EEYEF S+FKSP+A F PF +       AISGK +D     ++  E D            
Sbjct: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180

Query: 163 ---YEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
              Y  FQLVID GFNCTW++PV+KGIPYYKAVKKLD+GGRFL GLLKETLSFRHYN+MD
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240

Query: 220 ETILVNNIKENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKK---PLPQD 276
           ETILVNNIKE CLFVSPVSYF+SFK K++ A+EYVLPDFQTSFLGYV++ +K   PL +D
Sbjct: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300

Query: 277 SQTVELKDELFSVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNF 336
           +QT+ L DELF++PETFFHPEI Q+ KPG            PE +RPLM+GNIVCTGGNF
Sbjct: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 337 NLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYF 396
           NLPNFA RLA ELQRQLPTDWTC V +P     L+GW  M+ F+++  Y +ARVTREEY+
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYY 420

Query: 397 EHGVDWCTRHRFGYQNWM 414
           EHG DWCT+HRFGYQNW+
Sbjct: 421 EHGSDWCTKHRFGYQNWI 438

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/438 (66%), Positives = 334/438 (76%), Gaps = 24/438 (5%)

Query: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60
           ME+PPIV+DNGSYEIKFG    + P RA NALA+DKFG+ YLSN IK IKDISS+ FRRP
Sbjct: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120
           HE GQLT WELES IWDYC FNP EF+GFDLK+ KG HLV SE+CMT+PELSK+ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFASMFKSPIAGFAPFGRP----SIAISGKGDD-----------------QPNRKAE 159
           EEYEF S+FKSP+A F PF +        ISGK +D                   N +  
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGNSDSTNSTSSESKNAQDS 180

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
              Y  FQLVID GFNCTW++PV+KGIPYYKAVKKLDIGGRFL GLLKETLSFRHYN+MD
Sbjct: 181 GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 220 ETILVNNIKENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKK---PLPQD 276
           ETILVNNIKE CLFVSPVSYF+SFK K++ A+EYVLPDFQTSFLGYV++P+K   PLP+D
Sbjct: 241 ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED 300

Query: 277 SQTVELKDELFSVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNF 336
           +Q + L DELF++PETFFHPEI Q+ KPG            PE +RPLM+GNIVCTGGNF
Sbjct: 301 AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 337 NLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYF 396
           NLPNFA RLA ELQRQLPTDWTC V +P G   L+GW  M+ F  +  Y  ARVTREEY+
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYY 420

Query: 397 EHGVDWCTRHRFGYQNWM 414
           EHG DWCT+HRFGYQNW+
Sbjct: 421 EHGPDWCTKHRFGYQNWI 438

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/420 (65%), Positives = 335/420 (79%), Gaps = 6/420 (1%)

Query: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60
           ME  P+V+DNGSY +KFG   LE P+ A NA+A DK+ + YLSNQIK+IKDISSV  +RP
Sbjct: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKRP 60

Query: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120
           H  GQLTSWE+++ IWDYC +NPDEFNGF++ D+K +HL+ SETCMT+PEL KNMDQV+F
Sbjct: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120

Query: 121 EEYEFASMFKSPIAGFAPFGRPSI--AISGKGDDQPNRKA-EPDAYEPFQLVIDVGFNCT 177
           EEYEF S+ KSP+AG+ PF R +    I G+ D +P  +    + Y  FQLV+D GFNCT
Sbjct: 121 EEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSGFNCT 180

Query: 178 WVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVSPV 237
           W++PVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKE CLFVSP 
Sbjct: 181 WIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFVSPA 240

Query: 238 SYFESFKHKEQTAVEYVLPDFQTSFLGYVK---DPKKPLPQDSQTVELKDELFSVPETFF 294
           SYF+SFK+K+ T+ EYVLPDFQTSFLGYV+   +  KPLP+DSQ++ LKDELF+VPETFF
Sbjct: 241 SYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPETFF 300

Query: 295 HPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLP 354
           HPEI Q+LKPG            PE +RPLM+ NI+C GGNFNLP+FA+R+A ELQRQLP
Sbjct: 301 HPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLP 360

Query: 355 TDWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQNWM 414
           TDW C + +  G  EL GW +M+SF ++ +Y   RVTREEY+EHG+DWCT+HRFGYQNW+
Sbjct: 361 TDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGYQNWV 420

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/438 (65%), Positives = 332/438 (75%), Gaps = 24/438 (5%)

Query: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60
           ME+PPIV+DNGSYEIKFG    + P RA NALA+DKFG+ YLSN IK IKDISSV FRRP
Sbjct: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120
           HE GQLT WELES IWDYC FNP EF+GFDLK+ KG HLV SE+CMT+PELSK+ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFASMFKSPIAGFAPFGRP----SIAISGK----------GDDQPNRKAEP------ 160
           EEYEF S+FKSP+A F PF +        ISGK           DD+     EP      
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180

Query: 161 -DAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
            + Y  FQLVID GF+CTW++PV+KGIPYYKAVKKLDIGGRFL GLLKETLSFRHYN+MD
Sbjct: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 220 ETILVNNIKENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKK---PLPQD 276
           ETILVNNIKE CLFVSP SYF+SFK K +  +EYVLPDFQTSF+GYV+ P +   PLP D
Sbjct: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300

Query: 277 SQTVELKDELFSVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNF 336
           +Q++ L DELF++PETFFHPEI Q++KPG            PE +RPLM+GNIVCTGGNF
Sbjct: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360

Query: 337 NLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYF 396
           NLPNFA RLA ELQRQLPTDWTC V +P G   L+GW  M+ F  +  Y  ARVTREEY+
Sbjct: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYY 420

Query: 397 EHGVDWCTRHRFGYQNWM 414
           EHG DWCT+HRFGYQNW+
Sbjct: 421 EHGPDWCTKHRFGYQNWI 438

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/438 (65%), Positives = 331/438 (75%), Gaps = 24/438 (5%)

Query: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60
           ME  PIV+DNGSYEIKF     E P RA NALA+DKFG+ YLSN IK IKDISS+ FRRP
Sbjct: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120
           HE GQLT WELES IWDYCFFNP EF GFDLK+ KG HLV SE+CMT+PELSK+ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFASMFKSPIAGFAPFGRPSIA----ISGKGDDQP-----------------NRKAE 159
           EEYEF S+FKSP+A F PF +        ISGK ++                   + +  
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
              Y  FQLVID GFNCTW++PV+KGIPYYKAVKKLDIGGRFL GLLKETLSFRHYN+MD
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 220 ETILVNNIKENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKK---PLPQD 276
           ETILVNN+KE CLFVSPVSYF+SFK K++ A+EYVLPDFQTSF+GYV++P++   PLP+D
Sbjct: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300

Query: 277 SQTVELKDELFSVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNF 336
           +QT+ L DELF++PETFFHPEI Q+ KPG            PE +RPLM+GNIVCTGGNF
Sbjct: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 337 NLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYF 396
           NLPNFA RLA ELQRQLPTDWTC V +P G   L+GW  M+ F  +  Y  ARVTR+EY+
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYY 420

Query: 397 EHGVDWCTRHRFGYQNWM 414
           EHG DWCT+ RFGYQNW+
Sbjct: 421 EHGPDWCTKQRFGYQNWI 438

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/427 (63%), Positives = 329/427 (77%), Gaps = 13/427 (3%)

Query: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60
           ME  PIV+DNGSYE+KFG  D + P+RA NALA+DK+G++YLSNQ+  IKDISSV  RRP
Sbjct: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60

Query: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120
           HE GQL SWELE  +WDYCFFNPDEF  F+LK++KG HLVVSETCMT+PELS NMDQV+F
Sbjct: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120

Query: 121 EEYEFASMFKSPIAGFAPFGRPS---IAISGKGDD-------QPNRKAEPDAYEPFQLVI 170
           EEYEF S+FKSP+AGF PF         I GKGDD         + +   + Y  F LVI
Sbjct: 121 EEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVI 180

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEN 230
           D GFNCTW++P+IKG+PYYKAVKK+++GGRFLNGL KET+S+RHY+V DETILVNNIKE 
Sbjct: 181 DSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEK 240

Query: 231 CLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPK--KPLPQDSQTVELKDELFS 288
           CLF+SP SY +SFK+K++ +V+YVLPDFQTSF+GYVKD K    LP++SQ + L DELFS
Sbjct: 241 CLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFS 300

Query: 289 VPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATE 348
           VPET FHPE+ +LLKPG            PE +RPL++ NIVC GGNFN+PNF +RLATE
Sbjct: 301 VPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATE 360

Query: 349 LQRQLPTDWTCTVHLPSGPKELYGWSSMASFT-NSPLYSDARVTREEYFEHGVDWCTRHR 407
           LQRQLPTDW C +++P    EL GW SM+ F  N+ +Y  AR++REEY+EHG DW T+ R
Sbjct: 361 LQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKR 420

Query: 408 FGYQNWM 414
           FGYQNW+
Sbjct: 421 FGYQNWI 427

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/419 (63%), Positives = 327/419 (78%), Gaps = 5/419 (1%)

Query: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60
           ME  P+++DNGSYEIKFG+   + PHRA N++A+DK+G+Y+LSNQ+++IKDISSVVF RP
Sbjct: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60

Query: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120
           HE GQL SWELE+ IWDYC FNPD+FNG+ +  +KG+HL+ SE+CMTIPELSKNMDQVVF
Sbjct: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120

Query: 121 EEYEFASMFKSPIAGFAPF--GRPS---IAISGKGDDQPNRKAEPDAYEPFQLVIDVGFN 175
           EEYEF +MFK+P+  F PF  G+ S   +      + + +  A    Y  FQLVID GFN
Sbjct: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDSGFN 180

Query: 176 CTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVS 235
           C+W+VPVIKG+PYYKAVKKLDIGGRFLNG L+E LSFRHYNVMDETILVN+IKENCLF+S
Sbjct: 181 CSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFMS 240

Query: 236 PVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETFFH 295
           P +YFESF+ + +TA EYVLPDF TSF GY++ P + LP +SQT+ L+DELF+VPETFFH
Sbjct: 241 PNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDELFAVPETFFH 300

Query: 296 PEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT 355
           PEI  LL  G            PE +RPLM+GNIV TGGNFN+PNFA+RLATELQRQ PT
Sbjct: 301 PEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT 360

Query: 356 DWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQNWM 414
           DW+C V LP G   LYGW  M  F+ +  Y ++RVTR+EY+EHGVDWCT  RFGYQ W+
Sbjct: 361 DWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQAWL 419

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/443 (60%), Positives = 332/443 (74%), Gaps = 30/443 (6%)

Query: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60
           M+  PIV+DNGSYEIKFG  +   P RA NA+A+DK+ + YLSNQIK IKDISSV FRRP
Sbjct: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60

Query: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120
           +E GQLTSWELESAIWDYCF+NP+EF+GF L+D+  +HLV+SETC+++PE S+N+D ++F
Sbjct: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120

Query: 121 EEYEFASMFKSPIAGFAPFG---RPSIAISGKG-------------------------DD 152
           EEY + S++KSP+AGF PF    +  I+ISGK                           +
Sbjct: 121 EEYNYGSIYKSPVAGFIPFADLTKDVISISGKADDDDDDNNAKFQEQLVTNDLNTYISSE 180

Query: 153 QPNRKAEPDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSF 212
           +P+     + Y+ FQL+ID GFNCTW++PVIKGIPYYKA+KK+DIGGRFL GLLKETLSF
Sbjct: 181 EPSVTKTAE-YKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSF 239

Query: 213 RHYNVMDETILVNNIKENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKD-PKK 271
           RHYNV DETILVNNIKE CLFV+P SY ESFK K +TAVEYVLPDF T+F+GY+KD  K 
Sbjct: 240 RHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKT 299

Query: 272 PLPQDSQTVELKDELFSVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVC 331
            LP ++Q + LKDELFSV ET FHPEI ++LKPG            PE +RPLM+ NIVC
Sbjct: 300 KLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVC 359

Query: 332 TGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVT 391
            GGNFNLPNF+ RL +ELQRQLPTDWT  V++P    EL+GW +MA F+++  Y  AR+T
Sbjct: 360 IGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARIT 419

Query: 392 REEYFEHGVDWCTRHRFGYQNWM 414
           REEY EHGV+WCT+HRFGYQNW+
Sbjct: 420 REEYMEHGVEWCTKHRFGYQNWI 442

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/423 (63%), Positives = 325/423 (76%), Gaps = 12/423 (2%)

Query: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60
           ME  PIV+DNGSYEIKFGT     P  A N++A+DK+G+Y+LSNQ+++IKDISSV F RP
Sbjct: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60

Query: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120
           H+ GQL SWELES IWDYC FNPDEF+G+ L  +K +HL+ SE+CMT+PELSKNMDQVVF
Sbjct: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120

Query: 121 EEYEFASMFKSPIAGFAPF---GRPSIAISGKGD------DQPNRKAEPDAYEPFQLVID 171
           EEYE+ S+FK+P+  F PF   G  +  +  K D      D P+   +   Y  ++LVID
Sbjct: 121 EEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKD---YRDYELVID 177

Query: 172 VGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENC 231
            GFNCTWVVPVIKG+PYYKAVKKLDIGGRFLNG L+E LSFRHYNVMDETILVN+IKE C
Sbjct: 178 SGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKC 237

Query: 232 LFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPE 291
           LF+SP SYF+SF+ + +TA EYVLPDF TSF GY++ P + LP+DSQT+ L+DELF+VPE
Sbjct: 238 LFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQDELFAVPE 297

Query: 292 TFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQR 351
           TFFHPEI  LL PG            PE LRPL++GN+V TGGNFN+PNFA+RLATELQR
Sbjct: 298 TFFHPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNFNIPNFASRLATELQR 357

Query: 352 QLPTDWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQ 411
           Q PTDW+C V +P+G   LYGW  M  F+ +  Y ++RV+REEY+EHGVDWCT  RFGYQ
Sbjct: 358 QCPTDWSCRVSVPTGDARLYGWKCMQKFSETQAYRESRVSREEYYEHGVDWCTSKRFGYQ 417

Query: 412 NWM 414
            W+
Sbjct: 418 AWL 420

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/439 (61%), Positives = 331/439 (75%), Gaps = 25/439 (5%)

Query: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60
           M+S P+V+DNGSYEIKFG  + E P+RA N  A DK+GS YLSNQ+K I+++S V  RRP
Sbjct: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60

Query: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120
           HE GQLTSWELES IWDYC +NPDEF+GF+L  S  +HL+VSE CMT+PELSKNMDQV+F
Sbjct: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120

Query: 121 EEYEFASMFKSPIAGFAPFGRPS-------IAISGKGDD-----------------QPNR 156
           EEYEF S+FK+P AG+ PFG  +         ISGK +D                 + ++
Sbjct: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180

Query: 157 KAEPDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN 216
           K   + Y+ ++LVID GFNCTW++P+IKG+PYYKA+KKLDIGGRFL GLLKETLSFRHY+
Sbjct: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240

Query: 217 VMDETILVNNIKENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPK-KPLPQ 275
           +MDET+LVNNIKE CLFVSP SYF+SFK KE+T+VEY+LPD  +S+LGY ++ K KPLP+
Sbjct: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPE 300

Query: 276 DSQTVELKDELFSVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGN 335
            SQ V+L DELFSVPETFFHPEI ++LKPG            PE LRPL++ NIVCTGGN
Sbjct: 301 GSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360

Query: 336 FNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVTREEY 395
           FNLP+FA RLA ELQRQLPTDWTC + +P    EL+ W SM  F N+  Y   R+++EEY
Sbjct: 361 FNLPHFAARLAAELQRQLPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEY 420

Query: 396 FEHGVDWCTRHRFGYQNWM 414
           +EHG DW T+H+FGYQNW+
Sbjct: 421 YEHGPDWLTKHKFGYQNWL 439

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/420 (64%), Positives = 320/420 (76%), Gaps = 7/420 (1%)

Query: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60
           M+  PI++DNGSYE+KFG     TP RA NALARDK+G+ +LSNQ+  +KDIS+V FRRP
Sbjct: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60

Query: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120
           HE GQLTSWEL+S IWDYC +NPDEFN +++ ++KG+HLV+SE CM++PELSK  DQVVF
Sbjct: 61  HELGQLTSWELQSCIWDYCLYNPDEFN-WEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119

Query: 121 EEYEFASMFKSPIAGFAPFGRPSI---AISGKGDD--QPNRKAEPDAYEPFQLVIDVGFN 175
           EEYEF S FK P+AGF PF   ++    I  K D   + +   E + Y  FQLVID GFN
Sbjct: 120 EEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFN 179

Query: 176 CTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVS 235
           CTWVVP++KGIPYYKA+KKLDIGGRFLNG LKETLSFRHYNVMDETILVNNIKE CLF+S
Sbjct: 180 CTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFMS 239

Query: 236 PVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETFFH 295
           PVSYF SF+ KE T  EYVLPDFQTSF GYVK  K+ +P+DSQT++L DELFS+PETFFH
Sbjct: 240 PVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPETFFH 299

Query: 296 PEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT 355
           PEI  LLKPG            PE +RPLM+ N V TGGNFN+ NFA RLATELQRQ PT
Sbjct: 300 PEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPT 359

Query: 356 DWTCTVHLPSGP-KELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQNWM 414
           DW   V +P+     L+GW SM  F+ +  Y   RVTREEY+EHGVDWCT+ RFGYQ W+
Sbjct: 360 DWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQKWL 419

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/411 (63%), Positives = 309/411 (75%), Gaps = 5/411 (1%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRPHEFG 64
           P++++NGSYEIKFG  +LETP+RA N L RD++G Y+LSNQ+  I+DIS    RRP E G
Sbjct: 4   PLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSELG 63

Query: 65  QLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVFEEYE 124
           QL SWELE  IWDYC FNPDEF G++LKDSK   L+ SETCMTIPE+SKNMDQVVFEEYE
Sbjct: 64  QLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYE 122

Query: 125 FASMFKSPIAGFAPFGRP-SIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWVVPVI 183
           F SM K P+A F PF R     I G   +    K+    Y  FQLV+D GFNCTWV+PVI
Sbjct: 123 FGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKS---GYNNFQLVVDSGFNCTWVMPVI 179

Query: 184 KGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVSPVSYFESF 243
           KG+PYYKA KKLDIGGRFLNGLLKET+SFRHYNVMDETIL+NNIKE C F+ PVSYF+SF
Sbjct: 180 KGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVSYFDSF 239

Query: 244 KHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETFFHPEIPQLLK 303
           + KE+T VEY+LPDFQTS +GYV+ PK+ +P+ SQ + L+DELF+VPETFFHPEI  +LK
Sbjct: 240 QRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPEISNILK 299

Query: 304 PGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHL 363
           PG            PE LRPL++ NIV  GGNFN+ NFATRLATELQRQ PTDW   VH 
Sbjct: 300 PGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWKVRVHQ 359

Query: 364 PSGPKELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQNWM 414
           P     L GW SM  F+ +  Y ++RVTR EY EHG DWCT+HRFGY+ W+
Sbjct: 360 PKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/410 (62%), Positives = 314/410 (76%), Gaps = 2/410 (0%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRPHEFG 64
           PI++DNGSYEIKFG   L++P+RA N LARDK+G Y+LSNQ+K I+++S+   RRP E G
Sbjct: 4   PIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFELG 63

Query: 65  QLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVFEEYE 124
           QL SWELE  IWDYC FN DEF+ +DLKDSK   L+VSETCM+IPE+SK+MDQVVFEEYE
Sbjct: 64  QLVSWELEEHIWDYCLFNSDEFS-WDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEYE 122

Query: 125 FASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWVVPVIK 184
           F S+ K P+A + PF   +       D  P  + + D Y  FQLV+D GFNCTWV+PVIK
Sbjct: 123 FGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDD-YNDFQLVVDSGFNCTWVIPVIK 181

Query: 185 GIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVSPVSYFESFK 244
           G+PYYKAVKKLDIGGRFL GLLKET+SFRHYN+MDETIL NNIKE C F+ PVSYF+SF+
Sbjct: 182 GVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPVSYFDSFQ 241

Query: 245 HKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETFFHPEIPQLLKP 304
            K +T ++YVLPDFQTS +GYV+ PK+ +P+DSQT+ L+DELF++PETFFHPEI  +LKP
Sbjct: 242 KKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPEIANILKP 301

Query: 305 GXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLP 364
           G            PE +RPLM+ NI   GGNFN+ NFA+RLATELQRQ PTDW+  VHLP
Sbjct: 302 GLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHLP 361

Query: 365 SGPKELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQNWM 414
            G  EL GW +M  F+N+  Y   RVTR EY EHGVDWCT++RFGY+ W+
Sbjct: 362 KGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/416 (62%), Positives = 309/416 (74%), Gaps = 8/416 (1%)

Query: 6   IVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRPHEFGQ 65
           IV+DNGSY++KFG      P  A NALA+DK+G  +LSNQ++ IKDISSVVFRRPHE GQ
Sbjct: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66

Query: 66  LTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVFEEYEF 125
           LTSWELES IWDYC +NPDEF G D +  + +H+V+SETCMT+PELSKN DQV+FEEYE 
Sbjct: 67  LTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEV 125

Query: 126 ASMFKSPIAGFAPF---GRPSIAISGKGD----DQPNRKAEPDAYEPFQLVIDVGFNCTW 178
            S++K+P A + PF         ISGK D    D   +      Y  F LVID GFNCTW
Sbjct: 126 DSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSGFNCTW 185

Query: 179 VVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVSPVS 238
           V+P++KG+PYYKAVKKLD+GGRFLNGLLKET+SFRHYNVMDE+ILVNNIKE CL+V PVS
Sbjct: 186 VIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLYVDPVS 245

Query: 239 YFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETFFHPEI 298
           YFE+FK K +  +++VLPDFQTSF GYV+DPK  LP ++Q + L DE FSVPE FFHPEI
Sbjct: 246 YFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAFFHPEI 305

Query: 299 PQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPTDWT 358
            Q LKPG            PE LRPLM  NIVC GGNFNLP F  RL +ELQRQLPTDW 
Sbjct: 306 SQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWV 365

Query: 359 CTVHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQNWM 414
           C   + SG K L GW++MA F ++  Y  ARVT+E+YFEHG+DW T+ RFGYQNW+
Sbjct: 366 CRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGYQNWV 421

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/422 (62%), Positives = 319/422 (75%), Gaps = 12/422 (2%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRPHEFG 64
           P V+DNGSYEIKFG  +L TP RA N +A+DK+G+ YLSN +KTI+DISS   RRPHE G
Sbjct: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELG 62

Query: 65  QLTSWELESAIWDYCFFNPDEFNGFDLKD-SKGQHLVVSETCMTIPELSKNMDQVVFEEY 123
           QL SWELE  IWDYC +NPDEF+GF L D ++ Q L+++ETC T+PELSKN DQVVFEEY
Sbjct: 63  QLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEY 122

Query: 124 EFASMFKSPIAGFAPF----GRPSIAISGKGDDQPNR---KAEPDAYEPFQLVIDVGFNC 176
           EFA+MFKSP +GF PF    G  ++      D   N     A    Y  FQLVID GFNC
Sbjct: 123 EFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAVNTDYTTATTKEYRDFQLVIDSGFNC 182

Query: 177 TWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVSP 236
           TWVVP+IKG+P+YKA+KK+DIGGRFLNGLLKETLSFRHYN+MDETIL+NNIKE CLFVSP
Sbjct: 183 TWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFVSP 242

Query: 237 VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDP--KKPLPQDS-QTVELKDELFSVPETF 293
           VSYF+SFK K+Q AVEYVLPDFQTSFLGY+ D   +K + + S QT+ L DE F+VPETF
Sbjct: 243 VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPETF 302

Query: 294 FHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQL 353
           FHPE+  +LKPG            PE LRP+++ NIVC GGNF LP+ ++RL +ELQRQL
Sbjct: 303 FHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQL 362

Query: 354 PTDWTCTVHLPSGPK-ELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQN 412
           PTDWTC V +PS    EL  W++MA F+++ +Y   RVTREEY EHG DWC++HRF YQN
Sbjct: 363 PTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTYQN 422

Query: 413 WM 414
           W+
Sbjct: 423 WI 424

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/421 (62%), Positives = 308/421 (73%), Gaps = 13/421 (3%)

Query: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60
           M  P +V+DNGSYEIKFG    + P RA N L +DK+  ++LSNQ K ++DIS  + RRP
Sbjct: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60

Query: 61  HEFGQLTSWELESAIWDYCFFNPDEF--NGFDLKDSKGQHLVVSETCMTIPELSKNMDQV 118
           HE GQL SWELES +WDYCF+N D+F  N     D+K  HLVVSET MTIPELSKNMDQV
Sbjct: 61  HELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQV 120

Query: 119 VFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE---PDAYEPFQLVIDVGFN 175
           +FEEY+F SMFK P+A + PF +      G+  D     AE     +Y+ FQLVID GFN
Sbjct: 121 IFEEYDFKSMFKGPVAQYIPFYQ------GQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174

Query: 176 CTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVS 235
           CTW VP+IKG+PYYKA+KKLDIGGRFL GLL+ET+SFRHYNVM+ETILVNNIKE C FV 
Sbjct: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCTFVP 234

Query: 236 PVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDP-KKPLPQDSQTVELKDELFSVPETFF 294
           P SYF SF +K  T VEYVLPDFQTSFLGYVK P K+ L  D+QT+ L DE+FSVPETFF
Sbjct: 235 PESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKLTDDAQTLLLTDEVFSVPETFF 294

Query: 295 HPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLP 354
           HPEI Q+LKPG            PE +RPL++ NIVCTGGNFN+PNF  RL TELQRQ P
Sbjct: 295 HPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCP 354

Query: 355 TDWTCTVHLPS-GPKELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQNW 413
            DW+C VH P    K L+GW SM  F NS  +  ARVTREEY EHG+DWCT++RFGYQ W
Sbjct: 355 IDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFGYQQW 414

Query: 414 M 414
           +
Sbjct: 415 L 415

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/422 (59%), Positives = 314/422 (74%), Gaps = 9/422 (2%)

Query: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60
           M   P+++DNGSYEIKFG  + ETP  A NALA+DK+ +YYLSNQI  IKDISSV  +RP
Sbjct: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60

Query: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120
           H+ GQL SWELE  IWDYCF+N D+F GF++ +    HLV++ET MT+PELS+N DQVVF
Sbjct: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120

Query: 121 EEYEFASMFKSPIAGFAPFGRPS----IAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNC 176
           EEY F S++K+P A F PF +      I +SGK     +   E + Y+ F LVID G+NC
Sbjct: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKE-NNYQDFNLVIDSGYNC 179

Query: 177 TWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVSP 236
           +W++P+IKG+PYYKAVKK+D+GGRFLNGLLKET+S+RHY+V DE++LVNNIKENC+F+SP
Sbjct: 180 SWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFISP 239

Query: 237 VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKK--PLPQDSQTVELKDELFSVPETFF 294
           VSY ESFK K  T VEYVLPDFQTSF+GYV+D KK   LP+ SQ++ L+DELFSVPE FF
Sbjct: 240 VSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSVPEGFF 299

Query: 295 HPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLP 354
           HPE+  +LKPG            PE LR LM+ NIVCTGGNFN+PNF +R+ TELQ+Q+ 
Sbjct: 300 HPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQ 359

Query: 355 TDWTCTVHLPSGPKELYGWSSMASFT--NSPLYSDARVTREEYFEHGVDWCTRHRFGYQN 412
           T+W C V +P    EL  W +M SFT  N  LY   RVT++EY EHG +W T+ RFGYQN
Sbjct: 360 TEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGYQN 419

Query: 413 WM 414
           W+
Sbjct: 420 WL 421

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  102 bits (255), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 103/415 (24%), Positives = 173/415 (41%), Gaps = 69/415 (16%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY---------YLSNQIKTIKD 51
           E   +V+DNGS   K G    + P   F + + R +             Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPE 110
           I  +  R P E G +T+W+    IW + F+N       +L+ +  +H ++++E  M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVI 170
             + M Q++FE +   + + S  A  + +       SG+                  +V+
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS------SGRTTG---------------IVL 153

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNNIK 228
           D G   T VVP+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +IK
Sbjct: 154 DSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIK 213

Query: 229 ENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFS 288
           E   +V+       F+ + QTA        Q+S +    +    LP D Q + + +E F 
Sbjct: 214 EKLCYVAL-----DFEQEMQTAA-------QSSSI----EKSYELP-DGQVITIGNERFR 256

Query: 289 VPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATE 348
            PE  FHP I  L   G               +R  + GNIV +GG    P  A R+  E
Sbjct: 257 APEALFHPSILSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKE 316

Query: 349 LQRQLPTDWTCTVHLPSGPKELY----GWSSMASFTNSPLYSDARVTREEYFEHG 399
           +    P+     +  P  P+  Y    G S +AS T    +    ++++EY E G
Sbjct: 317 ITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTT---FQQMWISKQEYDESG 366

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  102 bits (253), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 102/415 (24%), Positives = 173/415 (41%), Gaps = 69/415 (16%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY---------YLSNQIKTIKD 51
           E   +V+DNGS   K G    + P   F + + R +             Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPE 110
           I  +  R P E G +T+W+    IW + F+N       +L+ +  +H ++++E  M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVI 170
             + M Q++FE +   + + S  A  + +       SG+                  +V+
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS------SGRTTG---------------IVL 153

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNNIK 228
           D G   T VVP+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +IK
Sbjct: 154 DSGDGVTHVVPIYAGFSLPHAIMRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIK 213

Query: 229 ENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFS 288
           E   +V+       F+ + QTA        Q+S +    +    LP D Q + + +E F 
Sbjct: 214 EKLCYVAL-----DFEQEMQTAA-------QSSSI----EKSYELP-DGQVITIGNERFR 256

Query: 289 VPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATE 348
            PE  FHP +  L   G               +R  + GNIV +GG    P  A R+  E
Sbjct: 257 APEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKE 316

Query: 349 LQRQLPTDWTCTVHLPSGPKELY----GWSSMASFTNSPLYSDARVTREEYFEHG 399
           +    P+     +  P  P+  Y    G S +AS T    +    ++++EY E G
Sbjct: 317 ITALAPSSMEVKIIAP--PERKYSVWIGGSILASLTT---FQQMWISKQEYDESG 366

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  101 bits (252), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 102/415 (24%), Positives = 173/415 (41%), Gaps = 69/415 (16%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY---------YLSNQIKTIKD 51
           E   +V+DNGS   K G    + P   F + + R +             Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPE 110
           I  +  R P E G +T+W+    IW + F+N       +L+ +  +H ++++E  M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVI 170
             + M Q++FE +   + + S  A  + +       SG+                  +V+
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS------SGRTTG---------------IVL 153

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIK 228
           D G   T VVP+  G     A+ ++D+ GR L   L + LS R Y  +   E  +V +IK
Sbjct: 154 DSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIK 213

Query: 229 ENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFS 288
           E   +V+       F+ + QTA        Q+S +    +    LP D Q + + +E F 
Sbjct: 214 EKLCYVAL-----DFEQEMQTAA-------QSSSI----EKSYELP-DGQVITIGNERFR 256

Query: 289 VPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATE 348
            PE  FHP +  L   G               +R  + GNIV +GG    P  A R+  E
Sbjct: 257 APEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKELYGNIVMSGGTTMFPGIAERMQKE 316

Query: 349 LQRQLPTDWTCTVHLPSGPKELY----GWSSMASFTNSPLYSDARVTREEYFEHG 399
           +    P+     +  P  P+  Y    G S +AS T    +    ++++EY E G
Sbjct: 317 ITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTT---FQQMWISKQEYDESG 366

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  101 bits (252), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 102/415 (24%), Positives = 173/415 (41%), Gaps = 69/415 (16%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY---------YLSNQIKTIKD 51
           E   +V+DNGS   K G    + P   F + + R +             Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPE 110
           I  +  R P E G +T+W+    IW + F+N       +L+ +  +H ++++E  M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVI 170
             + M Q++FE +   + + S  A  + +       SG+                  +V+
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS------SGRTTG---------------IVL 153

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNNIK 228
           D G   T VVP+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +IK
Sbjct: 154 DSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIK 213

Query: 229 ENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFS 288
           E   +V+       F+ + QTA        Q+S +    +    LP D Q + + +E F 
Sbjct: 214 EKLCYVAL-----DFEQEMQTAA-------QSSSI----EKSYELP-DGQVITIGNERFR 256

Query: 289 VPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATE 348
            PE  FHP +  L   G               +R  + GNIV +GG    P  A R+  E
Sbjct: 257 APEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKE 316

Query: 349 LQRQLPTDWTCTVHLPSGPKELY----GWSSMASFTNSPLYSDARVTREEYFEHG 399
           +    P+     +  P  P+  Y    G S +AS T    +    ++++EY E G
Sbjct: 317 ITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTT---FQQMWISKQEYDESG 366

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  101 bits (252), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 102/415 (24%), Positives = 173/415 (41%), Gaps = 69/415 (16%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY---------YLSNQIKTIKD 51
           E   +V+DNGS   K G    + P   F + + R +             Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPE 110
           I  +  R P E G +T+W+    IW + F+N       +L+ +  +H ++++E  M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVI 170
             + M Q++FE +   + + S  A  + +       SG+                  +V+
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS------SGRTTG---------------IVL 153

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNNIK 228
           D G   T VVP+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +IK
Sbjct: 154 DSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIK 213

Query: 229 ENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFS 288
           E   +V+       F+ + QTA        Q+S +    +    LP D Q + + +E F 
Sbjct: 214 EKLCYVAL-----DFEQEMQTAA-------QSSSI----EKSYELP-DGQVITIGNERFR 256

Query: 289 VPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATE 348
            PE  FHP +  L   G               +R  + GNIV +GG    P  A R+  E
Sbjct: 257 APEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKE 316

Query: 349 LQRQLPTDWTCTVHLPSGPKELY----GWSSMASFTNSPLYSDARVTREEYFEHG 399
           +    P+     +  P  P+  Y    G S +AS T    +    ++++EY E G
Sbjct: 317 ITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTT---FQQMWISKQEYDESG 366

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  101 bits (252), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 102/415 (24%), Positives = 173/415 (41%), Gaps = 69/415 (16%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY---------YLSNQIKTIKD 51
           E   +V+DNGS   K G    + P   F + + R +             Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPE 110
           I  +  R P E G +T+W+    IW + F+N       +L+ +  +H ++++E  M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVI 170
             + M Q++FE +   + + S  A  + +       SG+                  +V+
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS------SGRTTG---------------IVL 153

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNNIK 228
           D G   T VVP+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +IK
Sbjct: 154 DSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIK 213

Query: 229 ENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFS 288
           E   +V+       F+ + QTA        Q+S +    +    LP D Q + + +E F 
Sbjct: 214 EKLCYVAL-----DFEQEMQTAA-------QSSSI----EKSYELP-DGQVITIGNERFR 256

Query: 289 VPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATE 348
            PE  FHP +  L   G               +R  + GNIV +GG    P  A R+  E
Sbjct: 257 APEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKE 316

Query: 349 LQRQLPTDWTCTVHLPSGPKELY----GWSSMASFTNSPLYSDARVTREEYFEHG 399
           +    P+     +  P  P+  Y    G S +AS T    +    ++++EY E G
Sbjct: 317 ITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTT---FQQMWISKQEYDESG 366

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  101 bits (252), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 102/415 (24%), Positives = 173/415 (41%), Gaps = 69/415 (16%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY---------YLSNQIKTIKD 51
           E   +V+DNGS   K G    + P   F + + R +             Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPE 110
           I  +  R P E G +T+W+    IW + F+N       +L+ +  +H ++++E  M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVI 170
             + M Q++FE +   + + S  A  + +       SG+                  +V+
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS------SGRTTG---------------IVL 153

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNNIK 228
           D G   T VVP+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +IK
Sbjct: 154 DSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIK 213

Query: 229 ENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFS 288
           E   +V+       F+ + QTA        Q+S +    +    LP D Q + + +E F 
Sbjct: 214 EKLCYVAL-----DFEQEMQTAA-------QSSSI----EKSYELP-DGQVITIGNERFR 256

Query: 289 VPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATE 348
            PE  FHP +  L   G               +R  + GNIV +GG    P  A R+  E
Sbjct: 257 APEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKE 316

Query: 349 LQRQLPTDWTCTVHLPSGPKELY----GWSSMASFTNSPLYSDARVTREEYFEHG 399
           +    P+     +  P  P+  Y    G S +AS T    +    ++++EY E G
Sbjct: 317 ITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTT---FQQMWISKQEYDESG 366

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  101 bits (252), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 102/415 (24%), Positives = 173/415 (41%), Gaps = 69/415 (16%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY---------YLSNQIKTIKD 51
           E   +V+DNGS   K G    + P   F + + R +             Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPE 110
           I  +  R P E G +T+W+    IW + F+N       +L+ +  +H ++++E  M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVI 170
             + M Q++FE +   + + S  A  + +       SG+                  +V+
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS------SGRTTG---------------IVL 153

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNNIK 228
           D G   T VVP+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +IK
Sbjct: 154 DSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIK 213

Query: 229 ENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFS 288
           E   +V+       F+ + QTA        Q+S +    +    LP D Q + + +E F 
Sbjct: 214 EKLCYVAL-----DFEQEMQTAA-------QSSSI----EKSYELP-DGQVITIGNERFR 256

Query: 289 VPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATE 348
            PE  FHP +  L   G               +R  + GNIV +GG    P  A R+  E
Sbjct: 257 APEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKE 316

Query: 349 LQRQLPTDWTCTVHLPSGPKELY----GWSSMASFTNSPLYSDARVTREEYFEHG 399
           +    P+     +  P  P+  Y    G S +AS T    +    ++++EY E G
Sbjct: 317 ITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTT---FQQMWISKQEYDESG 366

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score =  101 bits (251), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 102/415 (24%), Positives = 173/415 (41%), Gaps = 69/415 (16%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY---------YLSNQIKTIKD 51
           E   +V+DNGS   K G    + P   F + + R +             Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPE 110
           I  +  R P E G +T+W+    IW + F+N       +L+ +  +H ++++E  M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVI 170
             + M Q++FE +   + + S  A  + +       SG+                  +V+
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS------SGRTTG---------------IVL 153

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNNIK 228
           D G   T VVP+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +IK
Sbjct: 154 DSGDGVTHVVPIYAGFSMPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIK 213

Query: 229 ENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFS 288
           E   +V+       F+ + QTA        Q+S +    +    LP D Q + + +E F 
Sbjct: 214 EKLCYVAL-----DFEQEMQTAA-------QSSSV----EKSYELP-DGQVITIGNERFR 256

Query: 289 VPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATE 348
            PE  FHP +  L   G               +R  + GNIV +GG    P  A R+  E
Sbjct: 257 APEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKDLYGNIVMSGGTTMFPGIAERMQKE 316

Query: 349 LQRQLPTDWTCTVHLPSGPKELY----GWSSMASFTNSPLYSDARVTREEYFEHG 399
           +    P+     +  P  P+  Y    G S +AS T    +    ++++EY E G
Sbjct: 317 ITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTT---FQQMWISKQEYDESG 366

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  101 bits (251), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 102/415 (24%), Positives = 173/415 (41%), Gaps = 69/415 (16%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY---------YLSNQIKTIKD 51
           E   +V+DNGS   K G    + P   F + + R +             Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPE 110
           I  +  R P E G +T+W+    IW + F+N       +L+ +  +H ++++E  M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVI 170
             + M Q++FE +   + + S  A  + +       SG+                  +V+
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS------SGRTTG---------------IVL 153

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNNIK 228
           D G   T VVP+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +IK
Sbjct: 154 DSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIK 213

Query: 229 ENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFS 288
           E   +V+       F+ + QTA        Q+S +    +    LP D Q + + +E F 
Sbjct: 214 EKLCYVAL-----DFEQEMQTAA-------QSSSI----EKSYELP-DGQVITIGNERFR 256

Query: 289 VPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATE 348
            PE  FHP +  L   G               +R  + GNIV +GG    P  A R+  E
Sbjct: 257 APEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKE 316

Query: 349 LQRQLPTDWTCTVHLPSGPKELY----GWSSMASFTNSPLYSDARVTREEYFEHG 399
           +    P+     +  P  P+  Y    G S +AS T    +    ++++EY E G
Sbjct: 317 ITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTT---FQQMWISKQEYDESG 366

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  101 bits (251), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 102/415 (24%), Positives = 173/415 (41%), Gaps = 69/415 (16%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY---------YLSNQIKTIKD 51
           E   +V+DNGS   K G    + P   F + + R +             Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPE 110
           I  +  R P E G +T+W+    IW + F+N       +L+ +  +H ++++E  M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVI 170
             + M Q++FE +   + + S  A  + +       SG+                  +V+
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS------SGRTTG---------------IVL 153

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNNIK 228
           D G   T VVP+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +IK
Sbjct: 154 DSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIK 213

Query: 229 ENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFS 288
           E   +V+       F+ + QTA        Q+S +    +    LP D Q + + +E F 
Sbjct: 214 EKLCYVAL-----DFEQEMQTAA-------QSSSI----EKSYELP-DGQVITIGNERFR 256

Query: 289 VPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATE 348
            PE  FHP +  L   G               +R  + GNIV +GG    P  A R+  E
Sbjct: 257 APEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKE 316

Query: 349 LQRQLPTDWTCTVHLPSGPKELY----GWSSMASFTNSPLYSDARVTREEYFEHG 399
           +    P+     +  P  P+  Y    G S +AS T    +    ++++EY E G
Sbjct: 317 ITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTT---FQQMWISKQEYDESG 366

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score =  100 bits (250), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 101/415 (24%), Positives = 173/415 (41%), Gaps = 69/415 (16%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY---------YLSNQIKTIKD 51
           E   +V+DNGS   K G    + P   F + + R +             Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPE 110
           I  +  R P E G +T+W+    IW + F+N       +L+ +  +H ++++E  M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVI 170
             + M Q++FE +   + + S  A  + +       SG+                  +V+
Sbjct: 115 NREKMTQILFETFNVPAFYVSIQAVLSLYS------SGRTTG---------------IVL 153

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNNIK 228
           D G   T VVP+  G     A+ ++D+ GR +   L + LS R Y+     E  +V +IK
Sbjct: 154 DSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIK 213

Query: 229 ENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFS 288
           E   +V+       F+ + QTA        Q+S +    +    LP D Q + + +E F 
Sbjct: 214 EKLCYVAL-----DFEQEMQTAA-------QSSAI----EKSYELP-DGQVITIGNERFR 256

Query: 289 VPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATE 348
            PE  FHP +  L   G               +R  + GNIV +GG    P  A R+  E
Sbjct: 257 APEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKE 316

Query: 349 LQRQLPTDWTCTVHLPSGPKELY----GWSSMASFTNSPLYSDARVTREEYFEHG 399
           +    P+     +  P  P+  Y    G S +AS T    +    ++++EY E G
Sbjct: 317 ITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTT---FQQMWISKQEYDESG 366

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  100 bits (250), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 102/415 (24%), Positives = 174/415 (41%), Gaps = 69/415 (16%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY---------YLSNQIKTIKD 51
           E   +V+DNGS   K G    + P   F + + R +             Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPE 110
           I  +  R P E G +T+W+    IW + F+N       +L+ +  +H ++++E  M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVI 170
             + M Q++FE +   + + S  A  + +       SG+                  +V+
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS------SGRTTG---------------IVL 153

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNNIK 228
           D G   T VVP+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +IK
Sbjct: 154 DSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIK 213

Query: 229 ENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFS 288
           E   +V+       F+ + QTA        Q+S +    +    LP D Q + + +E F 
Sbjct: 214 EKLCYVAL-----DFEQEMQTAS-------QSSSI----EKSYELP-DGQVITIGNERFR 256

Query: 289 VPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATE 348
            PE  FHP +  L   G               +R  + GNIV +GG+   P  A R+  E
Sbjct: 257 APEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGSTMFPGIAERMQKE 316

Query: 349 LQRQLPTDWTCTVHLPSGPKELY----GWSSMASFTNSPLYSDARVTREEYFEHG 399
           +    P+     +  P  P+  Y    G S +AS T    +    ++++EY E G
Sbjct: 317 ITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTT---FQQMWISKQEYDESG 366

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score =  100 bits (250), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 101/415 (24%), Positives = 173/415 (41%), Gaps = 69/415 (16%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY---------YLSNQIKTIKD 51
           E   +V+DNGS   K G    + P   F + + R +             Y+ ++ ++ + 
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 64

Query: 52  ISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPE 110
           I  +  R P E G +T+W+    IW + F+N       +L+ +  +H ++++E  M    
Sbjct: 65  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 115

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVI 170
             + M Q++FE +   + + S  A  + +       SG+                  +V+
Sbjct: 116 NREKMTQIMFETFNVPAFYVSIQAVLSLYS------SGRTTG---------------IVL 154

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNNIK 228
           D G   T VVP+  G     A+ ++D+ GR +   L + LS R Y+     E  +V +IK
Sbjct: 155 DSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIK 214

Query: 229 ENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFS 288
           E   +V+       F+ + QTA        Q+S +    +    LP D Q + + +E F 
Sbjct: 215 EKLCYVAL-----DFEQEMQTAA-------QSSAI----EKSYELP-DGQVITIGNERFR 257

Query: 289 VPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATE 348
            PE  FHP +  L   G               +R  + GNIV +GG    P  A R+  E
Sbjct: 258 APEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKE 317

Query: 349 LQRQLPTDWTCTVHLPSGPKELY----GWSSMASFTNSPLYSDARVTREEYFEHG 399
           +    P+     +  P  P+  Y    G S +AS T    +    ++++EY E G
Sbjct: 318 ITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTT---FQQMWISKQEYDESG 367

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score = 99.8 bits (247), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 101/415 (24%), Positives = 172/415 (41%), Gaps = 69/415 (16%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY---------YLSNQIKTIKD 51
           E   +V+DNGS   K G    + P   F + + R +             Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPE 110
           I  +  R P E G +T+W+    IW + F+N       +L+ +  +H ++++E  M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVI 170
             + M Q++FE +   + + S  A  + +       SG+                  +V+
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS------SGRTTG---------------IVL 153

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNNIK 228
           D G   T VVP+  G      + ++D+ GR L   L + LS R Y+     E  +V +IK
Sbjct: 154 DSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIK 213

Query: 229 ENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFS 288
           E   +V+       F+ + QTA        Q+S +    +    LP D Q + + +E F 
Sbjct: 214 EKLCYVAL-----DFEQEMQTAA-------QSSSI----EKSYELP-DGQVITIGNERFR 256

Query: 289 VPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATE 348
            PE  FHP +  L   G               +R  + GNIV +GG    P  A R+  E
Sbjct: 257 APEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKE 316

Query: 349 LQRQLPTDWTCTVHLPSGPKELY----GWSSMASFTNSPLYSDARVTREEYFEHG 399
           +    P+     +  P  P+  Y    G S +AS T    +    ++++EY E G
Sbjct: 317 ITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTT---FQQMWISKQEYDESG 366

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score = 99.4 bits (246), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 100/415 (24%), Positives = 172/415 (41%), Gaps = 69/415 (16%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY---------YLSNQIKTIKD 51
           E   +V+DNGS   K G    + P   F + + R +             Y+ ++ ++ + 
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDCYVGDEAQSKRG 64

Query: 52  ISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPE 110
           I  +  R P E G +T+W+    IW + F+N       +L+ +  +H ++++E  M    
Sbjct: 65  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 115

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVI 170
             + M Q++FE +   + + S  A  + +       SG+                  +V+
Sbjct: 116 NREKMTQIMFETFNVPAFYVSIQAVLSLYS------SGRTTG---------------IVL 154

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNNIK 228
           D G   T VVP+  G     A+ ++D+ GR +   L + LS R Y+     E  +V +IK
Sbjct: 155 DSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIK 214

Query: 229 ENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFS 288
           E   +V+       +  + QTA        Q+S +    +    LP D Q + + +E F 
Sbjct: 215 EKLCYVAL-----DYDQEMQTAA-------QSSAI----EKSYELP-DGQVITIGNERFR 257

Query: 289 VPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATE 348
            PE  FHP +  L   G               +R  + GNIV +GG    P  A R+  E
Sbjct: 258 APEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKE 317

Query: 349 LQRQLPTDWTCTVHLPSGPKELY----GWSSMASFTNSPLYSDARVTREEYFEHG 399
           +    P+     +  P  P+  Y    G S +AS T    +    ++++EY E G
Sbjct: 318 ITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTT---FQQMWISKQEYDESG 367

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 99.4 bits (246), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 100/415 (24%), Positives = 172/415 (41%), Gaps = 69/415 (16%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY---------YLSNQIKTIKD 51
           E   +V+DNGS   K G    + P   F + + R +             Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPE 110
           I  +  R P E G +T+W+    IW + F+N       +L+ +  +H ++++E  M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVI 170
             + M Q++FE +   + + S  A  + +       SG+                  +V+
Sbjct: 115 NREKMTQILFETFNVPAFYVSIQAVLSLYS------SGRTTG---------------IVL 153

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNNIK 228
           D G   T VVP+  G      + ++D+ GR +   L + LS R Y+     E  +V +IK
Sbjct: 154 DSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIK 213

Query: 229 ENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFS 288
           E   +V+       F+ + QTA        Q+S +    +    LP D Q + + +E F 
Sbjct: 214 EKLCYVAL-----DFEQEMQTAA-------QSSAI----EKSYELP-DGQVITIGNERFR 256

Query: 289 VPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATE 348
            PE  FHP +  L   G               +R  + GNIV +GG    P  A R+  E
Sbjct: 257 APEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKE 316

Query: 349 LQRQLPTDWTCTVHLPSGPKELY----GWSSMASFTNSPLYSDARVTREEYFEHG 399
           +    P+     +  P  P+  Y    G S +AS T    +    ++++EY E G
Sbjct: 317 ITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTT---FQQMWISKQEYDESG 366

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 99.0 bits (245), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 100/415 (24%), Positives = 173/415 (41%), Gaps = 69/415 (16%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY---------YLSNQIKTIKD 51
           E   +V+DNGS   K G    + P   F + + R +             Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPE 110
           I  +  R P E G +T+W+    IW + F+N       +L+ +  +H ++++E  M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKN 114

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVI 170
             + M Q++FE +   + + S  A  + +       SG+                  +V+
Sbjct: 115 NREKMTQILFETFNVPAFYVSIQAVLSLYS------SGRTTG---------------IVL 153

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNNIK 228
           D G   T VVP+  G     A+ ++D+ GR +   L + L+ R Y+     E  +V +IK
Sbjct: 154 DSGDGVTHVVPIYAGFSLPHAILRIDLAGRDITDYLMKILAERGYSFSTTAEREIVRDIK 213

Query: 229 ENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFS 288
           E   +V+       F+ + QTA        Q+S +    +    LP D Q + + +E F 
Sbjct: 214 EKLCYVAL-----DFEQEMQTAS-------QSSAV----EKSYELP-DGQVITIGNERFR 256

Query: 289 VPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATE 348
            PE  FHP +  L   G               +R  + GNIV +GG    P  A R+  E
Sbjct: 257 APEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKE 316

Query: 349 LQRQLPTDWTCTVHLPSGPKELY----GWSSMASFTNSPLYSDARVTREEYFEHG 399
           +    P+     +  P  P+  Y    G S +AS T    +    ++++EY E G
Sbjct: 317 ITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTT---FQQMWISKQEYDESG 366

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 96.3 bits (238), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 91/366 (24%), Positives = 156/366 (42%), Gaps = 59/366 (16%)

Query: 41  YLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-L 99
           Y+ ++ ++ + I  +  R P E G +T+W+    IW + F+N       +L+ +  +H +
Sbjct: 38  YVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPV 88

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  M      + M Q++FE +   + + S  A  + +       SG+          
Sbjct: 89  LLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYS------SGRTTG------- 135

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--V 217
                   +V+D G   T VVP+  G     A+ ++D+ GR L   L + LS R Y+   
Sbjct: 136 --------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFST 187

Query: 218 MDETILVNNIKENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDS 277
             E  +V +IKE   +V+       F+ + QTA        Q+S +    +    LP D 
Sbjct: 188 TAEREIVRDIKEKLCYVAL-----DFEQEMQTAA-------QSSSI----EKSYELP-DG 230

Query: 278 QTVELKDELFSVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFN 337
           Q + + +E F  PE  FHP +  L   G               +R  + GNIV +GG   
Sbjct: 231 QVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTM 290

Query: 338 LPNFATRLATELQRQLPTDWTCTVHLPSGPKELY----GWSSMASFTNSPLYSDARVTRE 393
            P  A R+  E+    P+     +  P  P+  Y    G S +AS T    +    ++++
Sbjct: 291 FPGIAERMQKEITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTT---FQQMWISKQ 345

Query: 394 EYFEHG 399
           EY E G
Sbjct: 346 EYDESG 351

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score = 93.6 bits (231), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 89/366 (24%), Positives = 155/366 (42%), Gaps = 59/366 (16%)

Query: 41  YLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-L 99
           Y+ ++ ++ + I  +  R P E G +T+W+    IW + F+N       +L+ +  +H +
Sbjct: 38  YVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPV 88

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  M      + M Q++FE +   + + S  A  + +       SG+          
Sbjct: 89  LLTEAPMNPKSNREKMTQILFETFNVPAFYVSIQAVLSLYS------SGRTTG------- 135

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--V 217
                   +V+D G   T VVP+  G      + ++D+ GR +   L + LS R Y+   
Sbjct: 136 --------IVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERGYSFST 187

Query: 218 MDETILVNNIKENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDS 277
             E  +V +IKE   +V+       F+ + QTA        Q+S +    +    LP D 
Sbjct: 188 TAEREIVRDIKEKLCYVAL-----DFEQEMQTAA-------QSSAI----EKSYELP-DG 230

Query: 278 QTVELKDELFSVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFN 337
           Q + + +E F  PE  FHP +  L   G               +R  + GNIV +GG   
Sbjct: 231 QVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTM 290

Query: 338 LPNFATRLATELQRQLPTDWTCTVHLPSGPKELY----GWSSMASFTNSPLYSDARVTRE 393
            P  A R+  E+    P+     +  P  P+  Y    G S +AS T    +    ++++
Sbjct: 291 FPGIAERMQKEITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTT---FQQMWISKQ 345

Query: 394 EYFEHG 399
           EY E G
Sbjct: 346 EYDESG 351

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 100/419 (23%), Positives = 166/419 (39%), Gaps = 66/419 (15%)

Query: 5   PIVVDNGSYEIKFGTPDLETPH----------RAFNALARDKFGSYYLSNQIKTIKDISS 54
           PIV+DNGS  IK G    E P           +    +A    G  ++ NQ + ++ +  
Sbjct: 9   PIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEGDTFIGNQAQELRGL-- 66

Query: 55  VVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKN 114
           +  R P E G + +W     IW Y F          L++ +   ++++E  +      + 
Sbjct: 67  LKLRHPVEHGIVKNWSDMEHIWSYVFNK-----SLQLQNVEDHPILITEAPLNPRNNRER 121

Query: 115 MDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGF 174
           M +++FE +   +++ S  A        S+  SG+                   V+D G 
Sbjct: 122 MCELLFESFNVPALYVSIQAVL------SLYASGRTTG---------------CVVDCGD 160

Query: 175 NCTWVVPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETILVNNIKEN 230
            C   VPV  G     +++++DI GR    FL  LL++T      +  +  + V  IKE 
Sbjct: 161 GCCHAVPVFDGFSIPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREV-VRIIKEK 219

Query: 231 CLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVP 290
             +V+   + E     EQ     + P++           K  LP D +T++L  E F  P
Sbjct: 220 ACYVAKDPHIE-----EQNF--SINPNYT----------KFKLP-DGKTIDLGQEKFRAP 261

Query: 291 ETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQ 350
           E  F PE+                      LR L+  N++ +GG   LP F  RL +EL+
Sbjct: 262 EILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLFSNVLLSGGTSILPGFGDRLLSELK 321

Query: 351 RQLPTDWTCTVHLPSGPKELYG-WSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRF 408
               +D    + + + P+  Y  W   +  +    +    VTR E+ E   D C   RF
Sbjct: 322 SL--SDSQTKIKIFAPPERKYSTWIGGSILSGLSTFKKLWVTRAEW-EEAAD-CIHSRF 376

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 85/362 (23%), Positives = 147/362 (40%), Gaps = 60/362 (16%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDI----------S 53
           PIV+D G+  +K G      P   F + + R    +   +N    ++DI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEASDVRS 65

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113
            +    P E G + +W     +WDY FFN  + N     ++ G  ++++E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFNQMKLN-----NTSGGKILLTEPPMNPLKNRE 120

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
            M +V+FE+Y+F  ++ +  A  A + +    +S                    +V+D G
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLSSG------------------VVVDSG 159

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231
              T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKL 219

Query: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289
            +VS     ++   +E T +   Y LP                   D +T+++  E F  
Sbjct: 220 CYVSYDLDLDTKLARETTTLVESYELP-------------------DGRTIKVGQERFEA 260

Query: 290 PETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349
           PE  F P +  + +PG               +R  +   IV +GG+   P   +RL  EL
Sbjct: 261 PECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKEL 320

Query: 350 QR 351
           ++
Sbjct: 321 KQ 322

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 86.3 bits (212), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 101/422 (23%), Positives = 169/422 (40%), Gaps = 72/422 (17%)

Query: 5   PIVVDNGSYEIKFGTPDLETPH----------RAFNALARDKFGSYYLSNQIKTIKDISS 54
           PIV+DNGS  IK G    E P           +    +A    G  ++ NQ + ++ +  
Sbjct: 11  PIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLEGEQFIGNQAQELRGL-- 68

Query: 55  VVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKN 114
           +  R P E G + +W     IW++ F    + N  +      +H V++      P  ++ 
Sbjct: 69  LKLRYPLEHGIVKNWSDMELIWNHVFHKSLQLNNIE------EHPVLATEAPLNPLKNRE 122

Query: 115 -MDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
            M +++FE +   +++ S  A        S+  SG+                   V+D G
Sbjct: 123 AMCEMLFETFNVPAVYVSIQAVL------SLYASGRTTG---------------CVLDCG 161

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETILVNNIKE 229
             C   VPV  G     +++++D+ GR    FL  LL++T      +  +  I V  IKE
Sbjct: 162 DGCCHSVPVFDGFSLPSSIRRIDVAGRDVTEFLQLLLRKTTGVSLLSSSEREI-VRIIKE 220

Query: 230 NCLFVS--PVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELF 287
              +V+  P++  +++ H   T+  + LPD                    + ++LK+E F
Sbjct: 221 KACYVARDPLTEEQTY-HLTPTSTIFKLPD-------------------GKVLDLKNEKF 260

Query: 288 SVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLAT 347
             PE  F P++                      LRP +L NIV +GG    P F  RL T
Sbjct: 261 RAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALLSNIVLSGGTTMFPGFGDRLLT 320

Query: 348 ELQRQLPTDWTCTVHLPSGPKELYG-WSSMASFTNSPLYSDARVTREEYFEHGVDWCTRH 406
           EL R L    T  + + + P+  Y  W   +  +    +    VT+ E+ E+    C   
Sbjct: 321 EL-RNLSEPQT-KIKIFAPPERKYSTWIGGSILSGLSTFKKIWVTKSEWQEN--PDCVHS 376

Query: 407 RF 408
           RF
Sbjct: 377 RF 378

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 86/362 (23%), Positives = 142/362 (39%), Gaps = 60/362 (16%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKT-IKDI----------S 53
           PIV+D G+  +K G      P   F ++             I T +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGTISTPLKDIMIGDEASEVRS 65

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113
            +    P E G + +W     +WDY FFN        L  + G  ++++E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MKLPTTSGGKVLLTEPPMNPVKNRE 120

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
            M +V+FE Y+F  ++ +  A  A + +    +S                    +V+D G
Sbjct: 121 RMCEVMFERYDFGGVYVAIQAVLALYAQ---GLSSG------------------VVVDSG 159

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231
              T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYSFNRTADFETVRQIKEKV 219

Query: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289
            +VS     ++   +E T +  EY LP                   D + +++  E F  
Sbjct: 220 CYVSYDLNLDTKLARETTTLVQEYELP-------------------DGRIIKVGQERFEA 260

Query: 290 PETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349
           PE  F P++  +  PG               +R  +   IV +GG+   P   +RL  EL
Sbjct: 261 PECLFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRLEREL 320

Query: 350 QR 351
           ++
Sbjct: 321 KQ 322

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 83/362 (22%), Positives = 144/362 (39%), Gaps = 60/362 (16%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDI----------S 53
           PIV+D G+  +K G      P   F + + R    +   +N +  +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113
            +    P E G + +W     +WDY F++        L  + G  ++++E  M      +
Sbjct: 66  YLQISYPMENGVIKNWSDMELLWDYAFYDQ-----MKLPSTSGGKVMLTEPPMNPLRNRE 120

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
            M +V+FE+Y+F  ++ +  A  A + +    +S                    +V+D G
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLSSG------------------VVVDSG 159

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231
              T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL 219

Query: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289
            +VS     ++   +E T +   Y LP                   D + +++  E F  
Sbjct: 220 SYVSYDLDLDTKLARETTTLVENYELP-------------------DGRVIKVGSERFEA 260

Query: 290 PETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349
           PE  F P +  + +PG               +R  +   IV +GG+   P   +RL  EL
Sbjct: 261 PECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKEL 320

Query: 350 QR 351
           ++
Sbjct: 321 KQ 322

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 98/408 (24%), Positives = 158/408 (38%), Gaps = 64/408 (15%)

Query: 5   PIVVDNGSYEIKFGTPDLETPH----------RAFNALARDKFGSYYLSNQIKTIKDISS 54
           P+V+DNGS  IK G    E P           +    +A    G  ++ NQ + ++ +  
Sbjct: 37  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRGL-- 94

Query: 55  VVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKN 114
           +  R P + G +T+W     +W Y F          L++ +    +V+E  +   +  + 
Sbjct: 95  LKLRYPLQHGIVTNWADMEQVWGYVFNK-----SLQLQNVEDHPNLVTEAPLNPHKNREK 149

Query: 115 MDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGF 174
           M +++FE +   +++ S  A        S+  SG+                   V+D G 
Sbjct: 150 MCELLFESFNVPALYVSVQAVL------SLYASGRTTG---------------CVVDCGD 188

Query: 175 NCTWVVPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETILVNNIKEN 230
            C   VPV  G     +++++DI GR    FL  LL++T      +  +  I V  IKE 
Sbjct: 189 GCCHAVPVFDGFSVPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREI-VRTIKEK 247

Query: 231 CLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVP 290
             FV+          K+    E   P    SF       K  LP D +T+EL  E +  P
Sbjct: 248 ACFVT----------KDPKLEEQNFP-MNPSF------SKFKLP-DGKTIELGQERYRAP 289

Query: 291 ETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQ 350
           E  F PE+                      LR L+  NI+ +GG   LP F  RL  EL+
Sbjct: 290 EILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILLSGGTSMLPGFGDRLLKELK 349

Query: 351 RQLPTDWTCTVHLPSGPKELYG-WSSMASFTNSPLYSDARVTREEYFE 397
               +     +  P  P+  Y  W   +  +    +    VT+ E+ E
Sbjct: 350 SLSGSRTKIKIFAP--PERKYSTWIGGSILSGLSTFKKLWVTKSEWEE 395

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 84/362 (23%), Positives = 143/362 (39%), Gaps = 60/362 (16%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDI----------S 53
           PIV+D G+  +K G      P   F + + R    +   +N    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVRS 65

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113
            +    P E G + +W     +WDY FF         L  +    ++++E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQ-----MKLPTTSNGKILLTEPPMNPTKNRE 120

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
            M +V+FE+Y+F  ++ +  A  A + +    +S                    +V+D G
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLSSG------------------VVVDSG 159

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231
              T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 160 DGVTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKL 219

Query: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289
            +VS     ++   +E T +   Y LP                   D +T+++  E F  
Sbjct: 220 CYVSYDLDLDTKLARETTTLVESYELP-------------------DGRTIKVGQERFEA 260

Query: 290 PETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349
           PE  F P +  + +PG               +R  +   IV +GG+   P   +RL  EL
Sbjct: 261 PECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKEL 320

Query: 350 QR 351
           ++
Sbjct: 321 KQ 322

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 84/362 (23%), Positives = 144/362 (39%), Gaps = 60/362 (16%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDI----------S 53
           PIV+D G+  +K G      P   F + + R    +   ++    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113
            +    P E G + +W     +WDY FF         L  +    ++++E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQ-----MKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
            M +V+FE+Y+F  ++ +  A  A + +    +S                    +V+D G
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLSSG------------------VVVDSG 159

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231
              T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 160 DGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKL 219

Query: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289
            +VS     ++   +E TA+   Y LP                   D +T+++  E F  
Sbjct: 220 CYVSYDLDLDTKLARETTALVESYELP-------------------DGRTIKVGQERFEA 260

Query: 290 PETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349
           PE  F P +  + +PG               +R  +   IV +GG+   P   +RL  EL
Sbjct: 261 PECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKEL 320

Query: 350 QR 351
           ++
Sbjct: 321 KQ 322

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 84/362 (23%), Positives = 145/362 (40%), Gaps = 60/362 (16%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKT-IKDI----------S 53
           PIV+D G+  +K G      P   F ++             I T +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGSISTPLKDIMIGEEASDVRS 65

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113
            +    P E G + +W+    +WDY F+N  +F       + G  ++++E  M   +  +
Sbjct: 66  YLQISYPMENGIIRNWQDMEHLWDYAFYNQMKF-----PSTSGGKILLTEPPMNPLKNRE 120

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
            M +V+FE+Y+F  ++ +  A  A + +    +S                    +V+D G
Sbjct: 121 LMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLSSG------------------VVVDSG 159

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231
              T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL 219

Query: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289
            +VS     ++   +E T +   Y LP                   D + +++  E F  
Sbjct: 220 SYVSYDLNLDTKLARETTVLVENYELP-------------------DGRVIKVGQERFEA 260

Query: 290 PETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349
           PE  F P++  + +PG               +R  +   IV +GG+   P   +RL  EL
Sbjct: 261 PECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAIVLSGGSSMYPGLPSRLEKEL 320

Query: 350 QR 351
           ++
Sbjct: 321 KQ 322

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 81.3 bits (199), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 95/415 (22%), Positives = 171/415 (41%), Gaps = 58/415 (13%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHR---------AFNALARDKF-GSYYLSNQIKTIKDISS 54
           PIV+DNGS  IK G    + P            ++ +   +F G+ ++ NQ + I+ +  
Sbjct: 12  PIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFDGNTFVGNQAQEIRGL-- 69

Query: 55  VVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKN 114
           +  R P E G +T W     +W + F       G  L   +   ++V+E  +   +  + 
Sbjct: 70  LKLRHPLEHGVVTDWNALEQLWGHVFEK-----GLQLSSLQDHPVLVTEAPLNPKKNREQ 124

Query: 115 MDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGF 174
           M +++FE +   +++ S  A        S+  SG+                   V+D G 
Sbjct: 125 MCELLFETFSVPAVYVSIQAVL------SLYASGRTTG---------------CVLDSGD 163

Query: 175 NCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFV 234
            C+  VPV  G     A++++DI GR ++ LL + L  +   V   ++L ++ +E    +
Sbjct: 164 GCSHAVPVYDGYTLPSAIRRIDIAGRDISELL-QVLIRKSTGV---SLLSSSEREIVRII 219

Query: 235 SPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETFF 294
              + + +   KE+    Y +   QT F          LP D + +EL +E F  PE  F
Sbjct: 220 KEKACYIALDPKEEEK-NYTMHGKQTMF---------RLP-DGKQIELDNEKFRAPEILF 268

Query: 295 HPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLP 354
           +P++                      LR  +  NIV +GG   +P F  R+  EL  +L 
Sbjct: 269 NPQLIGSEFQSLPEILYESIQKVDLDLRTSLFSNIVFSGGTTMIPGFGDRVLKEL--KLS 326

Query: 355 TDWTCTVHLPSGPKELYG-WSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRF 408
            +    + + + P+  Y  W   +  +    +    VT++E+ E+    C   RF
Sbjct: 327 CEPQTKIKIFAPPERKYSTWIGGSILSGLSTFKKIWVTKKEWEEN--PRCVHARF 379

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 84/362 (23%), Positives = 144/362 (39%), Gaps = 60/362 (16%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDI----------S 53
           PIV+D G+  +K G      P   F + + R    +   ++    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEVRS 65

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113
            +    P E G + +W     +WDY FF         L  +    ++++E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQ-----MKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
            M +V+FE+Y+F  ++ +  A  A + +    +S                    +V+D G
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLSSG------------------VVVDSG 159

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231
              T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 160 DGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKL 219

Query: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289
            +VS     ++   +E TA+   Y LP                   D +T+++  E F  
Sbjct: 220 CYVSYDLDLDTKLARETTALVESYELP-------------------DGRTIKVGQERFEA 260

Query: 290 PETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349
           PE  F P +  + +PG               +R  +   IV +GG+   P   +RL  EL
Sbjct: 261 PECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKEL 320

Query: 350 QR 351
           ++
Sbjct: 321 KQ 322

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 80.9 bits (198), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 83/362 (22%), Positives = 144/362 (39%), Gaps = 60/362 (16%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDI----------S 53
           PIV+D G+  +K G      P   F + + R    +   ++    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113
            +    P E G + +W     +WDY FF         L+ +    ++++E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQ-----MKLQSTSNGKILLTEPPMNPLKNRE 120

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
            M +V+FE+Y+F  ++ +  A  A + +    +S                    +V+D G
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLSSG------------------VVVDSG 159

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231
              T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKL 219

Query: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289
            +VS     ++   +E T +   Y LP                   D +T+++  E F  
Sbjct: 220 CYVSYDLDLDTKLARETTTLVESYELP-------------------DGRTIKVGQERFEA 260

Query: 290 PETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349
           PE  F P +  + +PG               +R  +   IV +GG+   P   +RL  EL
Sbjct: 261 PECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKEL 320

Query: 350 QR 351
           ++
Sbjct: 321 KQ 322

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 80.9 bits (198), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 88/366 (24%), Positives = 144/366 (39%), Gaps = 66/366 (18%)

Query: 5   PIVVDNGSYEIKFGT-----PDLETPHRAFNALARDKFGSYYLSNQIKTIKDI------- 52
           PIV+D G+  +K G      PD   P      + R +  S+  S     IKDI       
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKT--PIKDIMVGEEAS 63

Query: 53  ---SSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIP 109
              S +    P E G +  W     +WD+ FF         L  + G  ++++E  M   
Sbjct: 64  DVRSYLQISYPMENGIIKHWTDMELLWDHAFFEK-----MKLPSTSGGKILLTEPPMNPL 118

Query: 110 ELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLV 169
           +  + M QV+FE+Y+F  ++ +  A  A + +    +S                    +V
Sbjct: 119 KNREMMCQVMFEKYDFGGVYVAIQAVLALYAQ---GLSSG------------------VV 157

Query: 170 IDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNI 227
           +D G   T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 158 VDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQI 217

Query: 228 KENCLFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDE 285
           KE   +VS    F++   +E T +   Y LP                   D + +++  E
Sbjct: 218 KEKLSYVSYDLDFDTKLARETTTLVENYELP-------------------DGRIIKVGQE 258

Query: 286 LFSVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRL 345
            F  PE  F P +  + +PG               +R  +   IV +GG+   P   +RL
Sbjct: 259 RFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSLYKAIVLSGGSSMYPGLPSRL 318

Query: 346 ATELQR 351
             EL++
Sbjct: 319 EKELKQ 324

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 84/362 (23%), Positives = 143/362 (39%), Gaps = 60/362 (16%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDI----------S 53
           PIV+D G+  +K G      P   F + + R    +   +   K +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKDIMIGDEASDVRS 65

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113
            +    P E G + +W     +WDY FFN        L  + G  ++++E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MQLPTTSGGKILLTEPPMNPVKNRE 120

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
            M +V+FE+Y+F  ++ +  A  A + +    +S                    +V+D G
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLSSG------------------VVVDSG 159

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231
              T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL 219

Query: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289
            +VS     ++   +E T +   Y LPD                    + +++  E F  
Sbjct: 220 CYVSYDLDLDTKLARETTTLVENYELPD-------------------GRIIKVGQERFEA 260

Query: 290 PETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349
           PE  F P +  + + G               +R  +   IV +GG+   P   +RL  EL
Sbjct: 261 PECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYPGLPSRLEKEL 320

Query: 350 QR 351
           ++
Sbjct: 321 KQ 322

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 82/362 (22%), Positives = 142/362 (39%), Gaps = 60/362 (16%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDI----------S 53
           PIV+D G+  +K G      P   F + + R    +   ++    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRS 65

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113
            +    P E G + +W     +WDY F+         L  + G  ++++E  M      +
Sbjct: 66  YLQISYPMENGIIKNWADMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPMNPLRNRE 120

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
            M +V+FE+Y+F  ++ +  A  A + +    +S                    +V+D G
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLSSG------------------VVVDSG 159

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231
              T +VPV + +      K+LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 160 DGVTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL 219

Query: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289
            +VS     ++   +E T +   Y LP                   D + +++  E F  
Sbjct: 220 CYVSYDLDLDTKLARETTTLVENYELP-------------------DGRVIKVGSERFEA 260

Query: 290 PETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349
           PE  F P +  + +PG               +R  +   +V +GG+   P   +RL  EL
Sbjct: 261 PECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKEL 320

Query: 350 QR 351
           ++
Sbjct: 321 KQ 322

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 83/362 (22%), Positives = 143/362 (39%), Gaps = 60/362 (16%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDI----------S 53
           PIV+D G+  +K G      P   F + + R    +   ++    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASDVRS 65

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113
            +    P E G + +W     +WDY FF         L  +    ++++E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQ-----MKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
            M +V+FE+Y+F  ++ +  A  A + +    +S                    +V+D G
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLSSG------------------VVVDSG 159

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231
              T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 160 DGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKL 219

Query: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289
            +VS     ++   +E T +   Y LP                   D +T+++  E F  
Sbjct: 220 CYVSYDLDLDTKLARETTVLVESYELP-------------------DGRTIKVGQERFEA 260

Query: 290 PETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349
           PE  F P +  + +PG               +R  +   IV +GG+   P   +RL  EL
Sbjct: 261 PECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAIVLSGGSSMYPGLPSRLEKEL 320

Query: 350 QR 351
           ++
Sbjct: 321 KQ 322

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 83/362 (22%), Positives = 142/362 (39%), Gaps = 60/362 (16%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDI----------S 53
           PIV+D G+  +K G      P   F + + R    +   SN    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEASNVRS 65

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113
            +    P E G + +W     +WDY F++        +  + G  ++++E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWADMEQLWDYAFYDQ-----MKIPSTAGHKVLLTEPPMNPLKNRE 120

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
            M +V+FE+Y+F  ++ +  A  A + +    +S                    +V+D G
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLSSG------------------VVVDSG 159

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231
              T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRYLIDLLSRRGYAFNKTADFETVRQIKEKL 219

Query: 232 LFVS-PVSYFESFKHKEQTAVE-YVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289
            +VS  +       H+  T VE Y LP                   D + +++  E F  
Sbjct: 220 CYVSYDLDLDTKLAHETTTLVETYELP-------------------DGRVIKVGSERFEA 260

Query: 290 PETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349
           PE  F P +  + + G               +   +   IV +GG+   P   +RL  EL
Sbjct: 261 PECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAIVLSGGSSMYPGLPSRLEKEL 320

Query: 350 QR 351
           ++
Sbjct: 321 KQ 322

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 82/362 (22%), Positives = 140/362 (38%), Gaps = 60/362 (16%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDI----------S 53
           PIV+D G+  +K G      P   F + + R    +   +N    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEASQVRS 65

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113
            +    P E G +  W     +WDY F+         L  + G  ++++E  M      +
Sbjct: 66  YLQISYPMENGIIRDWADMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPMNPLRNRE 120

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
            M +V+FE+Y+F  ++    A  A + +    +S                    +V+D G
Sbjct: 121 QMCEVMFEKYDFGGVYVGIQAVLALYAQ---GLSSG------------------VVVDSG 159

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231
              T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDMTRYLIDLLSRRGYAFNKTADFETVRQIKEKL 219

Query: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289
            +VS     ++   +E T +  +Y LP                   D + +++  E F  
Sbjct: 220 CYVSYDLDLDTRLAQETTTLVEQYELP-------------------DGRVIKVGSERFEA 260

Query: 290 PETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349
           PE  F P +  + +PG               +   +   IV +GG+   P   +RL  EL
Sbjct: 261 PECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAIVLSGGSSMYPGLPSRLEKEL 320

Query: 350 QR 351
           ++
Sbjct: 321 KQ 322

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 83/362 (22%), Positives = 141/362 (38%), Gaps = 60/362 (16%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDI----------S 53
           PIV+D G+  +K G      P   F + + R    +    +    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRS 65

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113
            +    P E G + +W     +WDY FF         L  + G  ++++E  M   +  +
Sbjct: 66  YLQISYPMENGIIRNWADMELLWDYAFFEQ-----MKLPTTSGGKVLLTEPPMNPIKNRE 120

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
            M +V+FE+Y+F   + +  A  A + +    +S                    +V+D G
Sbjct: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQ---GLSSG------------------VVVDSG 159

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231
              T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKL 219

Query: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289
            +VS     ++   +E T +   Y LP                   D + +++  E F  
Sbjct: 220 CYVSYDLDLDTKLARETTTLVESYELP-------------------DGRVIKVGPERFEA 260

Query: 290 PETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349
           PE  F P +  + +PG               +R  +   IV +GG+   P   +RL  EL
Sbjct: 261 PECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKEL 320

Query: 350 QR 351
           ++
Sbjct: 321 KQ 322

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 98/425 (23%), Positives = 165/425 (38%), Gaps = 74/425 (17%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHR-AFNALARDKFGSYYLSNQI----------KTIKDIS 53
           P+V+DNGS  IK G      P    +N +   K+    L+N I          +  K   
Sbjct: 10  PVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISNNDLTYIGNRAQKSRG 69

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPELS 112
            +  R P   G + +W+    +W + F +  + N FD      +H L+++E  +   +  
Sbjct: 70  LLRLRHPMNRGIVENWDDMETLWSHTFNDILKINDFD------EHPLLITEAPLNPEKNR 123

Query: 113 KNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDV 172
             M +V FE+++FA+++       A     S+  SG+                   V+D 
Sbjct: 124 DKMCEVFFEKFDFAAVY------IANPSTLSLYASGR---------------TTGCVLDC 162

Query: 173 GFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVM-----DETILVNNI 227
           G      VP+ +G     +++++D+GGR +   L+     R Y  +      E  +V N+
Sbjct: 163 GDGYCSSVPIYEGFALPSSIRRIDVGGRDVTEQLQ--FQIRKYTGISLYSSSEHEIVKNV 220

Query: 228 KENCLFVSPVSYFESFKHKEQTAV---EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKD 284
           KE   +VS       F H E  +    E +   F+             LP D + + L  
Sbjct: 221 KEKACYVST-----DFAHDEDMSNLNPEKIRCQFK-------------LP-DGKDLILDK 261

Query: 285 ELFSVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATR 344
             F  PE  F P+I  L                  +LRP +  +I+  GG+     F  R
Sbjct: 262 ARFRAPEILFRPQIMGLEYDSVSDMCFESISKVDLELRPKLFSSIILNGGSTMFRGFGDR 321

Query: 345 LATELQRQLPTDWTCTVHLPSGPKELY-GWSSMASFTNSPLYSDARVTREEYFEHGVDWC 403
           L  EL  Q+ T     + + + P+  Y  W   +  T    +    +T+ E+ E   D  
Sbjct: 322 LLKEL--QIRTGNKNLIKIIAPPERKYTSWIGGSILTGLSTFKQLWMTKAEWQE---DNN 376

Query: 404 TRHRF 408
            R+RF
Sbjct: 377 LRYRF 381

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 82/362 (22%), Positives = 142/362 (39%), Gaps = 60/362 (16%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDI----------S 53
           PIV+D G+  +K G      P   F + + R    +   +N    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEASDVRS 65

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113
            +    P E G + +W     +WDY FF+        L  +    ++++E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFDQ-----MKLPTTSNGKILLTEPPMNPVKNRE 120

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
            M +V+FE+Y+F  ++ +  A  A + +    +S                    +V+D G
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLSSG------------------VVVDSG 159

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231
              T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKV 219

Query: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289
            +VS     ++   +E T +   Y LP                   D + +++  E F  
Sbjct: 220 CYVSYDLDLDTKLARETTTLVENYELP-------------------DGRVIKVGQERFEA 260

Query: 290 PETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349
           PE  F P +  + + G               +R  +   IV +GG+   P   +RL  EL
Sbjct: 261 PECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAIVLSGGSSMYPGLPSRLEKEL 320

Query: 350 QR 351
           ++
Sbjct: 321 KQ 322

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/296 (23%), Positives = 120/296 (40%), Gaps = 49/296 (16%)

Query: 60  PHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVV 119
           P E G + +W     +WDY F++        L  + G  ++++E  M   +  + M +V+
Sbjct: 18  PMENGVIKNWSDMELLWDYAFYDQ-----MQLPSTSGGKVMLTEPPMNPVKNREQMCEVM 72

Query: 120 FEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWV 179
           FE+Y+F  ++ +  A  A + +     SG                   +V+D G   T +
Sbjct: 73  FEKYDFGGVYVAIQAVLALYAQG--LSSG-------------------VVVDSGDGVTHI 111

Query: 180 VPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENCLFVSPV 237
           VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE   +VS  
Sbjct: 112 VPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYD 171

Query: 238 SYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETFFH 295
              ++   +E T +   Y LP                   D + +++  E F  PE  F 
Sbjct: 172 LDLDTKLARETTTLVENYELP-------------------DGRVIKVGSERFEAPECLFQ 212

Query: 296 PEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQR 351
           P +  + +PG               +R  +   IV +GG+   P   +RL  EL++
Sbjct: 213 PSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQ 268

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 86/364 (23%), Positives = 139/364 (38%), Gaps = 62/364 (17%)

Query: 3   SPPIVVDNGSYEIKFGTPDLETP------------HRAFNALARDKFGSYYLSNQIKTIK 50
           S P+V+DNGS  +K G    + P            H   N  ++D      L+ + ++I 
Sbjct: 10  SQPVVLDNGSAILKAGYSGEDRPKFLEHSIVGSPRHGYVNDSSKDDTFVGNLAQERRSI- 68

Query: 51  DISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPE 110
               +  R P + G + +W     IWDY F +        LKD     ++++E  +    
Sbjct: 69  ----LQLRHPVDHGVVKNWNDMELIWDYMFKDK-----LKLKDVDEHPVLITEAPLNPVS 119

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVI 170
               M  ++FE +   +++ +  A  + +   S  ISG                    V+
Sbjct: 120 NRDEMCDLLFESFGVQALYVANPAVLSLYA--SGKISG-------------------CVL 158

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETL---SFRHYNVMDETILVNNI 227
           D G   +  VPV +G     A+K++D+GGR L   L+  L   +        E  LV  I
Sbjct: 159 DCGDGYSCSVPVYQGYTLKSAIKRIDLGGRDLTEQLQLQLRKSTGLSLTTSGEMELVRMI 218

Query: 228 KENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELF 287
           KE   +V               AV+  + + + ++ G     K  LP D + + L  + F
Sbjct: 219 KEKSCYV---------------AVDLDIEEEKCNYEGDQVGLKFKLP-DGKFITLSKDRF 262

Query: 288 SVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLAT 347
            VPE  F P +                      LRP M  +I+ +GG   L  F  RL  
Sbjct: 263 QVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDLRPQMWSDILLSGGTTMLKGFGNRLVQ 322

Query: 348 ELQR 351
           EL +
Sbjct: 323 ELDK 326

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 82/362 (22%), Positives = 140/362 (38%), Gaps = 60/362 (16%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKT-IKDI----------S 53
           PIV+D G+  +K G      P   F ++             I T +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKDIMIGDEASEVRS 65

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113
            +    P E G + +W     +WDY F+         L  + G  ++++E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPMNPLKNRE 120

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
            M +V+FE+Y+F  ++ +  A  A + +    +S                    +V+D G
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLSSG------------------VVVDSG 159

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231
              T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKL 219

Query: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289
            +VS     ++   +E T +  +Y LP                   D + +++  E F  
Sbjct: 220 CYVSYDLDLDTRLARETTTLVEKYELP-------------------DGRIIKVGQERFEA 260

Query: 290 PETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349
           PE  F P +  +   G               +R  +   IV +GG+   P   +RL  EL
Sbjct: 261 PECLFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYPGLPSRLEKEL 320

Query: 350 QR 351
           ++
Sbjct: 321 KQ 322

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 77/317 (24%), Positives = 134/317 (42%), Gaps = 60/317 (18%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY---------YLSNQIKTIKD 51
           E   +V+DNGS   K G    + P   F + + R +             Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPE 110
           I  +  R P E G +T+W+    IW + F+N       +L+ +  +H ++++E  M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVI 170
             + M Q++FE +   + + S  A  + +       SG+                  +V+
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS------SGRTTG---------------IVL 153

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIK 228
           D G   T VVP+  G      + ++D+ GR L   L + LS R Y  +   E  +V +IK
Sbjct: 154 DSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIK 213

Query: 229 ENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFS 288
           E   +V+       F+ + QTA        Q+S +    +    LP D Q + + +E F 
Sbjct: 214 EKLCYVAL-----DFEQEMQTAA-------QSSSI----EKSYELP-DGQVITIGNERFR 256

Query: 289 VPETFFHPEIPQLLKPG 305
            PE  FHP +  L   G
Sbjct: 257 APEALFHPSVLGLESSG 273

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 117/296 (39%), Gaps = 49/296 (16%)

Query: 60  PHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVV 119
           P E G + +W     +WDY F+         L D+    ++++E  M   +  + M +V+
Sbjct: 18  PMENGIIKNWTDMELLWDYAFYEQ-----MKLPDTSNGKILLTEPPMNPIKNREKMCEVM 72

Query: 120 FEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWV 179
           FE+Y F  ++ +  A  A + +     SG                   +V+D G   T +
Sbjct: 73  FEKYNFGGVYVAIQAVLALYAQG--LSSG-------------------VVVDSGDGVTHI 111

Query: 180 VPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENCLFVSPV 237
           VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE   +VS  
Sbjct: 112 VPVYESVVLNHLTRRLDVAGRDVTRNLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYD 171

Query: 238 SYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETFFH 295
              ++   +E T +   Y LP                   D + +++  E F  PE  F 
Sbjct: 172 LDLDTKLARETTTLVESYELP-------------------DGRVIKVGSERFEAPECLFQ 212

Query: 296 PEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQR 351
           P +  + + G               +R  +   IV +GG+   P   +RL  EL++
Sbjct: 213 PNLVDVEQAGVGELLFNTIQSADVDIRSTLFKAIVLSGGSSMYPGLPSRLEKELKQ 268

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 79/362 (21%), Positives = 139/362 (38%), Gaps = 60/362 (16%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDI----------S 53
           PIV+D G+  +K G      P   F + + R    +    N    +KD+          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVRS 65

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113
            +    P E G + +W     +WDY F+         L  + G  ++++E  +   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPLNPLKNRE 120

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
            M +V+FE+Y+F  ++ +  A  A + +    +S                    +VID G
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLSSG------------------VVIDSG 159

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231
              T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKL 219

Query: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289
            +VS     ++   +E T +   Y LP                   D + +++  E F  
Sbjct: 220 CYVSYDLELDTKLARETTTLVENYELP-------------------DGRVIKVGQERFEA 260

Query: 290 PETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349
            E  F P +  +   G               +R  +   IV +GG+   P   +R+  EL
Sbjct: 261 AECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKEL 320

Query: 350 QR 351
           ++
Sbjct: 321 KQ 322

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 88/411 (21%), Positives = 168/411 (40%), Gaps = 66/411 (16%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHR-AFNALARDKFGSY-----------YLSNQIKTIKDI 52
           PIV+DNGS  IK G    + P    +N     K+              Y+ N+ ++I+ +
Sbjct: 11  PIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENLDKYIGNRAQSIRGL 70

Query: 53  SSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELS 112
             +  + P   G + +W+    +W + F +       ++++ +   L+++E  +TI +  
Sbjct: 71  --LRLQHPMNRGVVDNWDDMELLWWHIFNDT-----LNVQNIEEHPLLITEAPLTIEKQR 123

Query: 113 KNMDQVVFEEYEFASMFKSPIAGFAPFGRPSI-AISGKGDDQPNRKAEPDAYEPFQLVID 171
             M + +FE +   S++            PS+ ++   G+                 V+D
Sbjct: 124 HIMCERLFETFNIPSLY---------VANPSVLSLYASGNTTG-------------CVVD 161

Query: 172 VGFNCTWVVPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETILVNNI 227
            G       P+ +G     +++K+++GGR     L   ++++     Y+  +E  +V  I
Sbjct: 162 CGDGYCSSTPIYEGFVLPASIRKMEVGGRDITEHLQFQIRKSSGISLYSS-NEKEIVRTI 220

Query: 228 KENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELF 287
           KE   ++S     E F   E++   Y L   + S        K  LP D + + L  E F
Sbjct: 221 KEKVCYIS-----EDFNKSEES---YYLRQDEMSC-------KFKLP-DGKELTLNKERF 264

Query: 288 SVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLAT 347
             PE  F+P++  L                  +LRP +  NI+ TGG+     F +RL  
Sbjct: 265 RSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPKLFSNILLTGGSTLFKGFGSRLLG 324

Query: 348 ELQRQLPTDWTCTVHLPSGPKELY-GWSSMASFTNSPLYSDARVTREEYFE 397
           +LQ    T+    + + + P+  Y  W   +  T    + +  VT+ ++ E
Sbjct: 325 DLQEL--TNNRAKIKILAPPERKYTSWIGGSILTGLSTFKNLWVTKSDWEE 373

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 83/411 (20%), Positives = 161/411 (39%), Gaps = 68/411 (16%)

Query: 5   PIVVDNGSYEIKFGTPDLETP---------HRAFNALARDKF-GSYYLSNQIKTIKDISS 54
           PIV+DNGS  IK G    E P         H  ++ +  +   G  ++ N+ + ++ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEERPKALEYSLVGHTKYDKVMLEGLQGDTFVGNKAQKLRGL-- 71

Query: 55  VVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKN 114
           +  R P + G +  W+    IW Y            L++ +   L+++E  M   +  + 
Sbjct: 72  LRLRYPMKHGVVEDWDSMELIWSYVLNEV-----LQLQNIEEHPLLITEAPMNPLKNREM 126

Query: 115 MDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGF 174
           + QV+FE +  ++++ S  A  + +       SG+                   V+D G 
Sbjct: 127 IAQVMFETFNLSAIYVSDPAVLSLYA------SGR---------------TTGCVVDCGE 165

Query: 175 NCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETI-------LVNNI 227
                VP+  G     ++ ++DIGG    G + E L F+       ++       +V  I
Sbjct: 166 GYCSSVPIYDGFALPASIMRMDIGG----GDITEQLQFQIRKSAGVSLFSSSEREIVRTI 221

Query: 228 KENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELF 287
           KE   +++  +  E  K+ + T       D  ++F          LP D +++E+ ++ +
Sbjct: 222 KEKVCYLAKDAKKEEDKYLQGT------QDLISAF---------KLP-DGKSIEVGNDRY 265

Query: 288 SVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLAT 347
             PE  F P+I      G               LR  +L +++ +GG   L  F  R+  
Sbjct: 266 RAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRKNLLSSVILSGGTTTLKGFGDRMLH 325

Query: 348 ELQRQLPTDWTCTVHLPSGPKELY-GWSSMASFTNSPLYSDARVTREEYFE 397
           +L+    T  T  + + + P+  Y  W   +  T    +      + ++ E
Sbjct: 326 DLEA--LTKGTSKIKIIAPPERKYTAWIGGSILTGLSTFQKLWTKKSDWLE 374

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 67.8 bits (164), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 83/405 (20%), Positives = 152/405 (37%), Gaps = 56/405 (13%)

Query: 5   PIVVDNGSYEIKFGTPDLETP---------HRAFNALARDKF-GSYYLSNQIKTIKDISS 54
           PIV+DNGS  IK G    E P         H  +  +  +   G  ++ N+ + ++ +  
Sbjct: 14  PIVIDNGSGIIKVGFSGEERPKALEYSLVGHVKYEKVMLEGLQGDTFVGNKAQKLRGL-- 71

Query: 55  VVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKN 114
           +  R P   G +  W+    IW Y            L++ +   L+++E  M   +  + 
Sbjct: 72  LRLRYPMTHGVVEDWDSMELIWSYMLNEV-----LQLQNIEEHPLLITEAPMNPLKNREV 126

Query: 115 MDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGF 174
           M QV+FE +   +++ S  A  + +       SG+                   V+D G 
Sbjct: 127 MAQVLFETFNLPALYISNPAVLSLYA------SGR---------------TTGCVVDCGE 165

Query: 175 NCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFV 234
                VP+  G     ++ ++DIGGR +     E L F+       ++  ++  E    +
Sbjct: 166 GYCSTVPIYDGFALPASIMRMDIGGRDIT----EQLQFQLRKSAGISLFSSSELEVVRMI 221

Query: 235 S-PVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETF 293
              V Y      KE+        D  + F          LP D + +E+ ++ +  PE  
Sbjct: 222 KEKVCYLAKNIKKEEDRYLQGHHDLGSVF---------KLP-DGKCIEIGNDRYRAPEIL 271

Query: 294 FHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQL 353
           F P+I      G               LR  +L +I+ +GG   L  F  R+  +L+   
Sbjct: 272 FSPQIIGSGYDGLSDMCMQSIWKVDLDLRKTLLSSIILSGGTTTLRGFGERMLHDLEAL- 330

Query: 354 PTDWTCTVHLPSGPKELY-GWSSMASFTNSPLYSDARVTREEYFE 397
            +  TC + + + P+  Y  W   +  T    +      + ++ E
Sbjct: 331 -SKGTCKIKIIAPPERKYTTWVGGSILTGLSTFQKLWTKKSDWLE 374

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 82/415 (19%), Positives = 159/415 (38%), Gaps = 76/415 (18%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF--NALARDKFG---------SYYLSNQIKTIKDIS 53
           P+V+DNG+  +K G    + P + F  N +   KF          + Y+ N+ +  + + 
Sbjct: 10  PVVIDNGTGVLKVGFVGDDKP-KCFQHNIVGTPKFDKVMIGGLDDNMYIGNKAQENRGL- 67

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113
            +  R P E G++  W+   A+W +   +       +++  +   ++++E  +   +  +
Sbjct: 68  -LRLRHPMEHGEVKHWDEMEAVWKHTLLHD-----LNIQHIEEHPILITEAPLNSSKNRE 121

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
           +M +++FE +                  P+I +     + P   A          VID G
Sbjct: 122 HMCEILFESFNI----------------PAIHV-----ENPAVLALYSGGRTTGCVIDCG 160

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVM-------DETILVNN 226
                 VP+ +G     +++++DIGGR +     E L F+    +       +E  +V  
Sbjct: 161 EGYCSAVPIYEGFALTPSIRRIDIGGREIT----EQLQFQIRKSVGMSLFSSNEKEIVRT 216

Query: 227 IKENCLFVSPVSYFESFKH---KEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELK 283
           IKE   +V+     E  K+    E  + ++ LPD ++  +G V+                
Sbjct: 217 IKERACYVADDISKEEHKYILDSESNSSKFKLPDGKSLSIGNVR---------------- 260

Query: 284 DELFSVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFAT 343
              F   E  F+P +                      LRP++  ++V  GG   LP F  
Sbjct: 261 ---FRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSLVLNGGTTVLPGFGN 317

Query: 344 RLATELQRQLPTDWTCTVHLPSGPKELY-GWSSMASFTNSPLYSDARVTREEYFE 397
           R+  EL  Q+ T     + + + P+  Y  W   +       +    VT+  + E
Sbjct: 318 RILKEL--QILTKQDTKLRIIASPERKYTTWIGGSILAGLSTFQKILVTKSNWNE 370

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 76/358 (21%), Positives = 139/358 (38%), Gaps = 55/358 (15%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHR-AFNALARDKF---------GSYYLSNQIKTIKDISS 54
           P+V+DNGS  IK G    E P    +  +   K+         G  ++ N  + ++ +  
Sbjct: 14  PVVIDNGSGIIKAGFSGEERPKALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGL-- 71

Query: 55  VVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPELSK 113
           +  R P + G +  W+    IW Y      +          G+H L+++E  M   +  +
Sbjct: 72  LKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQNI------GEHPLLITEAPMNPLKNRE 125

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
            M QV+FE ++ ++++ S  A  + +       SG+                   V+D G
Sbjct: 126 QMAQVLFETFDVSALYVSNPAVLSLYA------SGR---------------TTGCVVDCG 164

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLF 233
                 VP+  G     ++ ++DIGG  +     E L F+       ++  ++ +E    
Sbjct: 165 EGYCSTVPIYDGFALPASMMRMDIGGADIT----EQLQFQLRKSAGVSLFSSSEREIVRT 220

Query: 234 VS-PVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPET 292
           +   V Y      KE+        D  ++F          LP D + +E+ ++ +  PE 
Sbjct: 221 MKEKVCYLAKNIKKEEEKYLQGTQDLISTF---------KLP-DGRCIEVGNDRYRAPEI 270

Query: 293 FFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQ 350
            F P+I  L   G               LR  +L +I+ +GG   L  F  R+  +L+
Sbjct: 271 LFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLKGFGDRMLWDLE 328

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 79/359 (22%), Positives = 138/359 (38%), Gaps = 57/359 (15%)

Query: 5   PIVVDNGSYEIKFGTPDLETP---------HRAFNALARDKF-GSYYLSNQIKTIKDISS 54
           PIV+DNGS  IK G    E P         H  ++ +  +   G  ++ N+ + ++ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHAKYDKVMLEGLQGDTFVGNKAQRLRGL-- 71

Query: 55  VVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKN 114
           +  + P E G +  W+    IW +            L++ +   L+++E  M   +  + 
Sbjct: 72  LRLQYPIEHGVVEDWDSMELIWAHILNEV-----LQLQNIEEHPLLITEAPMNPLKNREV 126

Query: 115 MDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGF 174
           M QV+FE +   +++ S  A  + +       SG+                   VID G 
Sbjct: 127 MAQVLFETFNLPALYVSNPAVLSLYA------SGR---------------TTGCVIDCGE 165

Query: 175 NCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVM---DETILVNNIKENC 231
                VP+  G     ++ ++DIGGR +   L+  L       +    E  +V  IKE  
Sbjct: 166 GYCSTVPIYDGFALPASMMRMDIGGRDITKQLQFQLRKSAGVSLFSSSEREIVRTIKEK- 224

Query: 232 LFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPE 291
                V Y  +   KE+        D  + F          LP D + +E+ ++ +  PE
Sbjct: 225 -----VCYLATDIKKEENTYMQESQDLTSVF---------KLP-DGKCIEIGNDRYRAPE 269

Query: 292 TFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQ 350
             F P+I      G               LR  +L +I+ +GG   L  F  R+  +L+
Sbjct: 270 ILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLSSIILSGGTTTLRGFGDRMLHDLE 328

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 94/426 (22%), Positives = 159/426 (37%), Gaps = 76/426 (17%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF---------------NALARDKFGSYYLSNQIKTI 49
           P+V+DNGS  IK G    E P + F                 LA D   S  + N+ + +
Sbjct: 11  PVVLDNGSGIIKAGFSGEEQP-KCFEYSLIGTPKYNKVMAGGLASD---SQLIGNEAQKM 66

Query: 50  KDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIP 109
           + +  + +  P E G +  W     +W + F+N        L + +   ++++E  +   
Sbjct: 67  RGLLKLHY--PLEHGVVQDWPGLEQLWTHVFYNS-----LKLANIEEHPMLITEAPLNPM 119

Query: 110 ELSKNMDQVVFEEYEFASMFKSPIAGFAPF--GRPSIAISGKGDDQPNRKAEPDAYEPFQ 167
           +    M +++FE +   +++ S  A  A +  GR +                        
Sbjct: 120 KNRNKMCEMLFETFGSPAVYVSIQAVLALYAGGRTT-----------------------G 156

Query: 168 LVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETIL 223
            VID G  C   VPV  G     A++++D+ GR    FL  LL+++      +  +  I 
Sbjct: 157 CVIDCGDGCCQSVPVYDGFTLPSAIQRIDVAGRDITEFLQLLLRKSSGVTLSSSSEREI- 215

Query: 224 VNNIKENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELK 283
           V  IKE   FV+         ++EQ        + +T F          LP D + + L 
Sbjct: 216 VRMIKEKACFVAT-----DVGNEEQNYEGANSAELETRF---------KLP-DGKILTLG 260

Query: 284 DELFSVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFAT 343
            E F  PE  F P +                      LR  +  +IV +GG+     F  
Sbjct: 261 AEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLRSSLYSSIVLSGGSTMFSGFGD 320

Query: 344 RLATELQRQLPTDWTCTVHLPSGPKELYG-WSSMASFTNSPLYSDARVTREEYFEHGVDW 402
           RL +E+++    +    +  P  P+  Y  W   +       +    VTR E+ E+    
Sbjct: 321 RLLSEIRKTSEPNTKIKIFAP--PERKYSTWIGGSILAGLSTFEKLWVTRAEWQEN--PQ 376

Query: 403 CTRHRF 408
           C   RF
Sbjct: 377 CIHSRF 382

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 95/421 (22%), Positives = 158/421 (37%), Gaps = 66/421 (15%)

Query: 5   PIVVDNGSYEIKFGTPDLETP----HRAFNALARDKFGSYYLSNQIKTI-----KDISSV 55
           P+V+DNGS  IK G    E P    +        DK  +  LS++ + +     K    +
Sbjct: 11  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSSRGQLVGNEAQKQRGLL 70

Query: 56  VFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPELSKN 114
             + P E G +  W     +W + F++  + N        G H ++V+E  +   E    
Sbjct: 71  RLQYPVEHGIVQDWSGLEQLWTHVFYSSLKLNNI------GDHPMLVTEAPLNPLENRDK 124

Query: 115 MDQVVFEEYEFASMFKSPIAGFAPF--GRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDV 172
           M ++++E +   +++ S  A  A +  GR +                         VID 
Sbjct: 125 MCEMLYETFNVPAVYVSIQAVLALYAGGRTT-----------------------GCVIDC 161

Query: 173 GFNCTWVVPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETILVNNIK 228
           G  C   VPV  G     A++++D+ GR    FL  LL++++     +  +  I V  IK
Sbjct: 162 GDGCCQSVPVYDGFSIPSAIRRIDVAGRDVTEFLQLLLRKSIGVTLLSSSEREI-VRMIK 220

Query: 229 ENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFS 288
           E   +V+P    E  K+      E +               K  LP D + + L  E F 
Sbjct: 221 EKACYVAPEVAAEEQKYASSRGSEEL--------------TKFKLP-DGKILSLGAEKFR 265

Query: 289 VPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATE 348
            PE  F P++                      LR  +  ++V +GG+     F  RL  E
Sbjct: 266 APEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYSSLVLSGGSTLFAGFGDRLLNE 325

Query: 349 LQRQLPTDWTCTVHLPSGPKELYG-WSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHR 407
           L+ +   +    +  P  P+  Y  W   +       +    VTR E+ E+    C   R
Sbjct: 326 LRSRCEPNVKIKIFAP--PERKYSVWIGGSILAGLSTFEKIWVTRSEWQEN--PQCVHSR 381

Query: 408 F 408
           F
Sbjct: 382 F 382

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 61/154 (39%), Gaps = 15/154 (9%)

Query: 270 KKPLPQDSQTVE------LKDELFSVPETFFHPEIPQLLKPGXX----XXXXXXXXXXPE 319
           + P P DS+ V       L  E   VPE  F P I    + G                P 
Sbjct: 592 RGPRPHDSEDVHQQHQLHLNTERIRVPEILFEPSIAGQDQAGIAELCETILLKKFGSKPG 651

Query: 320 QLRPL---MLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSM 376
            L      M+ N+  TGGN  +P    R+  E    LP     +VH+   P  L  W  M
Sbjct: 652 NLSAASSRMVNNVWITGGNARIPGIKNRIVKEFTEFLPAGTPLSVHMSEDPS-LDAWKGM 710

Query: 377 ASFTNSPL-YSDARVTREEYFEHGVDWCTRHRFG 409
           A   N+   Y +  VTR+EY E+G D+   H+ G
Sbjct: 711 AKLANNETDYKNTAVTRKEYEEYGPDYIKEHKLG 744

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 56/246 (22%), Positives = 99/246 (40%), Gaps = 47/246 (19%)

Query: 6   IVVDNGSYEIKFGTPDLETPHRAFNALA---RDK--------FGSYYLSNQIKTIKDISS 54
           I +D GSY I+ G  +  TP   F       RD+         G+  L +Q  TI+  S 
Sbjct: 39  IAIDFGSYNIRAGYTNQNTPSYIFPTRLTKHRDRKLQKTFTFIGNDTLLDQ--TIRSQS- 95

Query: 55  VVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKN 114
              + P +   LT+W+    + +Y F +     G    +     L+++E    +     +
Sbjct: 96  ---KSPFDGTLLTNWDYVEDMLEYTFHHL----GVSGNNGVSNPLIINERLACLQSQRNS 148

Query: 115 MDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGF 174
             Q++FE ++   +     + F+ +G      S K D                LVI+ G 
Sbjct: 149 WYQLLFETFDLPEVSFGIDSLFSFYGN-----STKEDG---------------LVINCGN 188

Query: 175 NCTWVVPVIKGIPYYKAVKKLDIGG----RFLNGLLKETLSFRHYNVMDETILVNNIKEN 230
             T V+P++ G       K+++ GG     FL+ LL  TL + ++     T+    + E+
Sbjct: 189 EETDVIPIVGGRGILSECKRINWGGSQSTNFLSSLL--TLKYPYFPAKLSTLQYTQMYED 246

Query: 231 CLFVSP 236
             + SP
Sbjct: 247 YCYTSP 252

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 91/412 (22%), Positives = 164/412 (39%), Gaps = 74/412 (17%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHR-AFNALARDKFGSYYLSN--QIKTIKDISS-----VV 56
           PIV+DNGS  +K G    + P    ++ +   K+    +    + K + +++      + 
Sbjct: 13  PIVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVEKGKFVGNLAQEYRGLLK 72

Query: 57  FRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPELSKNM 115
            R P + G + +WE    +WD+ F +  + +        G+H LVV+E  +      + M
Sbjct: 73  LRYPMDHGIIENWEHMETVWDHIFKDCLKVSNL------GEHPLVVTEAPLNPKPNREKM 126

Query: 116 DQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFN 175
            + +FE +   +++   IA  A     S+  SG+                   V++ G  
Sbjct: 127 CETLFESFNIPALY---IANPAVL---SLYASGR---------------TTGCVVEAGDG 165

Query: 176 CTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVM-----DETILVNNIKEN 230
               VP+ +G     +++++DIGGR +   L+  L  R    M      E  +V  IKEN
Sbjct: 166 YCSSVPIYEGFALTPSIRRIDIGGRDITKHLQ--LQLRKSTGMWLYSSSEQEIVRLIKEN 223

Query: 231 CLFVSPVSYFESFK---HKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELF 287
             ++      E  K    +E+ ++ + LPD +   +G    P +               F
Sbjct: 224 GCYICSNHKKEEEKFLLDQEKKSISFKLPDGKNLVIG----PGR---------------F 264

Query: 288 SVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLAT 347
             PE  F+P +                      LR  +L NI  +GG+     F  RL T
Sbjct: 265 RAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLRSKLLNNITLSGGSTMFQGFCDRLIT 324

Query: 348 ELQRQLPTDWTCTVHLPSGPKELY----GWSSMASFTNSPLYSDARVTREEY 395
           EL      D T  V + + P+  Y    G S +A+ +    + +  VT++++
Sbjct: 325 EL--DFSVDKTTKVRILAPPERKYSAFIGGSILANLST---FRNMWVTKDQW 371

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 87/409 (21%), Positives = 148/409 (36%), Gaps = 62/409 (15%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAFNALARDK------FGSY----YLSNQIKTIKDISS 54
           P+V+DNGS  +K G    E P     +L  D        G      ++ N+ + ++ +  
Sbjct: 11  PVVIDNGSAVVKAGFCGEEKPRCMEYSLIGDANYNKIMVGGLECDSFVGNKAQRLRGL-- 68

Query: 55  VVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKN 114
           +  + P E G ++ W+    +W +  F+        L       L+++E  +      + 
Sbjct: 69  LKLKHPMERGVVSDWDDMELLWSHILFD-----SLQLTSGMEHPLLITEAPLNPESNKEK 123

Query: 115 MDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGF 174
           M +V FE       F  P    +  G  S+  SG+                   V+D G 
Sbjct: 124 MLEVFFE------TFNIPAICVSIPGVLSLYASGRTTG---------------CVVDCGE 162

Query: 175 NCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNV----MDETILVNNIKEN 230
                VPV +G     ++K++++GG  +   L+  L  +   V      E  LV  +KE 
Sbjct: 163 GYCSSVPVCEGYTLASSIKRINLGGIDVTKQLQFQLR-KESGVWLFSSGERELVRTMKEK 221

Query: 231 CLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVP 290
             +VS        K +E+   E       T+F          LP D   + L    F  P
Sbjct: 222 SCYVS----LNQLKDEEKFTFEP--GKMNTNF---------KLP-DGNMLTLSKSRFRAP 265

Query: 291 ETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQ 350
           E  F P+I    +P               +LRP ++  I  +GG      F  R   EL 
Sbjct: 266 EILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMSRITLSGGTTMFRGFGDRFLQEL- 324

Query: 351 RQLPTDWTCTVHLPSGPKELY-GWSSMASFTNSPLYSDARVTREEYFEH 398
            Q+ T     + + + P+  Y  W   +       +     T+ ++ EH
Sbjct: 325 -QISTCKKSNIRILAPPERKYTAWIGGSMLAGLTTFRKMLTTKSDWREH 372

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 86/411 (20%), Positives = 157/411 (38%), Gaps = 67/411 (16%)

Query: 5   PIVVDNGSYEIKFG-TPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISS--------V 55
           PIV+DNG+  IK G T + +     ++ +   K+     SN I++   I +        +
Sbjct: 14  PIVIDNGTNVIKGGFTGETKPRCLEYSIVGTPKYDKIMQSNGIESDSFIGNKAQKYRGIL 73

Query: 56  VFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNM 115
             R P   G + +W+    IW Y F +        L++     ++++E  +      + M
Sbjct: 74  KLRHPMLRGVVQNWDDMETIWQYVFDDT-----LYLENLNEHPILITEPPLNNMANRQKM 128

Query: 116 DQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFN 175
            + +FE + F +++ S          P +++   G             +     +D G  
Sbjct: 129 CEALFEIFGFPAVYISV--------SPVLSLYASG-------------QTTGCAVDCGDG 167

Query: 176 CTWVVPVIKGIPYYKAVKKLDIGG-----RFLNGLLKETLSFRHYNVMDETILVNNIKEN 230
               +PV  G     +VKK+DIGG     +    +LK T  F + +   E  +V  IKE 
Sbjct: 168 YCTSIPVYNGFSLASSVKKIDIGGCDITEQLQFSILKNTGLFMYSS--SEREIVRTIKEK 225

Query: 231 CLFVSPVSYFESFKH---KEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELF 287
             +++     E+ K+   +E+ A ++ LPD                    + + +    +
Sbjct: 226 VCYIATDYNLETEKYLFNEEKMASQFKLPD-------------------GKMLNISQGKY 266

Query: 288 SVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLAT 347
           +  E  F PE+                      LR  +  NIV +GG    P F +RL  
Sbjct: 267 TSTEILFRPELIGSEFDSLPEICYQSIKKVDSDLRLPLYSNIVLSGGTTMCPGFGSRLLK 326

Query: 348 ELQRQLPTDWTCTVHLPSGPKELY-GWSSMASFTNSPLYSDARVTREEYFE 397
           ELQ    T +   + + + P+  Y  W   +  +    +S   VT+  + E
Sbjct: 327 ELQTL--TGYDTKIRIIAPPERKYTSWIGGSILSGLSTFSKIWVTKSMWEE 375

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 67/158 (42%), Gaps = 15/158 (9%)

Query: 270 KKPLPQDSQT------VELKDELFSVPETFFHPEIPQLLKPGXX----XXXXXXXXXXPE 319
           + P P DS+       + L  E   VPE FF P +    + G                P 
Sbjct: 591 RGPRPHDSENSHEQHQMHLNVERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGASPR 650

Query: 320 QLRPL---MLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSM 376
           Q+  +   M  N+  TGGN  +P    R+  E    LP + +  V++ S P  L  W  M
Sbjct: 651 QMSSITSEMAKNVWVTGGNAKIPGLRERIVKEFTGFLPVNTSFNVNISSDPS-LDAWRGM 709

Query: 377 ASFT-NSPLYSDARVTREEYFEHGVDWCTRHRFGYQNW 413
           A +  N   Y  + ++++EY E+G D+   H+ G  N+
Sbjct: 710 AKYAQNETDYKKSFISKKEYEEYGPDYIKEHKLGNMNY 747

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 42/216 (19%), Positives = 84/216 (38%), Gaps = 30/216 (13%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY-----YLSNQIKTIKDISSVVFR 58
           PI VD GS +++ G  +  TP   F N + R +         ++ N +   + + +   +
Sbjct: 38  PIAVDFGSNQLRAGLINRATPSHVFTNRITRFRDRKLMKTMTFIGNDVNLDQAVRAQS-K 96

Query: 59  RPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQV 118
            P +   +T+W+    I +Y F +     G    +     ++V+E   T+     +  QV
Sbjct: 97  SPFDGPMVTNWDYVEDILEYTFNHL----GSTPNNGISNPILVTERLATLQTQRSSWYQV 152

Query: 119 VFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTW 178
           +FE +    +     + FA +   +   +G                   LVI  G   T 
Sbjct: 153 LFECFNVPGVTFGIDSLFAYYQNTTANSTG-------------------LVIGCGNEDTN 193

Query: 179 VVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 214
           ++PV+ G       K+++ GG      L   ++ ++
Sbjct: 194 IIPVVDGQGMLTEAKRINWGGSQAADYLTNLMTLKY 229

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 80/395 (20%), Positives = 147/395 (37%), Gaps = 68/395 (17%)

Query: 5   PIVVDNGSYEIKFG-----TPDLETPHRAFNALARDKFGSY-----YLSNQIKTIKDISS 54
           P+++DNGS  IK G      PD+       N LA     +      Y+ N     +  ++
Sbjct: 12  PVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGNSAYERR--AT 69

Query: 55  VVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKN 114
           +    P+    + SW+    +WDY   N       +++  +   +V++ +  T  +  + 
Sbjct: 70  LHLESPYSTNAIMSWDRLEDLWDYVLLNK-----LEIEQLQEHPVVLTNSMSTSKKEEEK 124

Query: 115 MDQVVFEEYEFASMF--KSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDV 172
           M +V+FE++   +++  + PI      GR +                          +  
Sbjct: 125 MCEVLFEKFSIPAIYCSRDPIMSLYGLGRTT-----------------------GCSVSC 161

Query: 173 GFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH---YNVMDETILVNNIKE 229
           G     +  VI G+    + +  + GG  +   + + L   H    N  +   L+ +IKE
Sbjct: 162 GHRGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLDLLRHNHPKLENGQNGIELIRSIKE 221

Query: 230 NCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289
            C  +S   Y E           Y L   +TS      + K  LP D   +E+  E F  
Sbjct: 222 RCCVLSKDFYNE--------IRAYELITSKTS------NNKYRLP-DGNIIEIGSERFEA 266

Query: 290 PETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349
           PE  F+P+     +                  R  +L +IV +GG+  +  F  RL  E+
Sbjct: 267 PEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLESIVLSGGSSLIKGFGERLTKEI 326

Query: 350 QRQLPTDWTCTVHLPS--------GPKELYGWSSM 376
           ++++  +    ++ P         G   L G S+M
Sbjct: 327 RKEIDGNQKIMLNAPHERRFLPWIGGSVLSGLSTM 361

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 64/154 (41%), Gaps = 15/154 (9%)

Query: 270 KKPLPQDSQTVE------LKDELFSVPETFFHPEIPQLLKPG----XXXXXXXXXXXXPE 319
           + P P DS+ +       L  E   VPE  F P +    + G                P 
Sbjct: 596 RGPRPHDSENIHEQHQMHLNVERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQPG 655

Query: 320 QLRPL---MLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSM 376
           +L      M+ N++ TGGN  +P    R+  E    LPT    TV++ S P  L  W  M
Sbjct: 656 KLSQTSIDMVNNVLITGGNAKVPGLKERIVKEFTGFLPTGTNITVNMSSDPS-LDAWKGM 714

Query: 377 ASFT-NSPLYSDARVTREEYFEHGVDWCTRHRFG 409
           A+   N   Y    ++++EY E+G ++   H+ G
Sbjct: 715 AALARNEEQYRKTVISKKEYEEYGPEYIKEHKLG 748

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 89/222 (40%), Gaps = 53/222 (23%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALA--RDK--------FGSYYLSNQIKTIKDIS 53
           PI +D GS +++ G  +  TP   F NAL   RD+         G+  L +Q   ++  S
Sbjct: 39  PIAIDFGSSKLRAGFVNHATPTHIFPNALTKFRDRKLNKNFTFVGNDTLLDQ--AVRSQS 96

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFN----PDEFNGFDLKDSKGQHLVVSETCMTIP 109
              F  P     +T+W L   I DY F +    PD  NG          ++++E   T+ 
Sbjct: 97  RSPFDGPF----VTNWNLTEEILDYTFHHLGVVPD--NGI------PNPILLTERLATVQ 144

Query: 110 ELSKNMDQVVFEEYEFASMFKSPIAGFAPFG-RPSIAISGKGDDQPNRKAEPDAYEPFQL 168
               N  Q++FE Y    +     + F+ +   PS   +G                   L
Sbjct: 145 SQRTNWYQILFETYNVPGVTFGIDSLFSFYNYNPSGNKTG-------------------L 185

Query: 169 VIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGR----FLNGLL 206
           VI  G   T V+PV+ G       K+++ GG     +LN L+
Sbjct: 186 VISCGHEDTNVIPVVDGAGILTDAKRINWGGHQAVDYLNDLM 227

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 60/154 (38%), Gaps = 15/154 (9%)

Query: 270 KKPLPQDSQTVE------LKDELFSVPETFFHPEIPQLLKPGXXXXXXX-------XXXX 316
           + P   DS+++       L  E   VPE  F P I  L + G                  
Sbjct: 588 RGPRSHDSESIHEQHQMHLNVERIRVPEVIFQPSIGGLDQAGIVELCETLLLKKFGSNRR 647

Query: 317 XPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSM 376
              ++  +M  NI  TGGN  LP    R+  E    LP      V L   P  +  W  M
Sbjct: 648 ELSEISKMMAKNIFITGGNAKLPGIRERVVREFTGFLPVGTNLNVKLAEDPS-MSAWRGM 706

Query: 377 ASFT-NSPLYSDARVTREEYFEHGVDWCTRHRFG 409
           A F  N+ LY  + +T++EY E G ++   H  G
Sbjct: 707 AKFANNTSLYETSIMTKKEYEELGPEYIKEHNLG 740

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 99/234 (42%), Gaps = 44/234 (18%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALAR--DKFGSY---YLSNQIKTIKDISSVVFR 58
           PI +D GSYE++ G  +   P   F N LAR  D+  S    ++ N     + I +   +
Sbjct: 38  PIAIDFGSYEVRAGYVNQGDPALVFTNRLARYRDRKASRTYTFVGNDTNLDQSIRTQS-K 96

Query: 59  RPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKG--QHLVVSETCMTIPELSKNMD 116
            P +   +T+W+    I  Y F +       D++ + G    ++++E    +     N  
Sbjct: 97  SPFDGSMITNWDYVDDILAYTFHH------LDVRGNGGVPNPVLITERMAALQSQRSNWY 150

Query: 117 QVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNC 176
           +++FE Y    +     + F+ +G      +G                   + I+ G   
Sbjct: 151 ELLFECYNLQKVTFGIDSLFSFYGEHPPGTTG-------------------IAINSGNED 191

Query: 177 TWVVPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETILVNN 226
           T V+PV+ G       K+++ GG+    +LNGLL  +L + ++     T LVNN
Sbjct: 192 TSVIPVVNGKGILTEAKRINWGGQQSVGYLNGLL--SLKYPYF----PTKLVNN 239

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 60/154 (38%), Gaps = 15/154 (9%)

Query: 270 KKPLPQDSQTVE------LKDELFSVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRP 323
           + P P DS+ +       L  E   VPE  F P +    + G                R 
Sbjct: 596 RGPRPHDSENIHEQHQMHLNVERIRVPEVVFQPTMGGQDQAGICELSETILMKKFGSQRG 655

Query: 324 L-------MLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSM 376
                   M+ NI+ TGGN  +P    R+  E    LP      V++ S P  L  W  M
Sbjct: 656 KLSSTSLDMVNNILITGGNAKVPGLRERIVKEFTEFLPVGTNVAVNISSNPS-LDAWRGM 714

Query: 377 ASFT-NSPLYSDARVTREEYFEHGVDWCTRHRFG 409
           A+   N   Y    +++EEY E+G D+   H+ G
Sbjct: 715 AALARNKAEYKKTVISKEEYEEYGPDYIKEHKLG 748

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 83/217 (38%), Gaps = 43/217 (19%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALA--RDK--------FGSYYLSNQIKTIKDIS 53
           PI +D GS  ++ G  +  TP   F N L   RD+         G+  L +Q   ++  S
Sbjct: 39  PIAIDFGSSRLRAGFVNQATPTHIFPNVLTKFRDRKLNKNFTFVGNDTLLDQ--AVRSQS 96

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113
              F  P     +T+W     I DY F +     G    +     ++++E   T+     
Sbjct: 97  RSPFDGPF----VTNWNFTEEIMDYTFHHL----GVLPNNGISNPILLTERMATVQSQRA 148

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
           N  Q++FE Y    +          FG  S+      +   N+           LVID  
Sbjct: 149 NWYQILFETYNVPGV---------TFGIDSLYSFYNNNPSGNKTG---------LVIDCS 190

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGR----FLNGLL 206
              T VVP++ G       K+++ GG     +LN L+
Sbjct: 191 HEDTSVVPIVDGAGILTDAKRINWGGHQAVDYLNDLM 227

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 60/159 (37%), Gaps = 15/159 (9%)

Query: 270 KKPLPQDSQTVE------LKDELFSVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRP 323
           + P P DS+ +       +  E   VPE  F P I  L + G             +  R 
Sbjct: 593 RGPRPHDSENIHEQHQMHINVERIRVPEVIFQPSIGGLDQAGVVELCETVLLKKFDSSRR 652

Query: 324 L-------MLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSM 376
                   M  N+  TGGN  LP    R+  E    LP      V L   P  L  W  M
Sbjct: 653 ALSATCEKMAKNVFITGGNTKLPGIRERIVREFTGFLPVGTELKVTLAKDPS-LSAWKGM 711

Query: 377 ASFTNSPL-YSDARVTREEYFEHGVDWCTRHRFGYQNWM 414
           A F + P  Y  + +T+ EY E+G ++   H  G   +M
Sbjct: 712 AKFASDPTSYKSSILTKREYEEYGPEYIKEHNLGNAKFM 750

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 81/211 (38%), Gaps = 32/211 (15%)

Query: 5   PIVVDNGSYEIKFG-----TPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRR 59
           PI +D GSYE++ G      P L  P R      R    +Y    +   +        R 
Sbjct: 42  PIAIDFGSYEVRAGYVANKEPALVFPTRLARYRDRKASRTYTFVGRDTGLDASIRTQSRS 101

Query: 60  PHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVV 119
           P +   +T+W+    +  Y F +     G  + ++    +V++E   T+     N  +++
Sbjct: 102 PFDGPMVTNWDYVDDMLAYTFHHLGVRGGGGVPNA----VVLTERLATLQSQRANWYELL 157

Query: 120 FEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWV 179
           +E Y    +     + F+ +G      +G                   LV+  G   T V
Sbjct: 158 YEAYNLQEVTFGIDSLFSFYGERGPGSTG-------------------LVVSSGNEDTCV 198

Query: 180 VPVIKGIPYYKAVKKLDIGGR----FLNGLL 206
           VPV+ G       K+++ GG+    +L GLL
Sbjct: 199 VPVVDGRGVVSEAKRINWGGQQAVDYLTGLL 229

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 62/153 (40%), Gaps = 14/153 (9%)

Query: 270 KKPLPQDSQTVE------LKDELFSVPETFFHPEIPQLLKPGXXXXXXXXXX----XXPE 319
           + P P DS  V       L  E   VPE  F P +    + G                P 
Sbjct: 592 RGPRPHDSDDVHEQHQMHLNIERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFGSSPN 651

Query: 320 QLRPL---MLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSM 376
           QL      M  NI  +GGN  +P    R+  E    LP     +V++ S P  L  W  M
Sbjct: 652 QLSKTAEDMANNIWLSGGNAKVPGLKNRIVKEFTSFLPVGTKLSVNMSSDPL-LDSWKGM 710

Query: 377 ASFTNSPLYSDARVTREEYFEHGVDWCTRHRFG 409
           A +  S  Y+ + +T++EY E+G ++   H+ G
Sbjct: 711 AKWAKSEDYNKSFITKKEYEEYGPEYIKEHKMG 743

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 80/217 (36%), Gaps = 32/217 (14%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTI-KDIS-----SVVF 57
           PI +D GS  +K G  + + P   F   L R  F    L+  +  I  DIS         
Sbjct: 39  PIAIDFGSNTLKAGYTNQDVPSLVFPTRLTR--FRDRRLNRTMTFIGNDISLDQAVRAQS 96

Query: 58  RRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQ 117
           + P +   +T+WE    + +Y F    +  G    +     L+ SE    +        Q
Sbjct: 97  KSPFDGSMVTNWEYIDEMLEYTF----KHLGVLGDNGISNPLIFSEKLAVVQAQRSQWYQ 152

Query: 118 VVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCT 177
           ++FE +  +         FA F   SI  +G                   L+I      T
Sbjct: 153 LLFETFNISKATFGIDNQFAFFANNSIDSTG-------------------LMIGCNNEDT 193

Query: 178 WVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 214
            V+P++ G+   +  K+++ GG      +   LS ++
Sbjct: 194 NVIPIVNGVASLQECKRINWGGNHAVSYMNNLLSLKY 230

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 71/316 (22%), Positives = 125/316 (39%), Gaps = 41/316 (12%)

Query: 40  YYLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHL 99
           +Y+ N+  T    ++     P   GQ+ +W+     W+   F       +   + +    
Sbjct: 107 FYIGNEALTASQGANYSLNYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 160

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  +  PE  + + ++ FE +  A ++   IA  A     +   S K  D+      
Sbjct: 161 LLTEPPLNPPENREQVAEIFFESFNCAGLY---IAVQAVLALAASWTSSKVVDRSLTGT- 216

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
                    VID G   T V+PV +G     A+K + I GR +   ++  L  R    +D
Sbjct: 217 ---------VIDSGDGVTHVIPVAEGYVIGSALKNIPIAGRDITQFIQSLL--RERGEVD 265

Query: 220 ETI-LVNNIKENCLFVSP--VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQD 276
            ++     IK+   +V P  V  F  F    +   +YV+ +         +D  +     
Sbjct: 266 TSLRTAERIKQEYCYVCPDIVKEFNKFDRDAEKFAQYVVEN---------QDKTR----- 311

Query: 277 SQTVELKDELFSVPETFFHPEIPQ--LLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGG 334
            + V++  E F  PE FF+PEI     L P             P  +R  +  NIV +GG
Sbjct: 312 QKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVLDQTIQACPIDVRKGLYNNIVLSGG 370

Query: 335 NFNLPNFATRLATELQ 350
           +    +F  RL  +L+
Sbjct: 371 STMFKDFGRRLQRDLK 386

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 90/225 (40%), Gaps = 42/225 (18%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLS----NQIKT-IKDISSVV 56
           E   IV+D GSY    G    + P     ++    +G Y  +    NQ KT +    S+ 
Sbjct: 11  EITSIVIDPGSYTTNIGYSGSDCPE----SIIPSSYGQYKDTAKEENQKKTKVFSEQSIG 66

Query: 57  FRRPH-------EFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIP 109
             RP        E G++  W+     WD+   N        LK + G  ++++E      
Sbjct: 67  LARPDYEIKRIVENGEIADWDTAQEQWDWVLKNE-----LFLKSNSGIPVLLTEPIWNSV 121

Query: 110 ELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLV 169
           E  K   +V+ E  +F + + SP++    F                      A  P  LV
Sbjct: 122 ENRKKSLEVLLEGMDFEACYLSPVSTCVSFA---------------------AGRPNCLV 160

Query: 170 IDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 214
           +D+G + T V PVI G+   K+  +  I GR++N L++  L  R 
Sbjct: 161 VDIGHDTTSVSPVIDGMTLSKSSTRNFIAGRYINHLIETYLKPRE 205

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 39/91 (42%), Gaps = 5/91 (5%)

Query: 321 LRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT---DWTCTVHLPSGPKELYGWSSMA 377
           LR  +  N+V TGG   +P    RL  EL ++LP        T HL    K+   W   +
Sbjct: 426 LRASLAHNVVITGGTSCIPRLNDRLMYELSKRLPALKFRILTTGHLRE--KQYQAWLGGS 483

Query: 378 SFTNSPLYSDARVTREEYFEHGVDWCTRHRF 408
             T+   +    V +EEY E G D     RF
Sbjct: 484 ILTSLGTFHQLWVGKEEYKEVGADRLLVDRF 514

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 61/154 (39%), Gaps = 15/154 (9%)

Query: 270 KKPLPQDSQ------TVELKDELFSVPETFFHPEIPQLLKPGXXXXXXXXXX----XXPE 319
           + P P DS+       + L  E   VPE  F P +  L + G                  
Sbjct: 589 RGPRPHDSEDAHEQHQMHLNVERIRVPEVIFQPPMGGLDQAGIIELSETIIMNKFGSSRR 648

Query: 320 QLRPL---MLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSM 376
           QL  +   M  N+  TGGN  +P    R+  E    LP      + + S P  +  W  M
Sbjct: 649 QLSSVSQEMANNVFLTGGNVRVPGLRDRIVREFTEFLPVGTKYNIKVASDPA-IDAWKGM 707

Query: 377 ASFTNSPL-YSDARVTREEYFEHGVDWCTRHRFG 409
           A F  S   Y  + VT++EY E+G D+   H+ G
Sbjct: 708 AKFAQSSTDYKGSYVTKKEYEEYGPDYIKEHKLG 741

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 41/201 (20%), Positives = 74/201 (36%), Gaps = 28/201 (13%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDK----FGSYYLSNQIKTIKDISSVVFRR 59
           PI +D GS E++ G  +   P   F   L R +      ++        ++       R 
Sbjct: 38  PIAIDFGSSEVRAGYTNQSLPSHVFPTRLTRHRDRKINKTFTFVGNDTNLEQTLRTQSRS 97

Query: 60  PHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVV 119
           P +   +T+W+    + +Y F +     G    D     ++++E   T+     N  Q++
Sbjct: 98  PFDGPMITNWDYVEDMMEYTFNHL----GVVGHDGISNPILLTEKMATLQSQRSNWYQLM 153

Query: 120 FEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWV 179
           FE +    +     + F+ F       +G                   LVI  G   T V
Sbjct: 154 FECFGVPKLTFGIDSLFSYFANNQSDSTG-------------------LVISSGNEDTNV 194

Query: 180 VPVIKGIPYYKAVKKLDIGGR 200
           +PV+ G       K+++ GGR
Sbjct: 195 IPVVCGKGILSEAKRINWGGR 215

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 62/152 (40%), Gaps = 15/152 (9%)

Query: 272 PLPQDSQ------TVELKDELFSVPETFFHPEIPQLLKPGXXXXXXXXXXXX----PEQL 321
           P P DS+       + L  E   VPE  F P +  L + G                P+ L
Sbjct: 597 PRPHDSEDIHQQHQIHLNVERIRVPEIVFQPSMGGLDQAGIAELSETILLRKFGSEPKHL 656

Query: 322 RPL---MLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSMAS 378
             L   M  NI  TGGN  +P    R+  E +  LP +    V++ S P     W+ MA 
Sbjct: 657 SELSLTMANNIWLTGGNSKIPGLRERIVKEFREFLPVNTQFNVNMTSDPT-FDAWNGMAK 715

Query: 379 FT-NSPLYSDARVTREEYFEHGVDWCTRHRFG 409
              N   Y    ++++EY E+G ++   H+ G
Sbjct: 716 LAQNETDYKKTIISKKEYEEYGPEYIKEHKLG 747

 Score = 34.3 bits (77), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 44/218 (20%), Positives = 80/218 (36%), Gaps = 32/218 (14%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY-----YLSNQIKTIKDISSVVFR 58
           PI +D GS  ++ G  +   P   F   L R +         +  N     + I S + +
Sbjct: 38  PIAIDFGSSTVRAGYTNEARPSHIFPTKLTRYRDRKINKTFTFTGNDCSLDQTIRSQM-K 96

Query: 59  RPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH--LVVSETCMTIPELSKNMD 116
            P +   +T+W+    I  Y F      N   +    G    ++++E   TI     N  
Sbjct: 97  SPFDGALITNWDYVEDILQYTF------NHLGVVPDHGVQNPIIITEKLATIQSQRSNWY 150

Query: 117 QVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNC 176
           Q++FE Y          + FA +   + + +  G                 +VID     
Sbjct: 151 QLLFETYNVPKATFGIDSLFAFYNNNNGSATSTG-----------------MVIDCSHEE 193

Query: 177 TWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 214
           T ++P++ G       K+++ GGR     L   L+ ++
Sbjct: 194 TNIIPIVDGQGILTDAKRINWGGRHAIDYLSNLLALKY 231

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 77/334 (23%), Positives = 129/334 (38%), Gaps = 42/334 (12%)

Query: 40  YYLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHL 99
           +Y+ N+       +S     P   GQ+ +W+     W+   F       +   + +    
Sbjct: 99  FYIGNEALIASQGASYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 152

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  +  PE  + + ++ FE +  A ++   IA  A     +   S K  D+      
Sbjct: 153 LLTEPPLNPPENREQIAEIFFESFNCAGLY---IAVQAVLALAASWTSSKVVDRSLTGT- 208

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
                    VID G   T V+PV +G     A+K + I GR +   ++  L  R     D
Sbjct: 209 ---------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITQFIQTLL--RERGEAD 257

Query: 220 ETI-LVNNIKENCLFVSP--VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQD 276
            ++     IK+   +V P  V  F  F    +   +YV+ + +       K  KK     
Sbjct: 258 TSLRTAERIKQEYCYVCPDIVKEFNKFDRDPEKFAQYVVENQE-------KTQKK----- 305

Query: 277 SQTVELKDELFSVPETFFHPEIPQ--LLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGG 334
              V++  E F  PE FF+PEI     L P             P  +R  +  NIV +GG
Sbjct: 306 --VVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGG 362

Query: 335 NFNLPNFATRLATELQRQLPTDWTCTVHLPSGPK 368
           +    +F  RL  +L + +  +      L SG K
Sbjct: 363 STMFKDFGRRLQRDL-KSIVNNRIAQNELLSGTK 395

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 61/152 (40%), Gaps = 15/152 (9%)

Query: 272 PLPQDSQTVE------LKDELFSVPETFFHPEIPQLLKPG----XXXXXXXXXXXXPEQL 321
           P P DS+ +       L  E   VPE  F P +    + G                P +L
Sbjct: 598 PRPHDSENIHEQHQMHLNVERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGSQPGKL 657

Query: 322 RPL---MLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSMAS 378
                 M+ N+  TGGN  +P    R+  E    LP     +V++ S P  L  W  MA+
Sbjct: 658 SSTSLDMVNNVFITGGNSKVPGLRERIVREFTEFLPVGTNFSVNMSSDPS-LDAWKGMAA 716

Query: 379 FT-NSPLYSDARVTREEYFEHGVDWCTRHRFG 409
              N   Y    ++++EY E+G D+   H+ G
Sbjct: 717 LAQNKEEYKKTVISKKEYEEYGPDYIKEHKLG 748

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 86/221 (38%), Gaps = 39/221 (17%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALA--RDK--------FGSYYLSNQIKTIKDIS 53
           PI +D GS +++ G  +   P   F N L   RD+         G+  L +Q   ++  S
Sbjct: 39  PIAIDFGSSKLRAGFVNQAAPTHIFPNVLTKFRDRKLNKNFTFVGNDTLLDQ--AVRSQS 96

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113
              F  P     +T+W     I DY F +     G    +     ++++E   T+     
Sbjct: 97  RSPFDGPF----VTNWNFTEEIMDYTFHHL----GVSPNNGVRNPILLTERMATVQSQRA 148

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
           N  Q++FE Y    +          FG  S+      +   N+           LVID G
Sbjct: 149 NWYQIMFETYNVPGV---------TFGIDSLYGFYNQNTSGNKTG---------LVIDCG 190

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 214
              T V+PV+ G       K+++ GGR     L + ++ ++
Sbjct: 191 HEDTNVIPVVDGTGVLTDAKRINWGGRQAVDYLSDLMALKY 231

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 82/411 (19%), Positives = 156/411 (37%), Gaps = 64/411 (15%)

Query: 5   PIVVDNGSYEIKFGTPDLETPH----------RAFNALARDKFGSYYLSNQIKTIKDISS 54
           P+V+DNGS  +K G    ETP           R    +        ++ N+ + ++    
Sbjct: 13  PVVLDNGSAILKAGFSGDETPAILEYTMAGKPRYKKVMTTGLEDRTFVGNEAQRLR--GL 70

Query: 55  VVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQH-LVVSETCMTIPELSK 113
           +  RRP   G++T+W+    +W + F++  +    +     G H L+++E  +   +  +
Sbjct: 71  LALRRPISRGEVTNWDDMELLWSHIFYSKLQLGQGN--SQIGDHPLLITEAPLNSTKNRE 128

Query: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
            M ++++E + F +++ +  A  + +                        +    V++ G
Sbjct: 129 TMCEILYETFNFDALYVAHPAVLSLYATG---------------------QTTGCVLECG 167

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLL----KETLSFRHYNVMDETILVNNIKE 229
              +   PV +G     +++++DIGGR +   L    +++     ++  ++ I V  IKE
Sbjct: 168 EGYSASTPVYQGFALPSSIRRIDIGGRDITQELQFYIRKSTGLSLFSNSEQEI-VRTIKE 226

Query: 230 NCLFVSPVSYFES---FKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDEL 286
              +V+    FE    F H+ +      LPD Q    G  K     +    Q +    E 
Sbjct: 227 KANYVALDYKFEEEKFFIHERENTSTVKLPDGQELTFGKGKYRTSEILFQPQLI--GSEC 284

Query: 287 FSVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLA 346
            SVPE                             LR  +L NIV +GG   L  F  R  
Sbjct: 285 VSVPEMLLES-----------------INKVDMDLRTQLLENIVLSGGTTMLKGFDQRTM 327

Query: 347 TELQRQLPTDWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYFE 397
           +E ++ LP      +      +    W   +  +    + +  +TRE Y E
Sbjct: 328 SETKKMLPKHTKVKIR-SLAERSYIAWIGGSILSGLYGFRNLWLTREMYEE 377

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 62/159 (38%), Gaps = 15/159 (9%)

Query: 270 KKPLPQDSQTV------ELKDELFSVPETFFHPEIPQLLKPGXXXXXXXX-------XXX 316
           + P P DS+ +       L  E   VPE  F P +  L + G                  
Sbjct: 588 RGPRPHDSEDINQQHQMHLNVERIRVPEVIFQPSMGGLDQAGIIEICETNFLKKFGSSRS 647

Query: 317 XPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSM 376
               +   +  N+  TGGN  LP    R+  E +  LP      V + +    L  W  M
Sbjct: 648 ELSSISRSLASNVFLTGGNMRLPGMRERVVREFRGLLPIGTELNVRMANDCA-LDAWRGM 706

Query: 377 ASFTNS-PLYSDARVTREEYFEHGVDWCTRHRFGYQNWM 414
           A  + +  L+ D  VTR+EY E+G D+   H  G  ++M
Sbjct: 707 AKLSRTDSLFRDTYVTRQEYHEYGPDYIKEHNLGNVSFM 745

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 86/212 (40%), Gaps = 36/212 (16%)

Query: 6   IVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDISSVVF------R 58
           I +D GS E++ G  + E P   F N +AR  +    L+  +  I + +++        R
Sbjct: 39  IAIDFGSSEVRAGYGNQERPSHIFPNRIAR--WRDRKLNRNLTFIGNDTNLDLSVRSQSR 96

Query: 59  RPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQV 118
            P++   +T+W+    I +Y F +     G    D     ++++E    +     N  Q+
Sbjct: 97  SPYDGALVTNWDYTEDIMEYTFHHL----GVKGTDGIPNPIIMTEKLGALHSQRDNWYQL 152

Query: 119 VFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTW 178
           +FE +    +     + F+ +     + SG                   LVI  G   T 
Sbjct: 153 LFECFGAPQVTFGLDSLFSFYANNDASASG-------------------LVISSGNEDTH 193

Query: 179 VVPVIKGIPYYKAVKKLDIGGR----FLNGLL 206
           ++PV+ G       K+++ GGR    +L+ LL
Sbjct: 194 IIPVVDGKGVLGEAKRINWGGRQSVDYLSNLL 225

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 77/334 (23%), Positives = 128/334 (38%), Gaps = 42/334 (12%)

Query: 40  YYLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHL 99
           +Y+ N+  T     +     P + GQ+ +W      W+   F       +   + +    
Sbjct: 104 FYIGNEALTAAQGPAYSLSYPIKHGQVENWNHMERFWENSIFK------YLRTEPEDHFF 157

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  +  PE  + + ++ FE +  A ++   IA  A     +   S K  D+      
Sbjct: 158 LLTEPPLNPPENREQVAEIFFESFNCAGLY---IAVQAVLALAASWTSSKVTDRSLTGT- 213

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
                    VID G   T V+PV +G     A+K + I GR +   ++  L  R    +D
Sbjct: 214 ---------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVD 262

Query: 220 ETI-LVNNIKENCLFVSP--VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQD 276
            ++     IK+   +V P  V  F  F        ++++ +         K  KK     
Sbjct: 263 TSLKTAERIKQEYCYVCPDIVKEFNKFDRDVGKFSQFIIEN-------QGKTQKK----- 310

Query: 277 SQTVELKDELFSVPETFFHPEIPQ--LLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGG 334
              V++  E F  PE FF+PEI     L P             P  +R  +  NIV +GG
Sbjct: 311 --IVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYSNIVLSGG 367

Query: 335 NFNLPNFATRLATELQRQLPTDWTCTVHLPSGPK 368
           +    +F  RL  +L R +  D      L SG K
Sbjct: 368 STMFKDFGRRLQRDL-RSIVNDRIAQSELLSGTK 400

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 74/334 (22%), Positives = 130/334 (38%), Gaps = 42/334 (12%)

Query: 40  YYLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHL 99
           +Y+ N+        S     P   GQ+ +W+     W+   F       +   + +    
Sbjct: 102 FYIGNEALAASRGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 155

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  +  PE  + + ++ FE +  A ++   IA  A     +   S K  D+      
Sbjct: 156 LLTEPPLNPPENREQVAEIFFESFNCAGLY---IAVQAVLALAASWTSSKVTDRSLTGT- 211

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
                    VID G   T V+PV +G     A+K + I GR +   ++  L  R    +D
Sbjct: 212 ---------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVD 260

Query: 220 ETI-LVNNIKENCLFVSP--VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQD 276
            ++     IK+   +V P  V  F  F        ++++ + +++        KK +   
Sbjct: 261 TSLRTAERIKQEYCYVCPDIVKEFNKFDRDAGKFAQFIVENSEST--------KKKI--- 309

Query: 277 SQTVELKDELFSVPETFFHPEIPQ--LLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGG 334
              V++  E F  PE FF+PEI     L P             P  +R  +  NIV +GG
Sbjct: 310 ---VDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGG 365

Query: 335 NFNLPNFATRLATELQRQLPTDWTCTVHLPSGPK 368
           +    +F  RL  +L + +  +      L SG K
Sbjct: 366 STMFKDFGRRLQRDL-KSIVNNRIAQSELLSGTK 398

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 56/154 (36%), Gaps = 15/154 (9%)

Query: 270 KKPLPQDSQTV------ELKDELFSVPETFFHPEIPQLLKPGXXXXXXXXXXXXPEQLRP 323
           + P P DS+ +       L  E   VPE  F P +  L + G                R 
Sbjct: 588 RGPRPHDSENINEQHQMHLNVERIRVPEVIFQPSMAGLDQAGVTEICETNFLKKFGSTRS 647

Query: 324 LM-------LGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSM 376
            +         N+  TGGN  LP    R+  E    LP      V + S    +  W  M
Sbjct: 648 QLSEGSKKLAANVFLTGGNMRLPGVRERIVREFTGMLPMGSNLNVRMASDSA-VDAWRGM 706

Query: 377 ASFTNS-PLYSDARVTREEYFEHGVDWCTRHRFG 409
           A  + +   Y  + +TR+EY E G D+   H  G
Sbjct: 707 AKLSQAGSQYKGSYITRKEYQELGADYIKEHNLG 740

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 89/212 (41%), Gaps = 34/212 (16%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALAR--DKFGSY---YLSNQIKTIKDISSVVFR 58
           PI +D GS E++ G  + + P   F N ++R  D+  +    ++ N       + S   +
Sbjct: 38  PIAIDFGSSEVRAGFGNQDQPSHIFTNRISRWRDRRKNRNLTFIGNDTNLDLSVRSQA-K 96

Query: 59  RPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQV 118
            P++   +++W+    I +Y F +     G +  D     ++++E   T+    +N  Q+
Sbjct: 97  SPYDGAIVSNWDYTEEIMEYTFHHL----GVNGNDGVSNPILMTEKLATLQSQRENWYQL 152

Query: 119 VFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTW 178
           +FE +    +     + F+ +       SG                   LVI+ G   T 
Sbjct: 153 LFECFGVPQVTFGIDSLFSFYANNDATASG-------------------LVINSGNEDTH 193

Query: 179 VVPVIKGIPYYKAVKKLDIGGR----FLNGLL 206
           V+PV+ G       K+++ GGR    +L+ LL
Sbjct: 194 VIPVMNGKGVLSEAKRINWGGRQSVEYLSNLL 225

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 76/334 (22%), Positives = 126/334 (37%), Gaps = 42/334 (12%)

Query: 40  YYLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHL 99
           +Y+ N+        S     P   GQ+  W      W+   F       +   + +    
Sbjct: 101 FYIGNEALAAAQGPSYSLSYPIRHGQVEDWNHMERFWENSIFK------YLRTEPEDHFF 154

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  +  PE  + + ++ FE +  A ++   IA  A     +   S K  D+      
Sbjct: 155 LLTEPPLNPPENREQVAEIFFESFNCAGLY---IAVQAVLALAASWTSSKVTDRSLTGT- 210

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
                    VID G   T V+PV +G     A+K + I GR +   ++  L  R    +D
Sbjct: 211 ---------VIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGRDITLFIQSLL--RERGEVD 259

Query: 220 ETI-LVNNIKENCLFVSP--VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQD 276
            ++     IK+   +V P  V  F  F                T F  ++ + K+   + 
Sbjct: 260 TSLRTAERIKQEYCYVCPDIVKEFNKFDRD------------ATKFAQFIVENKEKTQK- 306

Query: 277 SQTVELKDELFSVPETFFHPEIPQ--LLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGG 334
            + V++  E F  PE FF+PEI     L P             P  +R  +  NIV +GG
Sbjct: 307 -KVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGG 364

Query: 335 NFNLPNFATRLATELQRQLPTDWTCTVHLPSGPK 368
           +    +F  RL  +L R +  +      L SG K
Sbjct: 365 STMFKDFGRRLQRDL-RSIVNNRIAQSELLSGTK 397

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/316 (21%), Positives = 122/316 (38%), Gaps = 41/316 (12%)

Query: 40  YYLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHL 99
           +Y+ N+        S     P   GQ+ +W+     W+   F       +   + +    
Sbjct: 100 FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 153

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  +  PE  + + ++ FE +  A ++   IA  A     +   S K  D+      
Sbjct: 154 LLTEPPLNPPENREQIAEIFFESFNCAGLY---IAVQAVLALAASWTSSKVTDRSLTGT- 209

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
                    VID G   T V+PV +G     A+K + I GR +   ++  L  R     D
Sbjct: 210 ---------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEAD 258

Query: 220 ETI-LVNNIKENCLFVSP--VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQD 276
            ++     IK+   +V P  V  F  F    +   ++V+ + +++               
Sbjct: 259 TSLRTAERIKQEYCYVCPDIVKEFNKFDRDGEKFAQFVVENQEST--------------R 304

Query: 277 SQTVELKDELFSVPETFFHPEIPQ--LLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGG 334
            + V++  E F  PE FF+PEI     L P             P  +R  +  NIV +GG
Sbjct: 305 KKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGG 363

Query: 335 NFNLPNFATRLATELQ 350
           +    +F  RL  +L+
Sbjct: 364 STMFKDFGRRLQRDLK 379

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 38/85 (44%), Gaps = 1/85 (1%)

Query: 325 MLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSMASFTNSPL 384
           M  NI  TGGN  +PN   R+  E    LP +    V+       L  W  MA F  S  
Sbjct: 658 MASNIFITGGNTKIPNLRERIVNEFTGFLPVNTPLNVNYAQNVS-LDAWKGMAKFARSDT 716

Query: 385 YSDARVTREEYFEHGVDWCTRHRFG 409
           YS   VT+ EY E G ++   H+ G
Sbjct: 717 YSSTCVTKVEYEEFGPNYIKEHKLG 741

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 84/216 (38%), Gaps = 30/216 (13%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY-----YLSNQIKTIKDISSVVFR 58
           PI +D GSYE++ G    +TP   F   + R K         ++ N       + S   R
Sbjct: 41  PIALDFGSYEVRAGFTSQDTPSHVFPTKIVRYKERKIQKALTFIGNDCSLDNAVRSHS-R 99

Query: 59  RPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQV 118
            P++   +T+WE    +  Y F +     G    D     ++++E   T+     N  Q+
Sbjct: 100 SPYDGSLITNWEYMEDMLSYTFHHL----GVQPNDGISNPMILTEKMATVQAQRSNWYQL 155

Query: 119 VFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTW 178
           +FE Y    +       F+ +   S   +G                   L+I+ G   T 
Sbjct: 156 LFECYGIPQVTFGIDGLFSFYANNSPDSTG-------------------LIINSGHEDTN 196

Query: 179 VVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 214
           ++PVIKG       K++D GG      LK  LS ++
Sbjct: 197 IIPVIKGKGILSEAKRIDWGGNQSIDYLKSLLSLKY 232

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 60/154 (38%), Gaps = 15/154 (9%)

Query: 270 KKPLPQDSQTVE------LKDELFSVPETFFHPEIPQLLKPG----XXXXXXXXXXXXPE 319
           + P P DS+ +       L  E   VPE  F P +    + G                P 
Sbjct: 596 RGPRPHDSENIHEQHQMHLNVERTRVPEIVFQPTMGGQDQAGICELAETILLKKFGSQPG 655

Query: 320 QLRPL---MLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSM 376
           +L      M  N+  TGGN  +P    R+  E    LP      +++ S P  L  W  M
Sbjct: 656 KLSQTSIDMANNVFITGGNAKVPGLKERIVKEFTGFLPVGTNININMSSDPS-LDAWKGM 714

Query: 377 ASFT-NSPLYSDARVTREEYFEHGVDWCTRHRFG 409
           A+   N   Y    ++R+EY E+G D+   H+ G
Sbjct: 715 AALAQNEEEYKRTIISRKEYEEYGPDYIKEHKLG 748

 Score = 37.4 bits (85), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 86/219 (39%), Gaps = 47/219 (21%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALA--RDK--------FGSYYLSNQIKTIKDIS 53
           PI +D GS +++ G  +   P   F N L   RD+         G+  L +Q   ++  S
Sbjct: 39  PIAIDFGSSKLRAGFVNQSAPTHVFPNVLTKFRDRKLNKNFTFVGNDTLLDQ--AVRSQS 96

Query: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113
              F  P     +T+W     I DY F +     G   ++     ++++E   T+     
Sbjct: 97  KSPFDGPF----VTNWNFTEEILDYTFHHL----GIVPENGISNPILLTERMATVQSQRA 148

Query: 114 NMDQVVFEEYEF--ASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVID 171
           N  Q++FE Y     +     + GF  +  PS   +G                   LVID
Sbjct: 149 NWYQILFETYNVPGVTFGIDSLYGFYNY-YPSGKQTG-------------------LVID 188

Query: 172 VGFNCTWVVPVIKGIPYYKAVKKLDIGGR----FLNGLL 206
            G   T V+P++ G       K+++ GG     +LN L+
Sbjct: 189 CGHEDTNVIPIVDGAGILTDAKRINWGGHQAVDYLNDLM 227

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 67/316 (21%), Positives = 123/316 (38%), Gaps = 41/316 (12%)

Query: 40  YYLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHL 99
           +Y+ N+        S     P   GQ+ +W+     W+   F       +   + +  + 
Sbjct: 104 FYIGNEALVAAQSPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHYF 157

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  +  PE  + + ++ FE +  A ++   IA  A     +   S K  D+      
Sbjct: 158 LLTEPPLNPPENREQVAEIFFESFNCAGLY---IAVQAVLALAASWTSSKVIDRSLTGT- 213

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
                    VID G   T V+PV +G     A+K + I GR +   ++  L  R     D
Sbjct: 214 ---------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITEFIQSLL--RERGEAD 262

Query: 220 ETI-LVNNIKENCLFVSP--VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQD 276
            ++     IK+   +V P  V  F  F  + +   ++++   + +               
Sbjct: 263 TSLRTAERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIVESQEKT--------------K 308

Query: 277 SQTVELKDELFSVPETFFHPEIPQ--LLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGG 334
            + V++  E F  PE FF+PEI     L P             P  +R  +  NIV +GG
Sbjct: 309 QKVVDVGYERFLAPEIFFNPEIASSDYLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGG 367

Query: 335 NFNLPNFATRLATELQ 350
           +    +F+ RL  +++
Sbjct: 368 STMFKDFSRRLQRDMK 383

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 73/334 (21%), Positives = 126/334 (37%), Gaps = 42/334 (12%)

Query: 40  YYLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHL 99
           +Y+ N+        S     P   GQ+ +W+     W+   F       +   + +    
Sbjct: 95  FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 148

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  +  PE  + + ++ FE +  A ++   IA  A     +   S K  D+      
Sbjct: 149 LLTEPPLNPPENREQVAEIFFESFNCAGLY---IAVQAVLALAASWTSSKVTDRSLTGT- 204

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
                    VID G   T V+PV +G     A+K + I GR +   ++  L  R     D
Sbjct: 205 ---------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEAD 253

Query: 220 ETI-LVNNIKENCLFVSP--VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQD 276
            ++     IK+   +V P  V  F  F        ++V+ + + +               
Sbjct: 254 TSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKT--------------R 299

Query: 277 SQTVELKDELFSVPETFFHPEIPQ--LLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGG 334
            + V++  E F  PE FF+PEI     L P             P  +R  +  NIV +GG
Sbjct: 300 RKAVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGG 358

Query: 335 NFNLPNFATRLATELQRQLPTDWTCTVHLPSGPK 368
           +    +F  RL  +L + +  +      L SG K
Sbjct: 359 STMFKDFGRRLQRDL-KSIVNNRIAQSELLSGTK 391

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 73/334 (21%), Positives = 126/334 (37%), Gaps = 42/334 (12%)

Query: 40  YYLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHL 99
           +Y+ N+        S     P   GQ+ +W+     W+   F       +   + +    
Sbjct: 95  FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 148

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  +  PE  + + ++ FE +  A ++   IA  A     +   S K  D+      
Sbjct: 149 LLTEPPLNPPENREQVAEIFFESFNCAGLY---IAVQAVLALAASWTSSKVTDRSLTGT- 204

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
                    VID G   T V+PV +G     A+K + I GR +   ++  L  R     D
Sbjct: 205 ---------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEAD 253

Query: 220 ETI-LVNNIKENCLFVSP--VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQD 276
            ++     IK+   +V P  V  F  F        ++V+ + + +               
Sbjct: 254 TSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKT--------------R 299

Query: 277 SQTVELKDELFSVPETFFHPEIPQ--LLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGG 334
            + V++  E F  PE FF+PEI     L P             P  +R  +  NIV +GG
Sbjct: 300 RKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGG 358

Query: 335 NFNLPNFATRLATELQRQLPTDWTCTVHLPSGPK 368
           +    +F  RL  +L + +  +      L SG K
Sbjct: 359 STMFKDFGRRLQRDL-KSIVNNRIAQSELLSGTK 391

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 70/316 (22%), Positives = 122/316 (38%), Gaps = 41/316 (12%)

Query: 40  YYLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHL 99
           +Y+ N+        S     P   GQ+ +W+     W+   F       +   + +    
Sbjct: 102 FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 155

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  +  PE  + + ++ FE +  A ++   IA  A     +   S K  D+      
Sbjct: 156 LLTEPPLNPPENRQQVAEIFFESFNCAGLY---IAVQAVLALAASWTSSKVTDRSLTGT- 211

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
                    VID G   T V+PV +G     A+K + I GR +   ++  L  R     D
Sbjct: 212 ---------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEQD 260

Query: 220 ETI-LVNNIKENCLFVSP--VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQD 276
            ++     IK+   +V P  V  F  F    +   ++++ + +       +  KK     
Sbjct: 261 ASLRTAERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFIVENKE-------RTTKK----- 308

Query: 277 SQTVELKDELFSVPETFFHPEIPQ--LLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGG 334
              V++  E F  PE FF+PEI     L P             P  +R  +  NIV +GG
Sbjct: 309 --VVDVGYERFLAPEIFFNPEIASSDFLTP-LPVVVDETIQACPIDVRKGLYNNIVLSGG 365

Query: 335 NFNLPNFATRLATELQ 350
           +    +F  RL  +L+
Sbjct: 366 STMFKDFGRRLQRDLK 381

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 73/334 (21%), Positives = 126/334 (37%), Gaps = 42/334 (12%)

Query: 40  YYLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHL 99
           +Y+ N+        S     P   GQ+ +W+     W+   F       +   + +    
Sbjct: 95  FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 148

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  +  PE  + + ++ FE +  A ++   IA  A     +   S K  D+      
Sbjct: 149 LLTEPPLNPPENREQVAEIFFESFNCAGLY---IAVQAVLALAASWTSSKVTDRSLTGT- 204

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
                    VID G   T V+PV +G     A+K + I GR +   ++  L  R     D
Sbjct: 205 ---------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEAD 253

Query: 220 ETI-LVNNIKENCLFVSP--VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQD 276
            ++     IK+   +V P  V  F  F        ++V+ + + +               
Sbjct: 254 TSLRTAEKIKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKT--------------R 299

Query: 277 SQTVELKDELFSVPETFFHPEIPQ--LLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGG 334
            + V++  E F  PE FF+PEI     L P             P  +R  +  NIV +GG
Sbjct: 300 RKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGG 358

Query: 335 NFNLPNFATRLATELQRQLPTDWTCTVHLPSGPK 368
           +    +F  RL  +L + +  +      L SG K
Sbjct: 359 STMFKDFGRRLQRDL-KSIVNNRIAQSELLSGTK 391

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 68/316 (21%), Positives = 124/316 (39%), Gaps = 41/316 (12%)

Query: 40  YYLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHL 99
           +Y+ N+        S     P   GQ+ +W+     W+   F       +   + +    
Sbjct: 106 FYIGNEALIASQGPSYSLSYPIRHGQIENWDHMERFWENSIFK------YLRAEPEDHFF 159

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  +  PE  + + ++ FE +  A ++   IA  A     +   S +  D+      
Sbjct: 160 LLTEPPLNPPENREQVAEIFFESFNCAGLY---IAVQAVLALAASWTSSQVTDRSLTGT- 215

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
                    VID G   T V+PV +G     A+K + I GR +   ++  L  R     D
Sbjct: 216 ---------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEAD 264

Query: 220 ETI-LVNNIKENCLFVSP--VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQD 276
            ++     IK+   +V P  V  F  F  + +   ++++ +         +D  K     
Sbjct: 265 TSLRTAERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIIEN---------QDKTK----- 310

Query: 277 SQTVELKDELFSVPETFFHPEIPQ--LLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGG 334
            + V++  E F  PE FF+PEI     L P             P  +R  +  NIV +GG
Sbjct: 311 QKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVRKGLYNNIVLSGG 369

Query: 335 NFNLPNFATRLATELQ 350
           +    +F+ RL  +++
Sbjct: 370 STMFKDFSRRLQRDIK 385

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 87/220 (39%), Gaps = 40/220 (18%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRPH 61
           E   +V+D GS+    G    + P     A+    +G Y    + +   + S  + R+ +
Sbjct: 13  EITAVVIDPGSFTTNIGYSGTDCPQ----AILPSCYGKYTEGEKDELFSEQSIGLPRKDY 68

Query: 62  EF------GQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNM 115
           E       G++  WE     WD+   +   F     + + G   +++E      E  K  
Sbjct: 69  EIHNIVQNGEVVDWEKAEKQWDWAIRSELRF-----ETNSGMPALLTEPIWNSEENRKKS 123

Query: 116 DQVVFEEYEFASMFKSPIAGFAPF--GRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173
            +V+ E  +F++ +  P A    F  GRP+                        LV+D+G
Sbjct: 124 LEVLLESMDFSACYLVPTATAVSFAMGRPTC-----------------------LVVDIG 160

Query: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFR 213
            + T V PV+ G+   K+  +  I G  LN L++  L+ R
Sbjct: 161 HDVTSVCPVVDGMTLSKSSMRSYIAGSLLNELIRSQLAPR 200

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 41/91 (45%), Gaps = 5/91 (5%)

Query: 321 LRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSG---PKELYGWSSMA 377
           LR  +  N+V TGG  +LP    R++ EL R LP        L SG    ++  GW   +
Sbjct: 390 LRTTLSHNVVITGGTSSLPGLMDRISAELNRSLPA--LKFRMLTSGQLRERQYQGWLGGS 447

Query: 378 SFTNSPLYSDARVTREEYFEHGVDWCTRHRF 408
              +   +    V ++EY E G D   + RF
Sbjct: 448 ILASLGTFHQLWVGKQEYAEVGADRLLKDRF 478

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 73/334 (21%), Positives = 127/334 (38%), Gaps = 42/334 (12%)

Query: 40  YYLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHL 99
           +Y+ N+        S     P   GQ+ +W+     W+   F       +   + +    
Sbjct: 97  FYIGNEALAASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 150

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  +  PE  + + ++ FE +  A ++   IA  A     +   S K  D+      
Sbjct: 151 LLTEPPLNPPENREQVAEIFFESFNCAGLY---IAVQAVLALAASWTSSKVVDRSLTGT- 206

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
                    VID G   T V+PV +G     A+K + I GR +   ++  L  R     D
Sbjct: 207 ---------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEED 255

Query: 220 ETI-LVNNIKENCLFVSP--VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQD 276
            T+     IK+   +V    V  F  F    Q   ++++ + + +               
Sbjct: 256 TTLRTAERIKQEYCYVCSDIVKEFNKFDRDPQKFAQFIVENSEKT--------------K 301

Query: 277 SQTVELKDELFSVPETFFHPEIPQ--LLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGG 334
            + +++  E F  PE FF+PEI     L P             P  +R  +  NIV +GG
Sbjct: 302 RKVIDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGG 360

Query: 335 NFNLPNFATRLATELQRQLPTDWTCTVHLPSGPK 368
           +    +F  RL  +L+  +      + HL SG K
Sbjct: 361 STMFKDFGRRLQRDLKGIVNNRIALSEHL-SGTK 393

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 69/316 (21%), Positives = 120/316 (37%), Gaps = 41/316 (12%)

Query: 40  YYLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHL 99
           +Y+ N+        S     P   GQ+ +W+     W+   F       +   + +    
Sbjct: 95  FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 148

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  +  PE  + + ++ FE +  A ++   IA  A     +   S K  D+      
Sbjct: 149 LLTEPPLNPPENREQVAEIFFESFNCAGLY---IAVQAVLALAASWTSSKVTDRSLTGT- 204

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
                    VID G   T V+PV +G     A+K + I GR +   ++  L  R     D
Sbjct: 205 ---------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEAD 253

Query: 220 ETI-LVNNIKENCLFVSP--VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQD 276
            ++     IK+   +V P  V  F  F        ++V+ + + +               
Sbjct: 254 TSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKT--------------R 299

Query: 277 SQTVELKDELFSVPETFFHPEIPQ--LLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGG 334
            + V++  E F  PE FF+PEI     L P             P  +R  +  NIV +GG
Sbjct: 300 RKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPMVVDQTIQACPIDVRKGLYNNIVLSGG 358

Query: 335 NFNLPNFATRLATELQ 350
           +    +F  RL  +L+
Sbjct: 359 STMFKDFGRRLQRDLK 374

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 83/220 (37%), Gaps = 36/220 (16%)

Query: 2   ESPPIVVDNGSYEIKFG-----TPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVV 56
           E   +V+D GSY    G     +P +  P         +K G    ++Q   +       
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQINIPSSYGQYTGGEKEGKKSFNDQFMGMAR-PDFE 71

Query: 57  FRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMD 116
            +R  E G +  WE     W +   +  +F  F     KG    ++E      E  K   
Sbjct: 72  IKRILEDGCVVDWEAAQEQWTWAIRDELKFGSF-----KGTPAFLTEAIWNSEENRKKSL 126

Query: 117 QVVFEEYEFASMFKSPIAGFAPF--GRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGF 174
           +V+ E  EF + + +P A    F  GRP+                        LV+D+G 
Sbjct: 127 EVLLEGMEFEACYIAPTATCVSFAMGRPTC-----------------------LVVDIGH 163

Query: 175 NCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 214
           +   V PV+ G+   K+  +  + G+ LN L+++ L  R 
Sbjct: 164 DVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIEKHLEPRE 203

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 5/91 (5%)

Query: 321 LRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT---DWTCTVHLPSGPKELYGWSSMA 377
           LR  +  N+V TGG+ ++   A RL TEL ++LP        + HL    ++   W   +
Sbjct: 392 LRATLAHNLVVTGGSSSILGLADRLMTELNKKLPALKFRILTSGHLRE--RQSRAWLGGS 449

Query: 378 SFTNSPLYSDARVTREEYFEHGVDWCTRHRF 408
             ++   +    V R+EY E G +   + RF
Sbjct: 450 ILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 68/316 (21%), Positives = 121/316 (38%), Gaps = 41/316 (12%)

Query: 40  YYLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHL 99
           +Y+ N+        S     P   GQ+ +W+     W+   F       +   + +    
Sbjct: 108 FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 161

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  +  PE  + + ++ FE +  A ++   IA  A     +   S K  D+      
Sbjct: 162 LLTEPPLNPPENREQIAEIFFESFNCAGLY---IAVQAVLALAASWTSSKVTDRSLTGT- 217

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
                    VID G   T V+PV +G     A+K + I GR +   ++  L  R    +D
Sbjct: 218 ---------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVD 266

Query: 220 ETI-LVNNIKENCLFVSP--VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQD 276
            ++     IK+   +V P  V  F  F        ++++ + + +               
Sbjct: 267 TSLKTAERIKQEYCYVCPDIVKEFNKFDRDGSKFAQFIVENQEQT--------------R 312

Query: 277 SQTVELKDELFSVPETFFHPEIPQ--LLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGG 334
            + V++  E F  PE FF+PEI     L P             P  +R  +  NIV +GG
Sbjct: 313 KKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVRKGLYNNIVLSGG 371

Query: 335 NFNLPNFATRLATELQ 350
           +    +F  RL  +L+
Sbjct: 372 STMFKDFGRRLQRDLK 387

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 2/86 (2%)

Query: 325 MLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSMASFTNSPL 384
           M  N+  TGG+  LP   TR+  E    LP D   +V++   P  L  W  MA F++   
Sbjct: 665 MAKNVWITGGHAQLPGLKTRIVKEFTSFLPNDAKFSVNISKHPS-LDAWKGMAKFSSDDA 723

Query: 385 -YSDARVTREEYFEHGVDWCTRHRFG 409
            +  + ++++EY E+G ++   HR G
Sbjct: 724 DFKSSLISKKEYEEYGPEYIKEHRLG 749

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 47/219 (21%), Positives = 87/219 (39%), Gaps = 32/219 (14%)

Query: 3   SPPIVVDNGSYEIKFGTPDLETPHRAFNALAR-DKFGSYYLSNQIKTIKDISSVVF---- 57
           S PI +D G+  +K G  +   P  AFN   R  +F    +S  +  I + +++ +    
Sbjct: 37  SIPIAIDFGTCSVKAGYVNKADP--AFNFPTRLTRFRDRKMSRTMTFIGNDTNLDYAVRS 94

Query: 58  --RRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNM 115
             + P +   +T+WE    I +Y F    +  G          L+++E   T+     N 
Sbjct: 95  QSKTPFDGPFVTNWEYAEDILEYTF----KHLGVTANHGISNPLIMTEKLATLQSQRANW 150

Query: 116 DQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFN 175
            Q++FE +  +++       FA +       SG                   LV  +   
Sbjct: 151 YQLLFETFNTSNVSFGIDNVFAFYANTDKHSSG-------------------LVFGLNNQ 191

Query: 176 CTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 214
            T V+P+I G P     K+++ GG    G L + ++ ++
Sbjct: 192 DTNVIPIIDGKPVLTDTKRINWGGSQSVGYLSDLMTLKY 230

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 82/220 (37%), Gaps = 36/220 (16%)

Query: 2   ESPPIVVDNGSYEIKFG-----TPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVV 56
           E   +V+D GSY    G     +P L  P       A  K G    ++Q   I       
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQLNIPSCYGQYTAGGKEGQKSFNDQF-MIMPRPDFE 71

Query: 57  FRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMD 116
            +R  E G +  WE     W +   +  +F  F     KG    ++E      E  K   
Sbjct: 72  IKRILENGCVVDWEAAQEQWAWAIRDELKFESF-----KGTPAFLTEAIWNPEENRKKSL 126

Query: 117 QVVFEEYEFASMFKSPIAGFAPF--GRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGF 174
           +V+ E  EF + + +P A    F  GRP+                        LV+D+G 
Sbjct: 127 EVLLEGMEFEACYIAPTATCTSFAMGRPTC-----------------------LVLDIGH 163

Query: 175 NCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 214
           +   V PV+ G+   K+  +  + G+ LN L++  L  R 
Sbjct: 164 DVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIENHLKPRE 203

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 5/91 (5%)

Query: 321 LRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT---DWTCTVHLPSGPKELYGWSSMA 377
           LR  +  N+V TGG+ ++P    RL TEL ++LP        + HL    ++   W   +
Sbjct: 392 LRATLAHNLVVTGGSSSIPGLTDRLMTELNKKLPALKFRILTSGHLRE--RQSRAWLGGS 449

Query: 378 SFTNSPLYSDARVTREEYFEHGVDWCTRHRF 408
             ++   +    V R+EY E G +   + RF
Sbjct: 450 ILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 74/334 (22%), Positives = 127/334 (38%), Gaps = 42/334 (12%)

Query: 40  YYLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHL 99
           +Y+ N+        S     P   GQ+ +W+     W+   F       +   + +    
Sbjct: 95  FYIGNEALAAAQGPSYSLSYPIRHGQIENWDHMERFWENSIFK------YLRTEPEDHFF 148

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  +  PE  + + ++ FE +  A ++   IA  A     +   S K  D+      
Sbjct: 149 LLTEPPLNPPENREQVAEIFFESFNCAGLY---IAVQAVLALAASWTSSKVTDRSLTGT- 204

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
                    VID G   T V+PV +G     A+K + I GR +   ++  L  R     D
Sbjct: 205 ---------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGETD 253

Query: 220 ETI-LVNNIKENCLFVSP--VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQD 276
            ++     IK+   +V P  V  F  F        ++++ + +       K  KK     
Sbjct: 254 TSLRTAERIKQEYCYVCPDIVKEFNKFDRNPDKFAQFIVENQE-------KTQKK----- 301

Query: 277 SQTVELKDELFSVPETFFHPEIPQ--LLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGG 334
              V++  E F  PE FF+PEI     L P             P  +R  +  NIV +GG
Sbjct: 302 --IVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYNNIVLSGG 358

Query: 335 NFNLPNFATRLATELQRQLPTDWTCTVHLPSGPK 368
           +    +F  RL  ++ + +  +      L SG K
Sbjct: 359 STMFKDFGRRLQRDI-KSIVNNRIAQSELLSGTK 391

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 63/154 (40%), Gaps = 15/154 (9%)

Query: 270 KKPLPQDSQ------TVELKDELFSVPETFFHPEIPQLLKPGXXXXXXX----XXXXXPE 319
           + P P DS+       + +  E   VPE  F P I    + G                P 
Sbjct: 601 RGPRPHDSEDPHQQHQIHMNVERIRVPEVMFQPSIGGCDQAGISELSETLFLRKFNSSPR 660

Query: 320 QLRPL---MLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSM 376
           +L  +   ML N+  TGG+  LP    R+  E    LP     ++++ + P  L  W  M
Sbjct: 661 KLSSISERMLNNVWLTGGHAKLPGLKERIVKEYTEFLPVGTKMSINISNDPS-LDTWKGM 719

Query: 377 ASF-TNSPLYSDARVTREEYFEHGVDWCTRHRFG 409
           A   +N+      +VT+++Y E+G ++   H  G
Sbjct: 720 AKLASNTDYLKKIQVTKKDYEEYGPEYMMEHNLG 753

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 108/254 (42%), Gaps = 40/254 (15%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDISS------VVF 57
           PI +D GSY +K G  +   P   F N L R  +    L+  +  I + ++      +  
Sbjct: 38  PIAIDFGSYNVKAGYTNQSLPTHVFTNKLTR--YRDRKLAKTMTFIGNDTNLDQPLRIQA 95

Query: 58  RRPHEFGQLTSWELESAIWDYCF--FNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNM 115
           +RP++   + +WE    I+DY          NG     S    ++++E    +     N 
Sbjct: 96  KRPYDGLFIANWEYAEEIFDYTLHHLGVQTTNG-----SISNPIILTEKMACLQSQRANW 150

Query: 116 DQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFN 175
            Q++FE ++  S         A FG  S+          N  A P  +E   LVI+ G  
Sbjct: 151 YQLLFETFDVPS---------ATFGLDSLYAFY------NNCANP--FESDGLVINCGHE 193

Query: 176 CTWVVPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETILVNNIKENC 231
            T +VP+++G       K+++ GGR    +L+ LL  TL + ++           + E+ 
Sbjct: 194 DTNIVPIVQGKGILTEAKRINWGGRHSTEYLSSLL--TLKYPYFPTKLSEFQYQTMYEDF 251

Query: 232 LFVSPVSYFESFKH 245
            +VSP +Y E  K+
Sbjct: 252 CYVSP-NYNEDIKN 264

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 71/316 (22%), Positives = 121/316 (38%), Gaps = 41/316 (12%)

Query: 40  YYLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHL 99
           +Y+ N+        S     P   GQ+ +W+     W+   F       +   + +    
Sbjct: 100 FYIGNEALAAAQGQSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 153

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  +  PE  + + ++ FE +  A ++   IA  A     +   S K  D+      
Sbjct: 154 LLTEPPLNPPENREQVAEIFFESFNCAGLY---IAVQAVLALAASWTSPKVTDRSLTGT- 209

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
                    VID G   T V+PV +G     A+K + I GR +   +++ L  R     D
Sbjct: 210 ---------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEQD 258

Query: 220 ETI-LVNNIKENCLFVSP--VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQD 276
            ++     IK+   +V P  V  F  F        ++V+   +       K  KK     
Sbjct: 259 TSLKTAERIKQEYCYVCPDIVKEFNKFDRDASKFAQFVVESQE-------KTRKK----- 306

Query: 277 SQTVELKDELFSVPETFFHPEIPQ--LLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGG 334
              V++  E F  PE FF+PEI     L P             P  +R  +  NIV +GG
Sbjct: 307 --IVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDETIQACPIDVRKGLYNNIVLSGG 363

Query: 335 NFNLPNFATRLATELQ 350
           +    +F  RL  +++
Sbjct: 364 STMFKDFGRRLQRDMK 379

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 68/319 (21%), Positives = 123/319 (38%), Gaps = 47/319 (14%)

Query: 40  YYLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHL 99
           +Y+ N+        +     P   GQ+ +W+     W+   F       +   + +    
Sbjct: 104 FYIGNEALVASQGPAYSLSYPIRHGQVENWDHMERFWENSIFK------YLRAEPEDHFF 157

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  +  PE  + + ++ FE +  A ++   IA  A     +   S +  D+      
Sbjct: 158 LLTEPPLNPPENREQVAEIFFESFNCAGLY---IAVQAVLALAASWTSAQVTDRSLTGT- 213

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
                    VID G   T V+PV +G     A+K + I GR +   ++  L  R     D
Sbjct: 214 ---------VIDSGDGVTHVIPVAEGYVVGSAIKNIPIAGRDITLFIQSLL--RERGEAD 262

Query: 220 ETI-LVNNIKENCLFVSP--VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQD 276
            ++     IK+   +V P  V  F  F  + +   ++++ +                 QD
Sbjct: 263 SSLKTAERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIIEN-----------------QD 305

Query: 277 SQTVELKD---ELFSVPETFFHPEIPQ--LLKPGXXXXXXXXXXXXPEQLRPLMLGNIVC 331
             T ++ D   E F  PE FF+PEI     L P             P  +R  +  NIV 
Sbjct: 306 KTTKKVIDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVL 364

Query: 332 TGGNFNLPNFATRLATELQ 350
           +GG+    +F+ RL  +++
Sbjct: 365 SGGSTMFKDFSRRLQRDVK 383

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 71/334 (21%), Positives = 128/334 (38%), Gaps = 42/334 (12%)

Query: 40  YYLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHL 99
           +Y+ ++        S     P   GQ+ +W+     W+   F       +   + +  + 
Sbjct: 91  FYIGDEAIAASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHYF 144

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  +  PE  + + ++ FE +  A ++   IA  A     +   S K  D+      
Sbjct: 145 LLTEPPLNPPENREQVAEIFFESFNCAGLY---IAVQAVLALAASWTSSKVVDRSLTGT- 200

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
                    VID G   T V+PV +G     A+K + I GR +   ++  L  R     D
Sbjct: 201 ---------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEED 249

Query: 220 ETI-LVNNIKENCLFVSP--VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQD 276
            T+     IK+   +V    V  F  F    +   ++++ + + +               
Sbjct: 250 TTLRTAERIKQEYCYVCSDIVKEFNKFDRDSEKFAQFIVENSEKT--------------R 295

Query: 277 SQTVELKDELFSVPETFFHPEIPQ--LLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGG 334
            + +++  E F  PE FF+PEI     L P             P  +R  +  NIV +GG
Sbjct: 296 RKVIDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGG 354

Query: 335 NFNLPNFATRLATELQRQLPTDWTCTVHLPSGPK 368
           +    +F  RL  +L+  +      + HL SG K
Sbjct: 355 STMFKDFGRRLQRDLKGIVNNRIALSEHL-SGTK 387

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 69/316 (21%), Positives = 121/316 (38%), Gaps = 41/316 (12%)

Query: 40  YYLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHL 99
           +Y+ N+        S     P   GQ+ +W+     W+   F       +   + +    
Sbjct: 107 FYIGNEALIAAQGPSYGLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHCF 160

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E  +  PE  + + ++ FE +  A ++   IA  A     +   S K  D+      
Sbjct: 161 LLTEPPLNPPENREQVAEIFFESFNCAGLY---IAVQAVLALAASWTSSKVIDRSLTGT- 216

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219
                    VID G   T V+PV +G     A+K + I GR +   +++ L  R     D
Sbjct: 217 ---------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEED 265

Query: 220 ETI-LVNNIKENCLFVSP--VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQD 276
            ++     IK+   +V P  V  F  F    +   ++V+   + +               
Sbjct: 266 TSLRTAERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFVVESQEKT--------------R 311

Query: 277 SQTVELKDELFSVPETFFHPEIPQ--LLKPGXXXXXXXXXXXXPEQLRPLMLGNIVCTGG 334
            + V++  E F  PE FF+PEI     L P             P  +R  +  NIV +GG
Sbjct: 312 RKVVDVGCERFMAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYNNIVLSGG 370

Query: 335 NFNLPNFATRLATELQ 350
           +    +F  RL  +L+
Sbjct: 371 STMFKDFGRRLQRDLK 386

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 59/154 (38%), Gaps = 15/154 (9%)

Query: 270 KKPLPQDSQTVE------LKDELFSVPETFFHPEIPQLLKPGXXXXXXXXXX----XXPE 319
           + P P DS+ +       L  E   VPE  F P I    + G                P 
Sbjct: 593 RGPRPHDSENIHEQHQLHLNVERIRVPEILFQPIIGGQDQAGISELCETILSNKFGSKPR 652

Query: 320 QLRPLMLG---NIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSM 376
           +L    LG   NI  TGG+  LP    R+  E    LP      V +   P  L  W  M
Sbjct: 653 ELSETSLGMAKNIWLTGGHSKLPGLRERIVKEFTGFLPVGTKLGVKMSKNPS-LDAWYGM 711

Query: 377 ASFT-NSPLYSDARVTREEYFEHGVDWCTRHRFG 409
                N   Y D+ +++++Y E+G ++   H+ G
Sbjct: 712 RKLAQNEADYKDSIISKKDYEEYGAEYIKEHKLG 745

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 46/216 (21%), Positives = 84/216 (38%), Gaps = 30/216 (13%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY-----YLSNQIKTIKDISSVVFR 58
           PI +D GSYE++ G      P   F N L R +         ++ N +   + + S   +
Sbjct: 38  PIAIDFGSYEVRAGYTSSSIPSHIFPNKLTRHRDRKLSKTFTFIGNDVLLDQTVRSQS-K 96

Query: 59  RPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQV 118
            P +   + +W+    I  Y F +     G    +S    L+++E   ++    KN  ++
Sbjct: 97  SPFDGSFIANWDYVEDIMQYTFNHL----GVVGDNSVRNPLIINEPLGSLQSQRKNWYEL 152

Query: 119 VFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTW 178
           +FE       F  P   F   G      + +G+                +VI+     T 
Sbjct: 153 LFE------CFHLPNVSFGIDGMFGFYANNEGNQDG-------------IVINCSNEETD 193

Query: 179 VVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 214
           V+PV+ G       K+++ GGR     L + +S ++
Sbjct: 194 VIPVVDGRGVLTDAKRINWGGRQAVDYLSDLMSLKY 229

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 58/154 (37%), Gaps = 15/154 (9%)

Query: 270 KKPLPQDSQTVE------LKDELFSVPETFFHPEIPQLLKPGXXXXXXXXXX----XXPE 319
           + P P DS+ +       +  E   VPE  F P +    + G                P 
Sbjct: 596 RGPRPHDSENIHEQHQMHINVERIRVPEVMFQPILGGQDQAGITEICETIITKKFGSTPR 655

Query: 320 QLRPL---MLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSM 376
            L      M  N+   GGN  +P   +R+  E    LP+D    V++   P  L  W+ M
Sbjct: 656 NLSQQSLDMAKNVWLVGGNAQVPGLKSRVVKEFTEFLPSDTKINVNISEAPT-LDVWNGM 714

Query: 377 ASFTNSPL-YSDARVTREEYFEHGVDWCTRHRFG 409
               N+   Y    VT EEY E GVD+   H+  
Sbjct: 715 YRLANTEEDYQRTIVTSEEYDECGVDYLKEHKLS 748

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 44/211 (20%), Positives = 84/211 (39%), Gaps = 32/211 (15%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALA--RDKFGSYYLS--NQIKTIKDISSVVFRR 59
           PI +D GSYE++ G  ++  P   F N  +  RD+  + YL        +   +    R 
Sbjct: 42  PIAIDFGSYELRAGYTNISRPSHIFPNRFSKYRDRKTNKYLPCIGYDTWLDQTTRSQARS 101

Query: 60  PHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVV 119
           P +   + +W++   I  Y F +     G    +     ++++E    +     N  Q +
Sbjct: 102 PFDGPLVVNWDMVEDILQYTFHHL----GVQPDNGVTNPIIINEKLACLQSQRSNWYQTL 157

Query: 120 FEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWV 179
           FE +    +  +     A +G    + +G                   +VID G+  T V
Sbjct: 158 FESFGVPKVSMAVEGMLAFYGHNGGSSTG-------------------IVIDCGYEDTNV 198

Query: 180 VPVIKGIPYYKAVKKLDIGGR----FLNGLL 206
           +P+++G       K+++ GG     +L+ LL
Sbjct: 199 IPIVEGQGMMLDAKRINWGGHSSIDYLSNLL 229

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 45/216 (20%), Positives = 83/216 (38%), Gaps = 37/216 (17%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSV-VFRRP 60
           E   +V+D GSY    G    + P     ++    +G Y      K I    S+ + R+ 
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGKKNIFSEQSIGIPRKD 68

Query: 61  HEF------GQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKN 114
           +E       G +  W+     W +   N        L  + G   +++E      E  K 
Sbjct: 69  YELKPIVKDGLVIDWDTAQEQWQWALKNE-----LYLNSNSGTPALLTEPVWNSTENRKK 123

Query: 115 MDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGF 174
             +V+ E  +F + + +P +    F                      A  P  LV+D+G 
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFA---------------------AGRPNCLVVDIGH 162

Query: 175 NCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETL 210
           +   V P++ G+   K+ ++  + G+F+N L+K+ L
Sbjct: 163 DTCSVSPIVDGMTLSKSTRRNFLAGKFINHLIKKAL 198

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 1/89 (1%)

Query: 321 LRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT-DWTCTVHLPSGPKELYGWSSMASF 379
           LR  +  N+V TGG   +P  + RL TEL + LP+  +       +  ++   W   +  
Sbjct: 400 LRATLAHNVVLTGGTSLIPGLSDRLMTELNKILPSLKFRILTTGHTMERQYQSWLGGSIL 459

Query: 380 TNSPLYSDARVTREEYFEHGVDWCTRHRF 408
           T+   +    V ++EY E GV+     RF
Sbjct: 460 TSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 46/216 (21%), Positives = 83/216 (38%), Gaps = 37/216 (17%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSV-VFRRP 60
           E   +V+D GSY    G    + P     ++    +G Y      K I    S+ + R+ 
Sbjct: 13  EVSAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGNKKIFSEQSIGIPRKD 68

Query: 61  HEF------GQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKN 114
           +E       G +  W+     W +   N        L  + G   +++E      E  K 
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALQNE-----LYLNSNSGIPALLTEPVWNSTENRKK 123

Query: 115 MDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGF 174
             +V+ E  +F + + +P +    F                      A  P  LV+D+G 
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFA---------------------AGRPNCLVVDIGH 162

Query: 175 NCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETL 210
           +   V P++ G+   K+ ++  I G+F+N L+K+ L
Sbjct: 163 DTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAL 198

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 1/89 (1%)

Query: 321 LRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT-DWTCTVHLPSGPKELYGWSSMASF 379
           LR  +  N+V TGG  ++P  + RL TEL + LP+  +       +  ++   W   +  
Sbjct: 400 LRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTGHTIERQYQSWLGGSIL 459

Query: 380 TNSPLYSDARVTREEYFEHGVDWCTRHRF 408
           T+   +    V ++EY E GV+     RF
Sbjct: 460 TSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/235 (19%), Positives = 90/235 (38%), Gaps = 52/235 (22%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISS--VVFRR 59
           E   +V+D GSY    G    + PH    ++   ++GS+  +N+    +D  S     +R
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDCPH----SILPSRYGSFKKTNKDSGDEDTKSDESATKR 68

Query: 60  PHEF--------------------GQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHL 99
            H F                    G +T W+     W++   N        L+ +KG   
Sbjct: 69  AHIFSEQSLGLPRKDYEIKTIVENGAVTDWDAAQEQWEWALKNE-----LFLESTKGIPA 123

Query: 100 VVSETCMTIPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE 159
           +++E      +  K   + + E   F + + +P +    F       +G+ +        
Sbjct: 124 LLTEPVWNTKKNRKKSLETLLESMNFEACYLAPTSTCVSFA------TGRAN-------- 169

Query: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 214
                   LV+D+G +   V PV+ G+   K+ ++    G+++N L++  L  R 
Sbjct: 170 -------CLVVDIGHDTCSVSPVVDGMTLSKSTRRSFFAGKYINHLIENFLKPRE 217

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 36/89 (40%), Gaps = 1/89 (1%)

Query: 321 LRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT-DWTCTVHLPSGPKELYGWSSMASF 379
           LR  +  N+  TGG   +P  + RL  EL  +LP   +          +E   W   +  
Sbjct: 416 LRASLAHNVQLTGGTSLIPGLSDRLMLELNARLPALKFRILTTGHKKEREYQSWLGGSVL 475

Query: 380 TNSPLYSDARVTREEYFEHGVDWCTRHRF 408
           T+   +    V R+EY E G D     RF
Sbjct: 476 TSLGTFHQLWVGRQEYEEVGADRLLNDRF 504

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 59/155 (38%), Gaps = 17/155 (10%)

Query: 270 KKPLPQDSQTVE------LKDELFSVPETFFHPE--------IPQLLKPGXXXXXXXXXX 315
           + P P D +++       +  E   VPE  F P         IP+L +            
Sbjct: 590 RGPRPHDGESIHHQHQMHMNIERIRVPEVLFQPNMGGEDQAGIPELCETLLLRKFGSTQR 649

Query: 316 XXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSS 375
              + +   M  N+  TGGN  LP    R+  E    LP+    ++     P  L  W  
Sbjct: 650 QLSD-VSTSMAQNVWITGGNAKLPGLRERIVKEFSEFLPSGSPFSIRKSQDPS-LDAWRG 707

Query: 376 MASFT-NSPLYSDARVTREEYFEHGVDWCTRHRFG 409
           MA    N+  +    +T++EY E+G ++   H  G
Sbjct: 708 MAKLAQNTEDFKHGYITKQEYLEYGPEYIKEHNLG 742

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/216 (20%), Positives = 83/216 (38%), Gaps = 37/216 (17%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSV-VFRRP 60
           E   +V+D GSY    G    + P     ++    +G        KTI    S+ + R+ 
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKSTSDKDSKTIFSEQSIGIPRKD 68

Query: 61  HEF------GQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKN 114
           +E       G +  W+     W +   N        L  + G   +++E      E  K 
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALKNE-----LYLDSNSGIPALLTEPVWNSTENRKK 123

Query: 115 MDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGF 174
             +V+ E  +F + + +P +    F                      A  P  LV+D+G 
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFA---------------------AGRPNCLVVDIGH 162

Query: 175 NCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETL 210
           +   V P++ G+   K+ ++  I G+F+N L+K+ +
Sbjct: 163 DTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAI 198

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 1/89 (1%)

Query: 321 LRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT-DWTCTVHLPSGPKELYGWSSMASF 379
           LR  +  N+V TGG  ++P  + RL TEL + LP+  +       +  ++   W   +  
Sbjct: 400 LRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTGHTRERQYQSWLGGSIL 459

Query: 380 TNSPLYSDARVTREEYFEHGVDWCTRHRF 408
           T+   +    V ++EY E GVD     RF
Sbjct: 460 TSLGTFHQLWVGKQEYEEVGVDRLLNDRF 488

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/219 (21%), Positives = 84/219 (38%), Gaps = 43/219 (19%)

Query: 6   IVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRPH---- 61
           IV+D GS+    G    + P     ++    +G+       K I +   ++F R      
Sbjct: 17  IVIDPGSFVTNIGYSGTDCPQ----SIMPSSYGNVETDGDTKRIFNEQPLLFPRAGMEIK 72

Query: 62  ---EFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQV 118
              E   +  W+     W+Y   N D       + +KG  ++++E         K   ++
Sbjct: 73  PIVENSTIVDWDRAQEQWEYAL-NTD----LKFESNKGTPVLLTEPIWNSEASRKKSLEI 127

Query: 119 VFEEYEFASMF---KSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFN 175
           + E  EF + +    S    FA  GRP+                        LV+D+G +
Sbjct: 128 LLESMEFEACYLAANSSAVSFA-MGRPTC-----------------------LVVDIGHD 163

Query: 176 CTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 214
            + V PVI G+   K+  +  + G++LN L+ + L  R 
Sbjct: 164 VSTVSPVIDGMTLSKSSTRNYVAGKYLNHLIAKNLKPRE 202

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 5/91 (5%)

Query: 321 LRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT---DWTCTVHLPSGPKELYGWSSMA 377
           LR  +  N+V TGG   +P  + R+  EL + LP        + HL    ++  GW   +
Sbjct: 431 LRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKFRMLSSGHLRE--RQYQGWLGGS 488

Query: 378 SFTNSPLYSDARVTREEYFEHGVDWCTRHRF 408
              +   +    V REEY E G +   + RF
Sbjct: 489 ILASLGTFHQLWVGREEYEEVGPERLLKDRF 519

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/222 (21%), Positives = 89/222 (40%), Gaps = 41/222 (18%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVF-RRP 60
           E   I++D GS+    G    + P     A+    +G Y    +  ++ +  S+   R+ 
Sbjct: 13  EITAIIIDPGSFNTNIGYSGTDCPQ----AILPSCYGQYINDEEKPSLFNEQSIGLPRKD 68

Query: 61  HEF------GQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKN 114
           +E       G++  W+     W++   +   F     + +KG   +++E      +  K 
Sbjct: 69  YEIKEIVRSGEVVDWDKAQEQWEWAIKSVLLF-----ESNKGLPALLTEPIWNSEDNRKK 123

Query: 115 MDQVVFEEYEFASMFKSPIAGFAPF--GRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDV 172
             +V+ E  +F + + +P A    F  GRP+                        LV+D+
Sbjct: 124 SLEVLLEGMDFEACYLTPTATAVSFAMGRPTC-----------------------LVVDI 160

Query: 173 GFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 214
           G + T V PVI G+   K+  +  I G  LN L++ +L  R 
Sbjct: 161 GHDITSVSPVIDGMTLSKSSMRSFIAGGLLNELIRTSLKPRE 202

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 39/89 (43%), Gaps = 1/89 (1%)

Query: 321 LRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT-DWTCTVHLPSGPKELYGWSSMASF 379
           LR  +  N+V TGG+ ++P    R+  EL + LP   +       +  K+   W   +  
Sbjct: 391 LRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPALKFRMLTSGQAREKQYQSWLGGSIL 450

Query: 380 TNSPLYSDARVTREEYFEHGVDWCTRHRF 408
            +   +    V ++EY E G D   + RF
Sbjct: 451 ASLGTFHQLWVGKQEYAEVGADRLLKDRF 479

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/230 (20%), Positives = 84/230 (36%), Gaps = 45/230 (19%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETP-----------HRAFNALARDKFGSYYLSNQIKTIK 50
           E   +++D GSY    G    + P           H A  + + D       + ++ + +
Sbjct: 13  EITAVIIDPGSYTTNIGYAGTDCPQSILPSSFGEIHEAEESTSEDNTEKTRKTRKVFSEQ 72

Query: 51  DIS----SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCM 106
            I         +R  E GQ+  W+     W +   N        ++ ++G   +++E   
Sbjct: 73  SIPIPRPDYEVKRVVENGQVCDWDSAVEQWSWALRNE-----LHIESNRGIPAMLTEPLW 127

Query: 107 TIPELSKNMDQVVFEEYEFASMFKSPIAGFAPF--GRPSIAISGKGDDQPNRKAEPDAYE 164
              E      +++ E  EF + + +  +    F  GRP+                     
Sbjct: 128 NSKENRSKSLEILLEGMEFEACYLTATSTAVSFATGRPN--------------------- 166

Query: 165 PFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 214
              L++D+G +   V PVI G+   K+ +     GRFLN LL + L  R 
Sbjct: 167 --SLIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPRE 214

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 63/157 (40%), Gaps = 26/157 (16%)

Query: 58  RRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQ 117
           +R  E G +  W++    W +        + F     KG   +++E      +  K   +
Sbjct: 162 KRIIENGMVADWDIAEEQWSWALREKLYMDSF-----KGIPALLTEPVWNTVQNRKKSLE 216

Query: 118 VVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCT 177
           V+ E+ EF + + + I     F                      A +P  LV+DVG +  
Sbjct: 217 VLLEKMEFEACYLTTIPTNVSFA---------------------AGKPNCLVVDVGHDTC 255

Query: 178 WVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 214
            V PVI G+   K+V++    GR+LN LL+  +  R 
Sbjct: 256 SVSPVIDGMTLTKSVRRNFFAGRYLNRLLENYIKPRE 292

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 64/166 (38%), Gaps = 13/166 (7%)

Query: 246 KEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETFFHPEIPQLLKPG 305
           KE TA   + P    +    + +  K   +D + V+       VP+     +I  ++ PG
Sbjct: 440 KEHTADAILAPTNADTPSENINENGKRSIEDGENVD-------VPKKSDKKDIDNII-PG 491

Query: 306 XXXXXXXXXXXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPS 365
                          LR  +  N++ TGG   +P  A RL  EL ++LP        L S
Sbjct: 492 IADLVEATVNSSDVDLRATLAHNVILTGGTSLIPGLADRLMYELNKKLPA--LKFRILSS 549

Query: 366 G---PKELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRF 408
           G    ++   W   +  T+   +    V + EY E G D   + RF
Sbjct: 550 GHRRERKYQAWLGGSILTSLGTFHQLWVGKREYEEVGPDRLLKDRF 595

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 94/448 (20%), Positives = 158/448 (35%), Gaps = 101/448 (22%)

Query: 6   IVVDNGSYEIKFGTPDLETPHRAFNALARDK-----FGSYYLSNQIKTIKDISSVVFRRP 60
           +V+ NGS     G  ++E P    ++    K     FG++ + ++ ++ ++    V+   
Sbjct: 7   VVIHNGSSSTVAGFSNMELPQSIISSSYVQKGNERVFGTFAMLDECESKEECE--VYTIM 64

Query: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLK-DSKGQHLVVSETCMTIPELSKNMDQVV 119
            + G   +WE   A W Y +        ++LK D +   LV+S     +P     +D  V
Sbjct: 65  DKNGMPYNWEALEAQWRYLY-------EYELKVDPQELPLVIS-----VPATHSEIDPQV 112

Query: 120 FEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWV 179
            E Y   ++ K  +        P       G                 LVIDVG   T V
Sbjct: 113 VENYFDLALNKLQVPALQIVVEPLAVALAMGKSSA-------------LVIDVGARGTTV 159

Query: 180 VPVIKGIPYYKAVKKLDIGGRFLN----GLLKETL-SFRHYNVMDETILVNNIKENCLFV 234
            P++ G      V K   GG FL+     LL+E L S  H    +    +   K   L V
Sbjct: 160 TPIVDGTVVRSGVMKSRFGGDFLDYQVAKLLEEPLGSSSHEAWYNSATWIREFKSTMLQV 219

Query: 235 SP--VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKP-----LPQDSQTV--ELKDE 285
               +S  E +   +    +        ++  Y+ +P        L ++++TV  EL+D 
Sbjct: 220 CDKNLSELERYHRDQLLLQQQQQQQLGGAYHNYMTNPLTQKRNFLLKKNNKTVTLELRD- 278

Query: 286 LFSVPETFFHPEIP-----------QLLK---------------PGXXXXXXXXXXXXPE 319
            + V E  F P++            +LL                PG              
Sbjct: 279 CYRVCEYLFQPQLASPDYASRDGLGELLSRSIKKAAASVSAQGTPGGGQGASLVYNRHQP 338

Query: 320 QLRP--------------------LMLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTC 359
           QL+P                     +L N+V TG    +  F  R+ +EL  + P +   
Sbjct: 339 QLQPEQPSTTTTTASSATTEQVYAQLLTNVVITGSTSLVAGFEPRIVSELAVRFPQNKLA 398

Query: 360 T----VHLPSGPKELYGWSSMASFTNSP 383
           T    +HL    + + GW +M +    P
Sbjct: 399 TYANQIHL---DRAVQGWIAMGAMAALP 423

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/219 (20%), Positives = 82/219 (37%), Gaps = 43/219 (19%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHR----AFNALARDKFGSYYLSNQIKTIKDISSVVF 57
           E   +V+D GSY    G    + P       +  L  D+       N  K   + S  + 
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGKLTADE-------NSKKMFSEQSIGIP 65

Query: 58  RRPHEF------GQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPEL 111
           R+ +E       G +  W+     W +   N        L  + G   +++E      E 
Sbjct: 66  RKDYELKPIIENGLVIDWDTAQEQWQWALRNE-----LYLDSNSGIPALLTEPVWNSMEN 120

Query: 112 SKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVID 171
            K   +V+ E  +F + + +P +    F                      A  P  LV+D
Sbjct: 121 RKKSLEVLLEGMQFEACYLAPTSTCVSFA---------------------AGRPNCLVVD 159

Query: 172 VGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETL 210
           +G +   V P++ G+   K+ ++  I G+F+N L+++ L
Sbjct: 160 IGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIQKAL 198

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 5/91 (5%)

Query: 321 LRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT---DWTCTVHLPSGPKELYGWSSMA 377
           LR  +  N+V TGG  ++P  + RL TEL + LP+       T H+    ++   W   +
Sbjct: 399 LRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTGHIRE--RQYQSWLGGS 456

Query: 378 SFTNSPLYSDARVTREEYFEHGVDWCTRHRF 408
             T+   +    V ++EY E G++     RF
Sbjct: 457 ILTSLGTFHQLWVGKQEYEEVGIERLLNDRF 487

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 88/212 (41%), Gaps = 34/212 (16%)

Query: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSY-----YLSNQIKTIKDISSVVFR 58
           PI +D GS +I+ G  +  TP   F N L R +         ++ N +   + I +   +
Sbjct: 38  PIAIDFGSSQIRAGYTNQSTPSHIFPNRLTRYRDRKINKTFTFIGNDVSLDQAIRTQS-K 96

Query: 59  RPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQV 118
            P +   +T+W+    I  Y F +     G    +     ++++E   T+     N  Q+
Sbjct: 97  SPFDGSIITNWDYVEDIMQYIFNHL----GVVGHNGVSNPILLTEKLATLQSQRSNWYQL 152

Query: 119 VFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTW 178
           +FE ++   +     + FA +G    + +G                   LVID G   T 
Sbjct: 153 LFECFDIPEVTLGIDSMFAFYGLNERSSTG-------------------LVIDCGNEETD 193

Query: 179 VVPVIKGIPYYKAVKKLDIGGR----FLNGLL 206
           V+PV++G       K+++ GGR    +LN LL
Sbjct: 194 VIPVVEGAGMLTDAKRINWGGRQAVDYLNDLL 225

 Score = 37.0 bits (84), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 49/136 (36%), Gaps = 15/136 (11%)

Query: 272 PLPQDSQTVE------LKDELFSVPETFFHPEIPQLLKPGX----XXXXXXXXXXXPEQL 321
           P P DS+ +       L  E   VPE  F P +    + G                  +L
Sbjct: 595 PRPHDSEDIHQQHQMHLNVERIRVPEILFQPSMGGQDQAGIIELCETILTKKFGSEQRKL 654

Query: 322 RPL---MLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSMAS 378
            P    M  N+  TGGN  LP    R+  E    LP      V     P  L  W+ MA 
Sbjct: 655 SPTALAMANNLWITGGNSKLPGMKERIVKEFTGFLPVGTAFNVKQSYNPS-LDAWNGMAK 713

Query: 379 FT-NSPLYSDARVTRE 393
            T NS  Y +  ++++
Sbjct: 714 LTLNSEDYKNTIISKK 729

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 60/153 (39%), Gaps = 30/153 (19%)

Query: 64  GQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVFEEY 123
           G++  W+     WD+   N        L+ + G    ++E      E  K   +V+ E  
Sbjct: 95  GEVIDWDGAQEQWDWALKN-----ALYLESNSGIPAFLTEPIWNTVENRKKSLEVLLEGL 149

Query: 124 EFASMFKSPIAGFAPF--GRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWVVP 181
           +F + + SP      F  GRP+                        LV+D+G +   V P
Sbjct: 150 QFEACYLSPTPTCISFASGRPNC-----------------------LVVDIGHDVASVSP 186

Query: 182 VIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 214
           VI G+   K+  +  I GRF+N  +KE L  R 
Sbjct: 187 VIDGMTLSKSSMRNFISGRFINEKIKEFLKPRE 219

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 1/89 (1%)

Query: 321 LRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT-DWTCTVHLPSGPKELYGWSSMASF 379
           LR  +  NIV TGG   +P F+ RL  EL ++LP   +       +  ++   W   +  
Sbjct: 412 LRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKFRVLTTGQTRERQYQAWLGGSIL 471

Query: 380 TNSPLYSDARVTREEYFEHGVDWCTRHRF 408
           ++   +    V ++EY E G D   + RF
Sbjct: 472 SSLGTFHQLWVGKQEYEESGADRLLKDRF 500

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 43/91 (47%), Gaps = 5/91 (5%)

Query: 321 LRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT---DWTCTVHLPSGPKELYGWSSMA 377
           LR  +  NIV TGG  ++P F+ RL +EL ++LP        T HL    ++   W   +
Sbjct: 391 LRATLAHNIVLTGGTSSIPGFSDRLMSELNKKLPALKFRILTTGHLRE--RQYQAWLGGS 448

Query: 378 SFTNSPLYSDARVTREEYFEHGVDWCTRHRF 408
             T+   +    V ++EY E G D     RF
Sbjct: 449 ILTSLGSFHQLWVGKQEYEEVGPDRLLSDRF 479

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%)

Query: 165 PFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETL 210
           P  LV+D+G + T V PV+ G+   K+  +  + G  +N L+K+ L
Sbjct: 156 PNCLVVDLGHDTTSVSPVVDGMTLSKSTMRNFLAGNCINELIKKPL 201

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/281 (21%), Positives = 100/281 (35%), Gaps = 50/281 (17%)

Query: 168 LVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETL----------------- 210
           LV+D+G +   V P+I G     AV +    G FL+  + E L                 
Sbjct: 141 LVVDIGASKITVTPIIDGSVVKPAVLRSKFAGDFLDYQVAENLKNSLPIEPAGEDSKVPE 200

Query: 211 SFRHYNVMDETILVNNIKENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPK 270
           SF+++        +++ K   L VSP    E    ++  A  +   D +  FL Y K  K
Sbjct: 201 SFKYWE--SSRTWIHDFKATMLQVSPSKIQELEGMQDTMAFSHNPLDNKKYFL-YKKGNK 257

Query: 271 KPLPQDSQTVELKDELF---------SVPETFFHPEIPQLLKPGXXXXXXXXX------- 314
               +  +  +L + LF         +  E      +  + K G                
Sbjct: 258 TLTLEQRECYKLAEMLFQPQLASDQFAAKEGLAELVVKAVKKAGAAVTTSNSGPAGGGGP 317

Query: 315 ------------XXXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVH 362
                          PEQ+   +L NIV TG    +P    R+  EL  Q P     +  
Sbjct: 318 SGSSSMGIGASSTTTPEQIHAALLTNIVITGSTSLVPGVEQRIVNELSYQFPQYKLSSFA 377

Query: 363 LPSG-PKELYGWSSMASFTNSPLYSDAR-VTREEYFEHGVD 401
            P    ++L  W    + +N P +     +TR+EY  +G++
Sbjct: 378 NPMVLDRKLQSWQGGVTMSNLPSWELGNWITRQEYDANGIN 418

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/227 (19%), Positives = 85/227 (37%), Gaps = 44/227 (19%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYY-------LSNQIKTIKDISS 54
           E   +++D GS+    G    + P     ++    +G+Y         + + K I   SS
Sbjct: 13  EITAVIIDPGSFSTNIGYSGTDYPQ----SILPSSYGTYKETTEGQESTTKRKRIFSESS 68

Query: 55  VVFRRPH-------EFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMT 107
           +   RP        E G +  W+     W +   +        L+ + G   +++E    
Sbjct: 69  IQIPRPDYEIKRIVENGSIMDWDAAQEQWSWALKSQ-----LHLQSTSGIPALLTEPIWN 123

Query: 108 IPELSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQ 167
             E  K   +++ E   F + + S +     F                      A  P  
Sbjct: 124 SVENRKKSLEILLEGMNFEACYLSSVPTCVSFA---------------------AGRPNC 162

Query: 168 LVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 214
           LV+D+G + T V PV+ G+   K+  +  I G+++N L+++ L  R 
Sbjct: 163 LVVDIGHDTTSVSPVVDGMTLSKSSMRNFIAGKYINTLIEKYLQPRE 209

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 42/91 (46%), Gaps = 5/91 (5%)

Query: 321 LRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT---DWTCTVHLPSGPKELYGWSSMA 377
           LR  +  N+V TGG+ ++P  + RL  EL R+LP        T H  +  ++   W   +
Sbjct: 408 LRASLAHNVVLTGGSSSIPGLSDRLILELNRRLPALKFRILSTGH--TKERQYQAWLGGS 465

Query: 378 SFTNSPLYSDARVTREEYFEHGVDWCTRHRF 408
             T+   +    V + EY E GV+     RF
Sbjct: 466 ILTSLGTFHQLWVGKNEYNEVGVERLLMDRF 496

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 55/149 (36%), Gaps = 30/149 (20%)

Query: 64  GQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVFEEY 123
           G +  W+     W +   +   F     + +KG    ++E      E  K   +V+ E  
Sbjct: 92  GSVIDWDSAQEQWSWAIQHELHF-----ESTKGMPAFLTEPIWNTEENRKKSLEVLLENM 146

Query: 124 EFASMFKSPIAGFAPF--GRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWVVP 181
           EF + F SP      F  GRP+                        LV+D+G +   V P
Sbjct: 147 EFEACFLSPTPTCVSFAMGRPTC-----------------------LVVDIGHDVCSVSP 183

Query: 182 VIKGIPYYKAVKKLDIGGRFLNGLLKETL 210
           V+ G+   K+     I G  LN LL + L
Sbjct: 184 VVDGMTLSKSSTSNFIAGSLLNALLSKQL 212

 Score = 37.0 bits (84), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 39/91 (42%), Gaps = 5/91 (5%)

Query: 321 LRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT---DWTCTVHLPSGPKELYGWSSMA 377
           LR  +  N+V TGG  ++P    R+  EL + LP        + HL    ++   W   +
Sbjct: 408 LRATLAHNVVVTGGTSSIPGLTDRIMAELNKSLPALKFRMLTSGHLKE--RQYQSWLGGS 465

Query: 378 SFTNSPLYSDARVTREEYFEHGVDWCTRHRF 408
             ++   +    V ++EY E G     + RF
Sbjct: 466 ILSSLGTFHQLWVGKQEYEEVGASRLLKDRF 496

>ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR034W
           (ARP7)
          Length = 401

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/264 (20%), Positives = 98/264 (37%), Gaps = 42/264 (15%)

Query: 168 LVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFR-----HYNVMDETI 222
           LV+DVG +   V P++ G      + +    G FL+  L + L  R      Y+      
Sbjct: 142 LVVDVGASKVTVTPIVDGSVVKTGILRSRYAGDFLDFQLMKALDDRPDGTSLYHWQQSRT 201

Query: 223 LVNNIKENCLFVSPVSYFESFKHKEQTAVEYV-LPDFQTSFLGYVKDPKKPLPQDSQTVE 281
            + + K   L VS +   E  K  ++ ++ ++ +P        + +       Q + T +
Sbjct: 202 WMRDFKNTMLQVSLMRLSEVEKQLQKQSISFIPIPLEGRKHFLFKR-------QKTVTWD 254

Query: 282 LKDELFSVPETFFHPE---------------IPQLLK-----------PGXXXXXXXXXX 315
           LK + + +PE+ F P                + + +K                       
Sbjct: 255 LK-QCYRIPESLFDPSSVSPEFDSADGLSDLVGKAIKKCAASITSSNGSAAQPAAAGLPS 313

Query: 316 XXPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSG-PKELYGWS 374
             PEQ+   +L N+V  GG   L     RL  +L  Q P     T   P+   ++L  W 
Sbjct: 314 ATPEQIHAALLTNVVIIGGTSLLQGLEQRLVNDLSLQFPQYKLSTYATPAHVDRQLQSWQ 373

Query: 375 SMASFTNSPLYS-DARVTREEYFE 397
              +  + P +   + VT++EY E
Sbjct: 374 GGVNMCHLPDWKLGSWVTKQEYLE 397

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/226 (20%), Positives = 84/226 (37%), Gaps = 49/226 (21%)

Query: 6   IVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDIS--------SVVF 57
           +V+D GS+    G    + P     A+    +G +  +       + S        S+ F
Sbjct: 17  VVIDPGSFTTNIGYSGTDCPQ----AILPSCYGHHKTNENADGDDEKSKPKVFAEQSLTF 72

Query: 58  RRPH-------EFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPE 110
            RP        E G +  W+     WD+   N        L+ +KG   +++E+     E
Sbjct: 73  PRPDYEIKPIVENGLVVDWDAAQEQWDWALRNV-----LHLESNKGVPALMTESIWNTME 127

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPF--GRPSIAISGKGDDQPNRKAEPDAYEPFQL 168
                 +V+ E  +F + + S       F  GRP+                        L
Sbjct: 128 NKTKSLEVLLETLDFEACYISSTPTCVSFATGRPNC-----------------------L 164

Query: 169 VIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 214
           V+DVG +     PV+ G+   ++ ++  I G+F++ L+ + L  R 
Sbjct: 165 VVDVGHDTASSSPVVDGMTLSRSTRRNFISGKFVDQLIGKYLQPRE 210

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 42/91 (46%), Gaps = 5/91 (5%)

Query: 321 LRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT---DWTCTVHLPSGPKELYGWSSMA 377
           LR  +  NIV TGG+ ++P F+ RL  EL ++LP        T HL    ++   W   +
Sbjct: 394 LRATLAHNIVLTGGSSSVPGFSDRLMNELTKKLPALKFRVLTTGHLRE--RQYQSWLGGS 451

Query: 378 SFTNSPLYSDARVTREEYFEHGVDWCTRHRF 408
             T+   +    V + EY E G +     RF
Sbjct: 452 ILTSLGSFHQLWVGKREYEEVGAERLLNDRF 482

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 40/91 (43%), Gaps = 5/91 (5%)

Query: 321 LRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT---DWTCTVHLPSGPKELYGWSSMA 377
           LR  +  N+V TGG   +P  + RL  EL  +LP        T H  +  ++   W   +
Sbjct: 396 LRATLAHNVVLTGGTSTIPGLSDRLMAELNSRLPALKFRMITTGH--TRERQYQSWLGGS 453

Query: 378 SFTNSPLYSDARVTREEYFEHGVDWCTRHRF 408
             T+   +    V +EEY + GVD     RF
Sbjct: 454 VLTSLGTFHQLWVGKEEYQDVGVDRLLADRF 484

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/221 (20%), Positives = 84/221 (38%), Gaps = 41/221 (18%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSN-----QIKTIKDISSVV 56
           E   +V+D GSY    G    + P     A+    +G Y  ++     + K   + S  +
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDCPQ----AILPSCYGDYTNTDDPEGKKKKVFSEQSICI 68

Query: 57  FRRPHEF------GQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPE 110
            R+ +E       G +  W+     W +   N        L+ + G   +++E      E
Sbjct: 69  PRKDYEIKPIVENGVVIDWDAAQEQWSWALENQ-----LYLRSNSGIPALLTEPIWNTVE 123

Query: 111 LSKNMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVI 170
             K   +++ E  +F + + +       FG      +G+                  LV+
Sbjct: 124 NRKKSLELLLEGMDFEACYLASTPTCVSFG------TGRSS---------------CLVV 162

Query: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLS 211
           D+G +   V PV+ G+   K+ K+    G +LN L+K  +S
Sbjct: 163 DLGHDTCSVSPVVDGMTLSKSTKRNFFAGGYLNELIKNYIS 203

>YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}
           ARP7Component of both the SWI/SNF and RSC chromatin
           remodeling complexes; actin-related protein involved in
           transcriptional regulation
          Length = 477

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 63/307 (20%), Positives = 101/307 (32%), Gaps = 79/307 (25%)

Query: 169 VIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLS--FRHYNVMDE------ 220
           VID+G +   V P+I GI    AV +   GG FL+  + E L+   +  N M+       
Sbjct: 156 VIDIGASGCNVTPIIDGIVVKNAVVRSKFGGDFLDFQVHERLAPLIKEENDMENMADEQK 215

Query: 221 ---------TILVNNIKENCLFVSPVSYFESFKHKEQTAVEYVLP-------DFQTSFLG 264
                    +  +   K   L VS    FE  ++ ++ A  Y          D Q  +  
Sbjct: 216 RSTDVWYEASTWIQQFKSTMLQVSEKDLFELERYYKEQADIYAKQQEQLKQMDQQLQYTA 275

Query: 265 YVKDPKKPLPQDSQ----------TVELKDELFSVPETFFHPEI------------PQLL 302
               P  PL Q             T++LK E +   E  F P++            P + 
Sbjct: 276 LTGSPNNPLVQKKNFLFKPLNKTLTLDLK-ECYQFAEYLFKPQLISDKFSPEDGLGPLMA 334

Query: 303 KP-------------------------------GXXXXXXXXXXXXPEQLRPLMLGNIVC 331
           K                                G            PEQ+  L+L N++ 
Sbjct: 335 KSVKKAGASINSMKANTSTNPNGLGTSHINTNVGDNNSTASSSNISPEQVYSLLLTNVII 394

Query: 332 TGGNFNLPNFATRLATELQRQLPT-DWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARV 390
           TG    +     R+  EL  + P    T   +     +++ GW    +  N P +S  + 
Sbjct: 395 TGSTSLIEGMEQRIIKELSIRFPQYKLTTFANQVMMDRKIQGWLGALTMANLPSWSLGKW 454

Query: 391 TREEYFE 397
             +E +E
Sbjct: 455 YSKEDYE 461

>Smik_13.203 Chr13 (331960..331989,332074..333447) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 86/211 (40%), Gaps = 27/211 (12%)

Query: 3   SPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP-- 60
           S   +V  G  E  F  P+LE P + + +  +D   +Y+ SN+  T + ++ +   R   
Sbjct: 16  SQTTLVQFGLNEETFTVPELEIPTQIYRSKKQDGSDAYHSSNKDNTAELVNPIQNGRIID 75

Query: 61  -HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVV 119
            + F Q       S + D    N D    F+ + S    L+++    +  +L + + Q V
Sbjct: 76  INAFTQFLRLIYVSILSDRASKNQD---AFEAELSNIPLLLITHHSWSQSDLER-ITQYV 131

Query: 120 FEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWV 179
           FE  E  ++ + P +  A +   S+                        +IDVG   T +
Sbjct: 132 FESLEINNLIQLPASLAATYSMISLQNC--------------------CIIDVGTYHTDI 171

Query: 180 VPVIKGIPYYKAVKKLDIGGRFLNGLLKETL 210
           +P++        V  + IGG+ +N  LK+ L
Sbjct: 172 IPIVDYAQLDHLVSSIPIGGQSINDSLKKLL 202

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 61/151 (40%), Gaps = 26/151 (17%)

Query: 64  GQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVFEEY 123
           G++  W+     W +   N        LK ++G   +++E      E  K   +V+ E  
Sbjct: 101 GEVVDWDAAQEQWSWALENE-----LFLKSNEGVPALLTEPIWNTVENRKKSLEVLLEGM 155

Query: 124 EFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWVVPVI 183
            F + + S       F       +G+ +                LV+D+G +   V PV+
Sbjct: 156 GFEACYLSATPTCVSFA------AGRSN---------------CLVVDIGHDIISVSPVV 194

Query: 184 KGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 214
            G+ + K+ ++  I G++LN L+ + L  R 
Sbjct: 195 DGMTFSKSTRRNVISGKYLNVLINDFLKPRE 225

 Score = 37.4 bits (85), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 40/89 (44%), Gaps = 1/89 (1%)

Query: 321 LRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT-DWTCTVHLPSGPKELYGWSSMASF 379
           LR  +  N+V TGG   +P  + R+  EL ++LP   +    +  +  ++   W   +  
Sbjct: 414 LRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKFRVLANGQTRERQYQSWLGGSIL 473

Query: 380 TNSPLYSDARVTREEYFEHGVDWCTRHRF 408
           ++   +    V ++EY E G D     RF
Sbjct: 474 SSLGTFHQLWVGKQEYEEIGADRLLTDRF 502

>ZYRO0G17182g Chr7 (1417793..1419190) [1398 bp, 465 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 465

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 74/323 (22%), Positives = 123/323 (38%), Gaps = 65/323 (20%)

Query: 6   IVVDNGSYEIKFGTPDLETPHRAF--NALARDK------FGSYYLSNQIKTIKDISSVVF 57
           +V+ NGS++   G  + ETP      + + RD       FG++ + ++ +   D +S V+
Sbjct: 9   VVIHNGSWQTVAGFSNRETPQCVIPSSYIQRDGQREAQIFGTFEMLDETQE-NDPNSNVY 67

Query: 58  RRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMD- 116
                 G   +WE   + W Y +    + +  +L       L++S     +P  S  +D 
Sbjct: 68  TIIDSRGLPYNWEALESQWRYIYEKQLQIDPSELP------LIIS-----VPASSSEVDM 116

Query: 117 QVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAY-----EPFQLVID 171
           ++V + +E A         F     P++ I            EP A      +   LVID
Sbjct: 117 KIVHKYFELA---------FEKLRVPTLQIV----------VEPLAIALSMSKSSALVID 157

Query: 172 VGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH----------YNVMDET 221
           +G     + PVI G      V K    G FL+  + E L  R           YN     
Sbjct: 158 IGARECKITPVIDGTVVKSGVMKSKFAGDFLDFQVTELLKDRLPPAESSCQMWYN---SQ 214

Query: 222 ILVNNIKENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPL------PQ 275
             +   K   L V   +  E  +  E+ + +     FQ      +  PK  L       +
Sbjct: 215 TWIQQFKNTMLQVCDRNLVEVQRLHEEQSNQLQPVGFQQFTSNSLTQPKNFLLKTANGSK 274

Query: 276 DSQTVELKDELFSVPETFFHPEI 298
            + +VELKD L  +PE  F P++
Sbjct: 275 QTISVELKDCL-KLPEYLFQPQL 296

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 318 PEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT-DWTCTVHLPSGPKELYGWSSM 376
           PEQ+  ++L N++ TG    L     R+  EL  + P    T   +     +++  W +M
Sbjct: 377 PEQVYSILLTNVIITGSTSLLQGMEQRIVNELSIRFPQYKLTTYANQILMDRKIQSWIAM 436

Query: 377 ASFTNSP 383
           +S +N P
Sbjct: 437 SSMSNLP 443

>Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {ON}
           YPR034W (ARP7) - actin related protein, subunit of the
           chromatin remodeling Snf/Swi complex [contig 35] PARTIAL
          Length = 351

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 79/211 (37%), Gaps = 29/211 (13%)

Query: 168 LVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNI 227
           L++D+G     V PVI G     A+ +    G FL+  + + LS +      E       
Sbjct: 94  LIVDLGAAKATVTPVIDGTVVQAAIGRSRFAGDFLDLQVGKLLSEKDDKQNGEESHEPTP 153

Query: 228 KENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFL-----GYVKDPKKPLPQDSQTVEL 282
            E  L+ +  ++ + FK          L D  ++ L      YVK+    L +  +T+ L
Sbjct: 154 LE--LWRNSRTWIQDFKSYMLQVAPSKLQDLDSAALDMMGLSYVKNF---LYRRQKTISL 208

Query: 283 -KDELFSVPETFFHPE---------------IPQLLKPG---XXXXXXXXXXXXPEQLRP 323
            + E  ++ E  F P                + + +K                 PEQ+  
Sbjct: 209 MQKECCALAEGLFQPSYVSQQFASSEGLSEIVAKAVKKAGASTATNSSATNATTPEQIHA 268

Query: 324 LMLGNIVCTGGNFNLPNFATRLATELQRQLP 354
            +L NIV TG +  +P    R+  +L  Q P
Sbjct: 269 ALLTNIVITGSSSLIPGLEQRIVNDLSYQFP 299

>Smik_16.278 Chr16 (516276..517706) [1431 bp, 476 aa] {ON} YPR034W
           (REAL)
          Length = 476

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 61/306 (19%), Positives = 99/306 (32%), Gaps = 78/306 (25%)

Query: 169 VIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLS--FRHYNVM-------- 218
           VID+G +   V P+I GI    AV +   GG FL+  + E L+   +  N M        
Sbjct: 156 VIDMGASGCNVTPIIDGIVVKNAVVRSKFGGDFLDFQVHERLAPLIKEENDMENMADEEK 215

Query: 219 -------DETILVNNIKENCLFVSPVSYFESFKHKEQTAVEYVLP-------DFQTSFLG 264
                  D +  +   K   L VS     E  ++ ++ A  Y          D Q  +  
Sbjct: 216 RSTDVWYDASTWIQQFKSTMLQVSEKDLIELERYYKEQADIYAKQQEQLKQMDQQLQYTA 275

Query: 265 YVKDPKKPLPQDSQ----------TVELKDELFSVPETFFHPEI------------PQLL 302
               P  PL Q             T++LKD  +   E  F P++            P + 
Sbjct: 276 LTGSPNNPLLQKKNFLFKPLNRTLTMDLKD-CYEFAEYLFKPQLISDKFSPEDGLGPLMA 334

Query: 303 KP------------------------------GXXXXXXXXXXXXPEQLRPLMLGNIVCT 332
           K                                            PEQ+  L+L N++ T
Sbjct: 335 KSVKKAGASINSMKANTSTNPNGLGTSHINTNAGDNSTASSSNISPEQVYSLLLTNVIIT 394

Query: 333 GGNFNLPNFATRLATELQRQLPT-DWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVT 391
           G    +     R+  EL  + P    T   +     +++ GW    +  N P ++  +  
Sbjct: 395 GSTSLIEGMEQRIIKELSIRFPQYKLTTFANQVMMDRKIQGWLGAVTMANLPSWNLGKWY 454

Query: 392 REEYFE 397
            +E +E
Sbjct: 455 SKEDYE 460

>Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034W
           (REAL)
          Length = 480

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 62/307 (20%), Positives = 100/307 (32%), Gaps = 79/307 (25%)

Query: 169 VIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLS--FRHYNVMDE------ 220
           VID+G +   V P+I GI    AV +   GG FL+  + E L+   +  N M+       
Sbjct: 156 VIDMGASGCNVTPIIDGIVVKNAVVRSKFGGDFLDYQVHEKLAPMIKEENDMENMADEEK 215

Query: 221 ---------TILVNNIKENCLFVSPVSYFESFKH-KEQTAV------EYVLPDFQTSFLG 264
                       +   K   L VS     E  ++ KEQ  +      +    D Q  +  
Sbjct: 216 SSTDVWHEANTWIQQFKSTMLQVSEKDLIELERYYKEQAEIFARQQEQLKQMDQQLQYTA 275

Query: 265 YVKDPKKPLPQDSQ----------TVELKDELFSVPETFFHPEI------------PQLL 302
               P  PL Q             T++ KD  +   E  F P++            P + 
Sbjct: 276 LTGSPNNPLLQKKNFLFKPLNKTITLDFKD-CYEFAEYLFKPQLISDKFSPEDGLGPLMA 334

Query: 303 K-------------------------------PGXXXXXXXXXXXXPEQLRPLMLGNIVC 331
           K                                G            PEQ+  L+L NI+ 
Sbjct: 335 KSVKKAGASINSMKANTSANMNGLGTSHMHATAGDNANGSSSNNISPEQVYSLLLTNIII 394

Query: 332 TGGNFNLPNFATRLATELQRQLPT-DWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARV 390
           TG +  +     R+  EL  + P    T   +     +++ GW    +  N P ++  + 
Sbjct: 395 TGSSSLIEGMEQRIIKELSIRFPQYKLTTFANQVMMDRKIQGWLGAVTMANLPSWNLGKW 454

Query: 391 TREEYFE 397
             +E +E
Sbjct: 455 YSKEDYE 461

>CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034w ARP7
           Actin-like protein
          Length = 529

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 37/83 (44%), Gaps = 2/83 (2%)

Query: 318 PEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSG-PKELYGWSSM 376
           PE +  L+L N++ TGG   +     R+  EL  + P     T   P    + L  W+  
Sbjct: 436 PEHVYSLLLTNVIITGGTSLIDGMEQRIIRELSIRFPQYKLSTFTNPDQLQRSLQAWNGA 495

Query: 377 ASFTNSPLYSDAR-VTREEYFEH 398
            S +N P +   +  T+E++  H
Sbjct: 496 VSLSNLPKWGLTQWFTKEDFNNH 518

>YMR033W Chr13 (337788..337817,337904..339277) [1404 bp, 467 aa]
           {ON}  ARP9Component of both the SWI/SNF and RSC
           chromatin remodeling complexes; actin-related protein
           involved in transcriptional regulation
          Length = 467

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 84/211 (39%), Gaps = 27/211 (12%)

Query: 3   SPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQ---IKTIKDISSVVFRR 59
           S   +V  G  E  F  P+LE P + +    +D   +Y+ +N+    + IK I +     
Sbjct: 16  SQTTLVQFGLNEETFTVPELEIPTQIYRTTRQDGSYTYHSTNKDNKAELIKPIQNGEIID 75

Query: 60  PHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVV 119
              F Q       S + D    N D    F+ + S    L+++    +  +L + + Q V
Sbjct: 76  ISAFTQFLRLIFVSILSDRANKNQD---AFEAELSNIPLLLITHHSWSQSDL-EIITQYV 131

Query: 120 FEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWV 179
           FE  E  ++ + P +  A +   S+                        +IDVG + T +
Sbjct: 132 FESLEINNLIQLPASLAATYSMISLQNC--------------------CIIDVGTHHTDI 171

Query: 180 VPVIKGIPYYKAVKKLDIGGRFLNGLLKETL 210
           +P++        V  + +GG+ +N  LK+ L
Sbjct: 172 IPIVDYAQLDHLVSSIPMGGQSINDSLKKLL 202

>NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {ON}
           Anc_7.448 YPR034W
          Length = 565

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 61/154 (39%), Gaps = 46/154 (29%)

Query: 68  SWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVFEEYEFAS 127
           +WE     W+Y F +        L+ S  ++ +V    +TIP + K +D  V E+Y F+ 
Sbjct: 83  NWEALEQQWNYLFNDV-------LRCSPEEYPLV----ITIPSMKKEIDGEVLEKY-FSL 130

Query: 128 MFK-----------SPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNC 176
           +F+            P+A     G+ S                        LVID+G + 
Sbjct: 131 VFERFKFPVFQIILEPLAITLSLGKSS-----------------------GLVIDMGSSG 167

Query: 177 TWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETL 210
             V P+I G     AV     GG FL+  + ETL
Sbjct: 168 CRVTPIIDGTVIKNAVLSSKYGGAFLDYQIIETL 201

>Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 83/211 (39%), Gaps = 27/211 (12%)

Query: 3   SPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKT---IKDISSVVFRR 59
           S   +V  G  E  F  P+LE P + + +  +D    Y+ +N+  T   IK I +     
Sbjct: 16  SQTTLVQFGLNEETFTVPELEIPTQIYRSTKQDGSYEYHSTNKDDTAELIKPIQNGSIID 75

Query: 60  PHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVV 119
            + F Q       S + D      D    F+ + S    L+++    +  +L + + Q +
Sbjct: 76  INAFLQFLRLIYVSLLSDRANKGQD---AFEAELSNIPLLLITHHSWSQSDL-ETITQYI 131

Query: 120 FEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWV 179
           FE  E  ++ + P +  A +   S+                        +IDVG   T +
Sbjct: 132 FESLEINNLIQLPASLAATYSMISLQNC--------------------CIIDVGTYHTDI 171

Query: 180 VPVIKGIPYYKAVKKLDIGGRFLNGLLKETL 210
           +P++        V  L +GG+ +N  LK+ L
Sbjct: 172 IPIVDYAQLDHLVSSLPVGGQSINDSLKKLL 202

>Skud_13.189 Chr13 (324460..324489,324579..325952) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 83/211 (39%), Gaps = 27/211 (12%)

Query: 3   SPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKT---IKDISSVVFRR 59
           S   +V  G  E  F  P+LE P + + +  +D   +Y+ +N+  T   I  I S     
Sbjct: 16  SQTTLVQFGLNEETFTVPELEIPTQIYRSTKQDGSYAYHSTNKDNTAELINPIQSGSIVD 75

Query: 60  PHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVV 119
              F Q       S + +    N D    F+ + S    L+++    +  +L + + Q +
Sbjct: 76  IEAFTQFLRLIYVSILSNRVNKNQD---AFEAELSNIPLLLITHHFWSQSDLER-ITQYI 131

Query: 120 FEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWV 179
           FE  E  ++ + P +  A +   S+                        +IDVG   T V
Sbjct: 132 FESLEINNLIQLPASLAATYSMISLQNC--------------------CIIDVGTYHTDV 171

Query: 180 VPVIKGIPYYKAVKKLDIGGRFLNGLLKETL 210
           +P++        V  + +GG+ +N  LK+ L
Sbjct: 172 IPIVDYAQLDHLVSSIPMGGQSINESLKKLL 202

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 43/92 (46%), Gaps = 5/92 (5%)

Query: 168 LVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNI 227
           LVID+  + + V P++ G+     + K   GG FL+  +      + ++ +DE +     
Sbjct: 156 LVIDISGSGSSVTPIVDGVIIKNGIVKSKYGGDFLDYQI-----IKKFSTIDEDLEEEMT 210

Query: 228 KENCLFVSPVSYFESFKHKEQTAVEYVLPDFQ 259
             + ++VS  S+ ++FK       +  L D +
Sbjct: 211 NSSNIWVSSNSWIKNFKKTMLQVTDKKLQDVE 242

>KNAG0H00570 Chr8 complement(91418..92827) [1410 bp, 469 aa] {ON}
           Anc_2.593 YMR033W
          Length = 469

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 55/214 (25%), Positives = 83/214 (38%), Gaps = 32/214 (14%)

Query: 2   ESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYY-----LSNQIKTIKDISSVV 56
           ES   +V  G  +  F  P+LE P R +  +  DK   Y+      S ++  IKD   ++
Sbjct: 15  ESATTLVQFGLNDEAFTVPELEIPTRIYKEVGSDKKNKYFSEPTETSVEVSPIKD--GLI 72

Query: 57  FRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMD 116
              P  F Q       S +      NP  F  F L +     L+ S     I    + + 
Sbjct: 73  ADLP-AFLQFLKLVYGSILAKQSVNNPSAFE-FQLANIP-LLLLTSHKWSQIQ--CERIT 127

Query: 117 QVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNC 176
           Q VFE  + +S+F    A    +   S         QPN            ++ID+G + 
Sbjct: 128 QFVFEHLQMSSLFLLSSALATTYALVS---------QPN-----------SIIIDIGTSY 167

Query: 177 TWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETL 210
           T +VPVI          +L +GG  +N  LK+ L
Sbjct: 168 TDIVPVIDYTALAYIGSRLKMGGDRINQTLKKLL 201

>KNAG0B02110 Chr2 complement(399743..401200) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%)

Query: 168 LVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLS 211
           LVID+G N   V PV  G+       +   GG FL+ L K  +S
Sbjct: 153 LVIDIGTNGCTVTPVYDGVVVRTGCVRSKYGGAFLDYLAKTKMS 196

>TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.593
           YMR033W
          Length = 484

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 24/42 (57%)

Query: 169 VIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETL 210
           +ID+G N T +VP++           L+ GG ++N +L++ L
Sbjct: 160 IIDIGLNHTDIVPIVDYTTINHLSNTLNYGGSYINTILQKLL 201

>KLLA0E06315g Chr5 complement(567309..568625) [1317 bp, 438 aa] {ON}
           similar to uniprot|Q75BT7 Ashbya gossypii ACR184C
           ACR184Cp and weakly similar to uniprot|Q12406
           Saccharomyces cerevisiae YPR034W ARP7 Actin-related
           protein involved in transcriptional regulation subunit
           of the chromatin remodeling Snf/Swi complex
          Length = 438

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 59/137 (43%), Gaps = 17/137 (12%)

Query: 168 LVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLN-----GLLKETLSFRHYNVMDETI 222
           +V+D+G +   V  VI G+ + +  K+  IGG FLN       LK+          D T 
Sbjct: 146 IVVDIGHSGVKVDVVIDGVLFKQYRKENKIGGAFLNWQICDQYLKQDSGKSTKIWRDATE 205

Query: 223 LVNNIKENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVEL 282
            + N K + L VSP+    ++          V P +Q   +    D  K    D +T+  
Sbjct: 206 WLPNFKNSMLQVSPIELDANYD---------VAPHYQ--HMVSPMDLTKNFLLDKKTLTF 254

Query: 283 KD-ELFSVPETFFHPEI 298
            + +L+++ E  F P I
Sbjct: 255 TNKQLYTIGELLFKPVI 271

>Skud_16.321 Chr16 (604148..605587) [1440 bp, 479 aa] {ON} YPR034W
           (REAL)
          Length = 479

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 36/81 (44%), Gaps = 1/81 (1%)

Query: 318 PEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT-DWTCTVHLPSGPKELYGWSSM 376
           PEQ+  L+L N++ TG    +     R+  EL  + P    T   +     +++ GW   
Sbjct: 380 PEQVYSLLLTNVIITGSTSLIEGMEQRIIKELSIRFPQYKLTTFANQVMMDRKIQGWLGA 439

Query: 377 ASFTNSPLYSDARVTREEYFE 397
            +  N P ++  +   +E +E
Sbjct: 440 VTMANLPSWNLGKWYSKEDYE 460

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 24/43 (55%)

Query: 169 VIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLS 211
           VID+G +   V P+I GI    AV +   GG FL+  + E L+
Sbjct: 156 VIDMGASGCNVTPIIDGIVVKNAVVRSKFGGDFLDFQVHEKLT 198

>TPHA0B01460 Chr2 complement(325847..327304) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 75/198 (37%), Gaps = 45/198 (22%)

Query: 37  FGSYYLSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKG 96
           FG++ + ++    +D   V      +FG   +WE     W Y +                
Sbjct: 44  FGTFEMLDEAAKNEDNDEVFTIMDSKFGVPYNWEALEKQWRYIY---------------E 88

Query: 97  QHLVVSET----CMTIPE-LSKN--MDQVVFEEYEFASMFKSPIAGFAPFGRPSIAIS-- 147
           +HL VS       +T+P  L+KN  ++  + EEY   +  K  I         S+AIS  
Sbjct: 89  EHLKVSPDQLPLAITVPSILTKNVELETKIIEEYCKIAFLKLGIPSLRVVNE-SLAISLS 147

Query: 148 -GKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFL---- 202
            GK +                L+ID+  +   V P++ GI     + K   GG FL    
Sbjct: 148 LGKKN---------------SLIIDLSGSGCSVTPILDGILIKNGILKSKFGGDFLDFEV 192

Query: 203 NGLLKETLSFRHYNVMDE 220
           N ++ E +       MDE
Sbjct: 193 NKIINEKIKESDKEEMDE 210

>NDAI0G04900 Chr7 (1179776..1184110) [4335 bp, 1444 aa] {ON}
           Anc_1.455 YEL022W
          Length = 1444

 Score = 30.8 bits (68), Expect = 8.6,   Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 47/106 (44%), Gaps = 18/106 (16%)

Query: 12  SYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRPHEFGQLTSWEL 71
           SY I     DL  P    N      F  Y  S  +KT        + + H+F +   W++
Sbjct: 705 SYSIIMLNTDLHNP----NIKEHMSFADY--SGNLKT-------CYNKSHDFPREYLWKI 751

Query: 72  ESAIWDYCFFNPDEFNG-FDLKDSKGQHLVVSETCMT----IPELS 112
             +I D     P+EF+G  +  D   ++L+VS T +T    +PE++
Sbjct: 752 YCSIRDKEIVMPEEFDGDVEWFDDVWKNLIVSNTVVTEIHSVPEVN 797

>KAFR0D01030 Chr4 (212780..212792,212864..215043) [2193 bp, 730 aa]
           {ON} Anc_8.50 YLR054C
          Length = 730

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 45/91 (49%), Gaps = 15/91 (16%)

Query: 42  LSNQIKTIKDISSVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVV 101
           L N++  I+++ ++   +  +F QL    LE A W       D         S    L +
Sbjct: 176 LQNELVAIQELQNISKSKLLKFNQL----LEVAEWIKIKLESD---------SSKMSLKI 222

Query: 102 SETCMTIPELSKNMDQVVFEEYEFASMFKSP 132
            E+   IP++S N+  +++EE+++ ++ K+P
Sbjct: 223 WESI--IPKISLNILSIIYEEFDYETLLKTP 251

>Ecym_3568 Chr3 (1077825..1079363) [1539 bp, 512 aa] {ON} similar to
           Ashbya gossypii AFR361C
          Length = 512

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 42/88 (47%), Gaps = 8/88 (9%)

Query: 22  LETPHRAFNALARDKFGSY--YLS--NQIKTIKDISSVVFRRPHEFGQLTSWELESAIWD 77
           +++  R  N  AR+   S+   LS  NQ+K   DI    F   H  G+ T  EL++   +
Sbjct: 422 IDSIRRTLNWNAREAQSSFVHMLSGKNQMKYESDIYEGQF---HNSGEPTE-ELQTEDSE 477

Query: 78  YCFFNPDEFNGFDLKDSKGQHLVVSETC 105
            C  +PD ++     DS  +H V SE C
Sbjct: 478 DCRRHPDSYDKITGSDSDREHYVSSEEC 505

>TBLA0C00840 Chr3 complement(172404..173678) [1275 bp, 424 aa] {ON}
           Anc_2.638 YMR067C
          Length = 424

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 254 VLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFS 288
           +LP  QT F  Y+  P K LP DSQ+  +KD  F+
Sbjct: 303 LLPPHQTHFKLYIPHPYKHLPSDSQSTLIKDLKFN 337

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,950,618
Number of extensions: 2170745
Number of successful extensions: 5443
Number of sequences better than 10.0: 169
Number of HSP's gapped: 5247
Number of HSP's successfully gapped: 213
Length of query: 414
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 302
Effective length of database: 40,638,807
Effective search space: 12272919714
Effective search space used: 12272919714
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)