Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C01716g8.259ON1413141367900.0
TDEL0F038608.259ON1399140939060.0
Suva_10.1708.259ON1416142438600.0
Skud_12.1548.259ON1417142138100.0
Smik_12.1458.259ON1418142338040.0
YLR086W (SMC4)8.259ON1418143538000.0
NCAS0B050008.259ON1409141037470.0
KAFR0B027108.259ON1416142036200.0
SAKL0H17094g8.259ON1422142935800.0
Kpol_392.88.259ON1427138935490.0
AGR089C8.259ON1370132834860.0
KLTH0G13750g8.259ON1399137734570.0
KNAG0G020208.259ON1444139034540.0
NDAI0B019708.259ON1415138334430.0
Ecym_43118.259ON1376137034220.0
Kwal_56.238258.259ON1396138333640.0
TBLA0E044108.259ON1422137832890.0
TPHA0J007208.259ON1393137032160.0
CAGL0L12188g8.259ON1398132831300.0
KLLA0F19085g8.259ON1372137130720.0
NDAI0G033208.68ON123110413842e-36
KLTH0A02706g8.68ON12281593583e-33
Kwal_23.50438.68ON12251593467e-32
Skud_6.648.68ON12301533431e-31
Suva_6.528.68ON12641533422e-31
YFR031C (SMC2)7.186ON11707243412e-31
Smik_6.718.68ON12281533386e-31
YFL008W (SMC1)8.68ON12251533387e-31
NCAS0C040008.68ON12231553369e-31
TPHA0P003408.68ON12191573369e-31
KAFR0C032008.68ON12231553361e-30
KNAG0G009108.68ON12261533351e-30
SAKL0B02288g8.68ON12281573332e-30
Kpol_1011.58.68ON12211623305e-30
KAFR0G029307.186ON11709763261e-29
TBLA0G035308.68ON12328103252e-29
Suva_6.1047.186ON11707223233e-29
AGR236W7.186ON11708453224e-29
KLLA0D07502g8.68ON12431553224e-29
Kwal_55.204217.186ON11708693207e-29
AGL023W8.68ON122210423181e-28
TDEL0C009608.68ON12221553172e-28
ZYRO0F03828g8.68ON121710283144e-28
Smik_7.3467.186ON11708403135e-28
CAGL0F02079g8.68ON12231693127e-28
Ecym_73038.68ON12227283082e-27
SAKL0F07282g7.186ON11707233029e-27
ZYRO0D15642g7.186ON117010042983e-26
KNAG0L011607.186ON11709762868e-25
NCAS0E019207.186ON11707242698e-23
KLTH0H09966g1.295ON122410022643e-22
KLTH0E04774g7.186ON11707062618e-22
Smik_10.1671.295ON12297422473e-20
YJL074C (SMC3)1.295ON12307162464e-20
Skud_6.1197.186ON11701602393e-19
Ecym_43907.186ON11701602359e-19
CAGL0D05258g7.186ON11701602359e-19
TDEL0H026107.186ON11701622322e-18
NDAI0G056301.295ON12297252322e-18
Skud_10.1701.295ON12307212313e-18
Kpol_1063.207.186ON11711602303e-18
NDAI0G020707.186ON11711622286e-18
SAKL0D06116g1.295ON12298092171e-16
KLLA0D16005g7.186ON11701622161e-16
TPHA0C044407.186ON11701612152e-16
NCAS0A093301.295ON12277252143e-16
KAFR0A016101.295ON12271092072e-15
ZYRO0G21296g1.295ON12271182062e-15
Kwal_14.24351.295ON12471162053e-15
AAL182W1.295ON12317172035e-15
TBLA0D046107.186ON1174792026e-15
KNAG0B052301.295ON12251171964e-14
TDEL0D016201.295ON12231111938e-14
Kpol_1018.21.295ON12111061874e-13
TPHA0I010901.295ON12161111849e-13
CAGL0H02805g1.295ON12191091831e-12
Ecym_63221.295ON12321041821e-12
Suva_6.1491.295ON12301051812e-12
TBLA0C027401.295ON11191401802e-12
KLLA0A00286g1.295ON1224891713e-11
KLTH0D02816g7.101ON10941601212e-05
SAKL0B09526g7.101ON10994531202e-05
ZYRO0G01584g7.101ON10881631203e-05
TDEL0E013404.237ON1106851113e-04
Skud_15.1217.101ON10931681113e-04
ACR068W5.267ON18053221060.001
Suva_15.1337.101ON10921621050.001
YOL034W (SMC5)7.101ON10931591050.002
NCAS0I005707.101ON10951671020.003
ZYRO0B12122g4.237ON1109781020.003
Smik_15.1317.101ON10931591020.003
KNAG0L006307.101ON11081601020.003
Kwal_26.72047.101ON1117621020.004
KAFR0D013307.101ON10801851010.005
Kpol_483.114.238ON25462431010.005
NCAS0J013904.237ON109668970.014
TPHA0B008404.237ON111968960.018
CAGL0H05071g4.237ON111076960.018
Skud_12.4684.237ON112068960.019
Suva_10.5004.237ON111568960.020
NDAI0J021804.237ON110868950.020
YLR383W (SMC6)4.237ON111468950.020
Smik_12.4704.237ON111468950.021
Ecym_26257.101ON1097131950.024
NDAI0A084507.101ON111962950.025
KLLA0F07997g7.101ON1119128950.026
KNAG0B060104.237ON111768950.026
Kpol_1044.137.101ON110362940.031
TDEL0H034907.101ON110380930.035
TPHA0L006007.101ON111762930.038
TBLA0E021907.101ON108969930.041
TBLA0A053001.67ON70763920.050
KLLA0E05303g4.237ON109870910.070
TBLA0I028904.237ON109871900.082
Ecym_31735.296ON839527870.19
TDEL0G028102.351ON109471860.23
AEL337C7.101ON109769860.24
CAGL0F01155g7.101ON110564860.27
SAKL0H03322g4.237ON111147860.30
Kpol_483.104.237ON111879860.30
Kwal_26.93804.237ON110285850.32
CAGL0D00924g4.238ON198086850.39
KLTH0D14080g4.237ON110299840.40
ZYRO0F16038g1.110ON1304174840.41
KLLA0C17204g4.46ON768288840.48
NCAS0B087001.67ON71572830.49
KAFR0A060404.237ON110268820.72
Kwal_56.237458.275ON17349771.2
CAGL0B00924g1.46ON438180791.6
KAFR0G027807.166ON711139782.2
Skud_3.1576.364ON19058752.2
AER044W4.237ON110352782.3
Ecym_53444.237ON110268772.8
KAFR0D004201.45ON78777773.0
CAGL0I08569g8.210ON77785763.4
ZYRO0A07524g2.351ON109071763.7
YHR023W (MYO1)5.267ON1928119763.7
TBLA0I029004.238ON1794269763.8
Suva_3.1226.364ON19058734.3
KLLA0D01045g6.16ON965125754.6
YEL061C (CIN8)6.16ON100089754.7
KAFR0C033408.71ON829160755.1
Skud_4.4088.331ON203044755.4
Kwal_27.99005.120ON50072746.4
KLLA0C09691g8.704ON821294746.4
KAFR0B065903.479ON706216746.5
AFR683C1.67ON67782746.8
YCR086W (CSM1)6.364ON19057717.1
Kwal_23.40103.425ON874231747.2
NCAS0A022304.204ON49480737.6
TDEL0D056003.492ON700144737.9
KNAG0B033005.598ON450117738.4
ZYRO0F17050g1.67ON71481738.5
ZYRO0F15378g2.16ON928269739.1
Ecym_82315.267ON1854301739.1
NCAS0I001307.68ON1567113739.6
Smik_14.851.110ON1312123739.6
NDAI0D044204.238ON1914202739.6
Smik_4.1764.238ON1795230739.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C01716g
         (1413 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...  2620   0.0  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....  1509   0.0  
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...  1491   0.0  
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...  1472   0.0  
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...  1469   0.0  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...  1468   0.0  
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....  1447   0.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....  1399   0.0  
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...  1383   0.0  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...  1371   0.0  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...  1347   0.0  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...  1336   0.0  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....  1335   0.0  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....  1330   0.0  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...  1322   0.0  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...  1300   0.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...  1271   0.0  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...  1243   0.0  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...  1210   0.0  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...  1187   0.0  
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}             152   2e-36
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...   142   3e-33
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...   137   7e-32
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...   136   1e-31
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...   136   2e-31
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...   135   2e-31
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...   134   6e-31
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...   134   7e-31
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....   134   9e-31
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...   134   9e-31
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....   134   1e-30
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....   133   1e-30
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...   132   2e-30
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...   131   5e-30
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...   130   1e-29
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...   129   2e-29
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...   129   3e-29
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...   128   4e-29
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...   128   4e-29
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...   127   7e-29
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...   127   1e-28
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....   126   2e-28
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...   125   4e-28
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...   125   5e-28
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...   124   7e-28
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...   123   2e-27
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...   120   9e-27
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...   119   3e-26
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...   114   8e-25
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....   108   8e-23
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...   106   3e-22
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...   105   8e-22
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...   100   3e-20
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    99   4e-20
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...    97   3e-19
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...    95   9e-19
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...    95   9e-19
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....    94   2e-18
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    94   2e-18
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    94   3e-18
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...    93   3e-18
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....    92   6e-18
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...    88   1e-16
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    88   1e-16
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    87   2e-16
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    87   3e-16
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    84   2e-15
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    84   2e-15
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    84   3e-15
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    83   5e-15
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    82   6e-15
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    80   4e-14
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    79   8e-14
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    77   4e-13
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    75   9e-13
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    75   1e-12
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    75   1e-12
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    74   2e-12
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    74   2e-12
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    70   3e-11
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    51   2e-05
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    51   2e-05
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    51   3e-05
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    47   3e-04
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    47   3e-04
ACR068W Chr3 (480141..485558) [5418 bp, 1805 aa] {ON} Syntenic h...    45   0.001
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    45   0.001
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    45   0.002
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    44   0.003
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    44   0.003
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    44   0.003
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    44   0.003
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    44   0.004
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    44   0.005
Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON...    44   0.005
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    42   0.014
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    42   0.018
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    42   0.018
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    42   0.019
Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR38...    42   0.020
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    41   0.020
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    41   0.020
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    41   0.021
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    41   0.024
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    41   0.025
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    41   0.026
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    41   0.026
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    41   0.031
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    40   0.035
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    40   0.038
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    40   0.041
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    40   0.050
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    40   0.070
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    39   0.082
Ecym_3173 Chr3 complement(327173..329692) [2520 bp, 839 aa] {ON}...    38   0.19 
TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2....    38   0.23 
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    38   0.24 
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    38   0.27 
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    38   0.30 
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    38   0.30 
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    37   0.32 
CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} simil...    37   0.39 
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    37   0.40 
ZYRO0F16038g Chr6 complement(1315669..1319583) [3915 bp, 1304 aa...    37   0.41 
KLLA0C17204g Chr3 (1504341..1506647) [2307 bp, 768 aa] {ON} some...    37   0.48 
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...    37   0.49 
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    36   0.72 
Kwal_56.23745 s56 complement(686641..687162) [522 bp, 173 aa] {O...    34   1.2  
CAGL0B00924g Chr2 complement(81492..82808) [1317 bp, 438 aa] {ON...    35   1.6  
KAFR0G02780 Chr7 (577037..579172) [2136 bp, 711 aa] {ON} Anc_7.1...    35   2.2  
Skud_3.157 Chr3 (247977..248549) [573 bp, 190 aa] {ON} YCR086W (...    33   2.2  
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    35   2.3  
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    34   2.8  
KAFR0D00420 Chr4 complement(60057..62420) [2364 bp, 787 aa] {ON}...    34   3.0  
CAGL0I08569g Chr9 (835234..837567) [2334 bp, 777 aa] {ON} simila...    34   3.4  
ZYRO0A07524g Chr1 (615902..619174) [3273 bp, 1090 aa] {ON} highl...    34   3.7  
YHR023W Chr8 (151666..157452) [5787 bp, 1928 aa] {ON}  MYO1Type ...    34   3.7  
TBLA0I02900 Chr9 complement(687092..692476) [5385 bp, 1794 aa] {...    34   3.8  
Suva_3.122 Chr3 (180777..181349) [573 bp, 190 aa] {ON} YCR086W (...    33   4.3  
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...    33   4.6  
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...    33   4.7  
KAFR0C03340 Chr3 (680435..682924) [2490 bp, 829 aa] {ON} Anc_8.7...    33   5.1  
Skud_4.408 Chr4 (727248..733340) [6093 bp, 2030 aa] {ON} YDR150W...    33   5.4  
Kwal_27.9900 s27 complement(113903..115405) [1503 bp, 500 aa] {O...    33   6.4  
KLLA0C09691g Chr3 (837629..840094) [2466 bp, 821 aa] {ON} weakly...    33   6.4  
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...    33   6.5  
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...    33   6.8  
YCR086W Chr3 (263392..263964) [573 bp, 190 aa] {ON}  CSM1Nucleol...    32   7.1  
Kwal_23.4010 s23 complement(525504..528128) [2625 bp, 874 aa] {O...    33   7.2  
NCAS0A02230 Chr1 (418098..419582) [1485 bp, 494 aa] {ON}               33   7.6  
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...    33   7.9  
KNAG0B03300 Chr2 complement(639238..640590) [1353 bp, 450 aa] {O...    33   8.4  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...    33   8.5  
ZYRO0F15378g Chr6 (1257918..1260704) [2787 bp, 928 aa] {ON} weak...    33   9.1  
Ecym_8231 Chr8 complement(471639..477203) [5565 bp, 1854 aa] {ON...    33   9.1  
NCAS0I00130 Chr9 (9673..14376) [4704 bp, 1567 aa] {ON} Anc_7.68 ...    33   9.6  
Smik_14.85 Chr14 (154519..158457) [3939 bp, 1312 aa] {ON} YNL250...    33   9.6  
NDAI0D04420 Chr4 (1033897..1039641) [5745 bp, 1914 aa] {ON} Anc_...    33   9.6  
Smik_4.176 Chr4 (322038..327425) [5388 bp, 1795 aa] {ON} YDL058W...    33   9.7  

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 2620 bits (6790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1319/1413 (93%), Positives = 1319/1413 (93%)

Query: 1    MDDDDSLSKRQKVDGLNQIDGKHPTVDLDQGENLSLPTTSSSQNTFAHAKTPRKLVVGNG 60
            MDDDDSLSKRQKVDGLNQIDGKHPTVDLDQGENLSLPTTSSSQNTFAHAKTPRKLVVGNG
Sbjct: 1    MDDDDSLSKRQKVDGLNQIDGKHPTVDLDQGENLSLPTTSSSQNTFAHAKTPRKLVVGNG 60

Query: 61   DNRYAHXXXXXXXXXXXXXXXXXXATSSRGRGSKTYXXXXXXXXXXXXXXKLELIQISPL 120
            DNRYAH                  ATSSRGRGSKTY              KLELIQISPL
Sbjct: 61   DNRYAHSSQSISSSSLQVPPLQPPATSSRGRGSKTYSQSPPRSPGRSPTRKLELIQISPL 120

Query: 121  KNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGK 180
            KNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGK
Sbjct: 121  KNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGK 180

Query: 181  SNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDE 240
            SNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDE
Sbjct: 181  SNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDE 240

Query: 241  EKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQM 300
            EKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQM
Sbjct: 241  EKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQM 300

Query: 301  KSKAXXXXXXXXXXXXXXIIGTAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSL 360
            KSKA              IIGTAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSL
Sbjct: 301  KSKAEREGEDGLLEYLEDIIGTAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSL 360

Query: 361  ENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASV 420
            ENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASV
Sbjct: 361  ENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASV 420

Query: 421  KKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTL 480
            KKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTL
Sbjct: 421  KKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTL 480

Query: 481  SSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEI 540
            SSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEI
Sbjct: 481  SSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEI 540

Query: 541  AQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGS 600
            AQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGS
Sbjct: 541  AQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGS 600

Query: 601  KELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKALDARSALSNAENKSK 660
            KELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKALDARSALSNAENKSK
Sbjct: 601  KELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKALDARSALSNAENKSK 660

Query: 661  VLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVETVECGQQCIEYL 720
            VLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVETVECGQQCIEYL
Sbjct: 661  VLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVETVECGQQCIEYL 720

Query: 721  RKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSSAFFSVLGNTLVAND 780
            RKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSSAFFSVLGNTLVAND
Sbjct: 721  RKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSSAFFSVLGNTLVAND 780

Query: 781  LKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRNKTEDIEIYSSEEV 840
            LKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRNKTEDIEIYSSEEV
Sbjct: 781  LKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRNKTEDIEIYSSEEV 840

Query: 841  AQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIKE 900
            AQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIKE
Sbjct: 841  AQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIKE 900

Query: 901  IQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGG 960
            IQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGG
Sbjct: 901  IQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGG 960

Query: 961  AELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETSRDLENFNQEIQ 1020
            AELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETSRDLENFNQEIQ
Sbjct: 961  AELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETSRDLENFNQEIQ 1020

Query: 1021 TLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDINEDIAIFKSFEMEMKN 1080
            TLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDINEDIAIFKSFEMEMKN
Sbjct: 1021 TLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDINEDIAIFKSFEMEMKN 1080

Query: 1081 ELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDESNNASDPXXXXXXXXXXXX 1140
            ELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDESNNASDP            
Sbjct: 1081 ELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDESNNASDPSENPVSDVEESE 1140

Query: 1141 XXXXXGKDENKDLDAQDQVQDAEKQGDNQMDVEDGGEYSDRGLTQFSXXXXXXXXXXXXX 1200
                 GKDENKDLDAQDQVQDAEKQGDNQMDVEDGGEYSDRGLTQFS             
Sbjct: 1141 SSVGEGKDENKDLDAQDQVQDAEKQGDNQMDVEDGGEYSDRGLTQFSEDELHEIEIEELE 1200

Query: 1201 XXXXXXQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAVEERNXXXXXXXXXXXXRFD 1260
                  QNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAVEERN            RFD
Sbjct: 1201 KEIEDLQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAVEERNKVKEKLDELKKKRFD 1260

Query: 1261 EFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVTFSVMPPKKSWRNITNLSG 1320
            EFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVTFSVMPPKKSWRNITNLSG
Sbjct: 1261 EFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVTFSVMPPKKSWRNITNLSG 1320

Query: 1321 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN 1380
            GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN
Sbjct: 1321 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN 1380

Query: 1381 NMFELAQQLVGIYKRDNKTKSATIKNIDFVSVS 1413
            NMFELAQQLVGIYKRDNKTKSATIKNIDFVSVS
Sbjct: 1381 NMFELAQQLVGIYKRDNKTKSATIKNIDFVSVS 1413

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 1509 bits (3906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 796/1409 (56%), Positives = 1006/1409 (71%), Gaps = 17/1409 (1%)

Query: 4    DDSLSKRQKVDGLNQIDGKHPTVDLDQGENLSLPTTSSSQNTFAHAKTPRKLVVGNGDNR 63
            D  L+KRQ+V+     D +    +   G   S P TS+S +T +H  TP+KLV+G  D+ 
Sbjct: 3    DTPLTKRQRVN-----DNESREFEAVNGSTKS-PLTSNSNSTISH--TPKKLVIGTNDDT 54

Query: 64   YAHXXXXXXXXXXXXXXXXXXATSSRGRGSKTYXXXXXXXXXXXXXXKLELIQISPLKNS 123
             +                    +SSRGR  +TY              KLELI+ISP+K +
Sbjct: 55   TSQSQPIVSSSSLQAPSLQHPNSSSRGREQRTYSQSPPRSPGRSPTRKLELIKISPVKKN 114

Query: 124  RLELQKIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNV 183
            RLELQ++YDA+Q+Q    RLCI++L+LQDFKSYAGRQVVGPF++SFSAVVGPNGSGKSNV
Sbjct: 115  RLELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNV 174

Query: 184  IDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKP 243
            IDSMLFVFGFRANKMRQDRLSDLIH SE +P+L SCSVEVHF+YV+DEP G TRIDEEKP
Sbjct: 175  IDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKP 234

Query: 244  NLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSK 303
             LVVTRKAF+NN+SKYYVND+E+NY EVT+LLKKEG+DLDHKRFLILQGEVENIAQM+ K
Sbjct: 235  TLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPK 294

Query: 304  AXXXXXXXXXXXXXXIIGTAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENG 363
            A              I GTAKYKP IE  L ++E LN+ CIEKENRF IVD+EK+SLE G
Sbjct: 295  AEKEGEDGLLEYLEDITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKSSLETG 354

Query: 364  KEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKE 423
            K+EAL FLE E+ LT+ +SK+ QY I  +++KL +TLDK + L  +L++E++K +   KE
Sbjct: 355  KDEALEFLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETLKE 414

Query: 424  LDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSM 483
            +D L+    ++  +++    EEK LL +KR LD + V  EEKIK+  +K +KAEK L S 
Sbjct: 415  VDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEKLLKSN 474

Query: 484  DRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQL 543
              S++++EA L EL+Q Q+DYE  L++LN++   E+ KLE +K SLK+KT  IS  IAQ 
Sbjct: 475  QHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNISAGIAQY 534

Query: 544  EKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKEL 603
            EK+LEPW+ QLQ+K+ +IQLAES++SL+K+  A++ ++I+Q K EI    ++ L   K +
Sbjct: 535  EKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKLAKEKVI 594

Query: 604  DSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKALDARSALSNAENKSKVLT 663
              L  +   V  E+ T   EC +A  RLK+M  IL  QRQ+ LDAR+A S+A+NKS VLT
Sbjct: 595  RELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQNKSTVLT 654

Query: 664  ALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVETVECGQQCIEYLRKN 723
            AL++LQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVE+VECGQQCIEYLRKN
Sbjct: 655  ALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVECGQQCIEYLRKN 714

Query: 724  KLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSSAFFSVLGNTLVANDLKQ 783
            KLGYARFILLDKLRKF+   I TPE+VPRLFDL+ PKD KF  AF+SVL +TL A  L Q
Sbjct: 715  KLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQ 774

Query: 784  ANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRNKTEDIEIYSSEEVAQL 843
            ANRVAYGKKRFRVV+LDG LIDISGTMSGGGS V RGLM++++N +   +I+S EEVAQL
Sbjct: 775  ANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNSYSPDIFSPEEVAQL 834

Query: 844  EVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQM 903
            E  L E+EK+FQ+ASDT  +ME+QLK LK++ P I+  +S+L ME ESW SE+K+KE  +
Sbjct: 835  ENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMETESWMSELKLKEKLL 894

Query: 904  LESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGGAEL 963
            LE   A       N E +     V++LKDE +++ +QT + + +I  LK++IMEIGG+EL
Sbjct: 895  LERLEAQKKATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIAVLKDKIMEIGGSEL 954

Query: 964  KIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETSRDLENFNQEIQTLK 1023
            +IQ+SKV S IQR++I+ SKQKK ++ IKK ENE+ KS K+   T +DL+ ++QEI +LK
Sbjct: 955  QIQNSKVTSTIQRMEILTSKQKKGKASIKKAENELKKSAKIVGNTQKDLDLYSQEIASLK 1014

Query: 1024 TTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDINEDIAIFKSFEMEMKNELE 1083
               + +Q +L  V +SV   Q     + E+   L+ +L  +      FKS ++E+ ++LE
Sbjct: 1015 ENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEFKSLKIEINDKLE 1074

Query: 1084 KLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILH--DLKDESNNASDPXXXXXXXXXXXXX 1141
            KLN+L  H+ KE++  E  L +LKIRDVT+ L   D  + +NN+  P             
Sbjct: 1075 KLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNNSKMPNELQEKRTEGADA 1134

Query: 1142 XXXXGKDENKDLDAQDQVQDAEKQGDNQMDVEDGGEYSDRGLTQFSXXXXXXXXXXXXXX 1201
                G++        D   + EK  D  M+V++     + GL + S              
Sbjct: 1135 TRQEGEE-------SDVSMEEEKSNDEVMEVDEKPHELENGLPRVSEAELKSLDVEDLGA 1187

Query: 1202 XXXXXQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAVEERNXXXXXXXXXXXXRFDE 1261
                 QN++D+ N D+++LEEYA+RL E K R++DLN+AV ER+            RFDE
Sbjct: 1188 QIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGELKKRRFDE 1247

Query: 1262 FMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVTFSVMPPKKSWRNITNLSGG 1321
            FMQGFGIISMTLKEMYQMITMGGNAELELVD+LDPFSEGVTFSVMPPKKSWRNITNLSGG
Sbjct: 1248 FMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGG 1307

Query: 1322 EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNN 1381
            EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNN
Sbjct: 1308 EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNN 1367

Query: 1382 MFELAQQLVGIYKRDNKTKSATIKNIDFV 1410
            MFELAQQLVGIYK  N TKSA++KN D +
Sbjct: 1368 MFELAQQLVGIYKTQNMTKSASLKNNDIL 1396

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 1491 bits (3860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 790/1424 (55%), Positives = 1023/1424 (71%), Gaps = 28/1424 (1%)

Query: 4    DDSLSKRQKVD-------GLNQIDGKH-PTVDL--DQGENLSLPTTSSSQNTFAHAKTPR 53
            D  LSKRQK          +N  +G+  P  +   D+ E    P + S ++++A + TPR
Sbjct: 3    DSPLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHTPR 62

Query: 54   KLVVGNGDNRYAHXXXXXXXXXXXXXXXXXXA-TSSRGRGSKTYXXXXXXXXXXXXXXKL 112
            KLV+ +G+NRYA                       SRGR  K Y              +L
Sbjct: 63   KLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPSRGRDYKAYSQSPPRSPGRSPTRRL 122

Query: 113  ELIQISPLKNSRLELQKIYDAQQNQA-RHTRLCIDQLILQDFKSYAGRQVVGPFNTSFSA 171
            EL+Q+SP+KNSR+ELQK+YD+ Q    +  RL ID+L+L++FKSYAG+QVVGPF+TSFSA
Sbjct: 123  ELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTSFSA 182

Query: 172  VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFKYVIDE 231
            VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEE+P+L SCSV VHF+YV+DE
Sbjct: 183  VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEYVVDE 242

Query: 232  PSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQ 291
            PSG +RIDEEKP LV+TRKAFRNN+SKYY+N +E+NY +VTKLLK EG+DLDHKRFLILQ
Sbjct: 243  PSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQ 302

Query: 292  GEVENIAQMKSKAXXXXXXXXXXXXXXIIGTAKYKPLIEKNLADMESLNDICIEKENRFQ 351
            GEVENIAQMKSKA              IIGTA YKPLIE  L+ +E+LN+IC+EKENRF+
Sbjct: 303  GEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKENRFE 362

Query: 352  IVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLE 411
            IV+REKNSLE+GKE AL FLE E++LT+ KSKL+Q+ +L SN KL +TL+K ++LN+  E
Sbjct: 363  IVNREKNSLESGKETALEFLEKEKQLTLLKSKLFQFKLLQSNSKLASTLEKTSSLNKDFE 422

Query: 412  KESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEK 471
             E  K     KE+D++ +   E++ ++ +C ++EK L  +KREL+   V  EE+ KN   
Sbjct: 423  SEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTKNLVN 482

Query: 472  KRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKD 531
            K  KAEK L S + SIS +E  L EL   Q ++E  +K+LN+  E E+  L+ IK SLKD
Sbjct: 483  KMGKAEKILKSTNHSISEAEHLLEELHGEQTEHETEVKDLNQSLEEERRILDDIKLSLKD 542

Query: 532  KTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIET 591
            KT  IS EI Q EK+LEPW+ QLQEKK+QIQLAES++SL++E + KL +  +  ++ I  
Sbjct: 543  KTKDISAEIIQHEKDLEPWDLQLQEKKSQIQLAESELSLLEETQVKLKKNAEALEENIAA 602

Query: 592  RK--QQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKALDAR 649
            +K  +Q LQG   +  L    KS+ +  S GEK+   A ++LKEMQ ILN  RQ+A++AR
Sbjct: 603  KKARKQELQGF--ILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAMEAR 660

Query: 650  SALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVET 709
            S+LS AENKSKVLTALSRLQKSGRI+GFHGRLGDLGVID+ +DVAISTACPRL+D+VV+T
Sbjct: 661  SSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVVVDT 720

Query: 710  VECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSSAFF 769
            VEC Q CI+YLRKNKLGYARFILLD+LR+FNL  ++TPE+VPRLFDL+ PKDPKFS+AF+
Sbjct: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSNAFY 780

Query: 770  SVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRNKT 829
            SVL +TLVA DLKQAN VAYGK+RFRVVT+DG LIDISGTMSGGG+ V +GLM+I +N++
Sbjct: 781  SVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKNQS 840

Query: 830  EDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEI 889
            + ++ Y+ EEV ++E  L EREKNF+VA+DT+++ME++LK ++++EP +E+ I +  ME 
Sbjct: 841  DRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRAEMEA 900

Query: 890  ESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIE 949
            +S  SE+ + E Q+ E++ AY  + ++  +L + ++ ++ L+ E+  +Q +TK+KK RI+
Sbjct: 901  DSLASELALAEEQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKERIK 960

Query: 950  TLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETS 1009
             L+++IM+IGG  L+IQ+SKV+S+ QRIDI+V+K KK +S IKK+  ++ K  K      
Sbjct: 961  ALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAKLKKVKSGIKKSVGDVTKFQKQLKNVE 1020

Query: 1010 RDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDINEDIA 1069
            RD+E  + E++ ++   E ++  L K    VT + + K  L E+S  L++K+ ++   I 
Sbjct: 1021 RDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKID 1080

Query: 1070 IFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDESNNASDPX 1129
             FKS EMEMKN+LEKLNSL  ++K +IK  E++L +L IRDVT  L  L    NN  D  
Sbjct: 1081 EFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLIL---DNNQMDIL 1137

Query: 1130 XXXXXXXXXXXXXXXXGKDENKDLDAQDQVQDAEKQGDNQ--MDVEDGGEYSDRGLTQFS 1187
                            G       +A+ + Q  E   D++  M++++  +   RG+ + S
Sbjct: 1138 DKEGEDRQETNQEDISG-------EAKGETQGEEGDNDDRHCMNIDETSDEVSRGIPRLS 1190

Query: 1188 XXXXXXXXXXXXXXXXXXXQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAVEERNXX 1247
                                 ++DA+N DI VLEEYARRL EFK R+LDLNQAV++R+  
Sbjct: 1191 EDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEV 1250

Query: 1248 XXXXXXXXXXRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVTFSVMP 1307
                      RFDEFM GF IISMTLKEMYQMITMGGNAELELVD+LDPFSEGVTFSVMP
Sbjct: 1251 KEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMP 1310

Query: 1308 PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1367
            PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER
Sbjct: 1311 PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1370

Query: 1368 TKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFVS 1411
            TKNAQFIVISLRNNMFELAQQLVG+YKRDN+TKS T+KNID ++
Sbjct: 1371 TKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILN 1414

>Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR086W
            (REAL)
          Length = 1417

 Score = 1472 bits (3810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 773/1421 (54%), Positives = 1025/1421 (72%), Gaps = 23/1421 (1%)

Query: 4    DDSLSKRQKVDG-------LNQIDGKHPTV---DLDQGENLSLPTTSSSQNTFAHAKTPR 53
            D  LSK+QK          LN  D +  +     +++ E    P + S ++++A + TPR
Sbjct: 3    DSPLSKKQKRKATEEPELSLNDTDAERESRVENRVNRTEKTPDPNSPSLESSYARSHTPR 62

Query: 54   KLVVGNGDNRYAHXXXXXXXXXXXXXXXXXXA-TSSRGRGSKTYXXXXXXXXXXXXXXKL 112
            KLV+ +G+NRYA                      SSRGR  K Y              +L
Sbjct: 63   KLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKVSSRGRDYKAYSQSPPRSPGRSPARRL 122

Query: 113  ELIQISPLKNSRLELQKIYDAQQNQARHT-RLCIDQLILQDFKSYAGRQVVGPFNTSFSA 171
            EL+Q+SP+KNSR+ELQK+YD+ ++  +   RL I++L+L +FKSYAGRQVVGPF+TSFSA
Sbjct: 123  ELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQVVGPFHTSFSA 182

Query: 172  VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFKYVIDE 231
            VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE +P L +CSV VHF+Y+IDE
Sbjct: 183  VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVAVHFEYIIDE 242

Query: 232  PSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQ 291
            PSG +RIDEEKP LV+TR+AF+NN+SKYY+N++E++Y EVTKLLKKEG+DLDHKRFLILQ
Sbjct: 243  PSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQ 302

Query: 292  GEVENIAQMKSKAXXXXXXXXXXXXXXIIGTAKYKPLIEKNLADMESLNDICIEKENRFQ 351
            GEVENIAQMK KA              IIGTA YKPLIE+ L+ +ESLN+IC+EK NRF+
Sbjct: 303  GEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEICLEKANRFE 362

Query: 352  IVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLE 411
            IVDREKNSLE+GKE AL FL+ E++LT+ KSKL Q+ +L SN KL +TL+KI++LN++ E
Sbjct: 363  IVDREKNSLESGKETALEFLKKEKQLTLLKSKLLQFKMLQSNSKLASTLEKISSLNREFE 422

Query: 412  KESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEK 471
             E  K     +E+D+++A   +++ ++ +  + EK L  +KREL+G  V  EE+ KN   
Sbjct: 423  SEKKKFQESLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSLEERTKNLVN 482

Query: 472  KRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKD 531
            K  KAEK L S   SIS SE    EL++ Q ++E  +K+LN+  E E++ L+ IK SLKD
Sbjct: 483  KMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILDDIKLSLKD 542

Query: 532  KTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIET 591
            KT  IS +I + EKE EPW+ QLQEKK+QIQLAES++SL++E  AKL +  +  +++I +
Sbjct: 543  KTKDISAKIIRHEKESEPWDLQLQEKKSQIQLAESELSLLEETRAKLKKNAEALEEKIIS 602

Query: 592  RKQ--QILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKALDAR 649
            +KQ  Q LQG   LD L  + KS+ +  S GE++  +A ++LKEMQ ILN  RQ+A++AR
Sbjct: 603  KKQRKQELQGLV-LD-LSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQRAMEAR 660

Query: 650  SALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVET 709
            S+LS A+NK+ VLTALS+LQKSGRI+GFHGRLGDLGVID  +DVAISTACPRL+D+VV+T
Sbjct: 661  SSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRLDDVVVDT 720

Query: 710  VECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSSAFF 769
            VEC Q CI+YLRKNKLGYARFILLD+LRKFNL  I+TPE+VPRLFD++ PKDPKFS+AF+
Sbjct: 721  VECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDPKFSNAFY 780

Query: 770  SVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRNKT 829
            SVL +TLVA DLKQAN+VAYGK+RFRVVT+DG LIDISGTMSGGG+ V +GLM++  N++
Sbjct: 781  SVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQS 840

Query: 830  EDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEI 889
            ++IE Y+ EEV ++E  L EREKNF+VA+DT+++MEE+LK ++++EP +E+ IS+  ME 
Sbjct: 841  DEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEA 900

Query: 890  ESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIE 949
            +S  SE+ + E Q  E++ AY    +   ++ E +++++ L+ E++ +Q++T++KK +I+
Sbjct: 901  DSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRTKKEQIK 960

Query: 950  TLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETS 1009
             L+++IM+IGG +L  Q+SKV S+ QRIDI+V K KK +S IKK+E ++ K  K      
Sbjct: 961  ILQDQIMKIGGTKLHTQNSKVGSLCQRIDILVIKLKKVKSGIKKSEGDVLKYQKQLKNFE 1020

Query: 1010 RDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDINEDIA 1069
            +D E  + E++ ++  ++  + +L +   ++T + + K  L ++   L+++L ++ E+I 
Sbjct: 1021 QDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTEMEENID 1080

Query: 1070 IFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDESNNASDPX 1129
             FKS E+EMKN+LEKLNSL  H+K EIK  +++L DL IRDVT  L  L    NN  D  
Sbjct: 1081 EFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQML---DNNQMDVV 1137

Query: 1130 XXXXXXXXXXXXXXXXGKDENKDLDAQDQVQDAEKQGDNQMDVEDGGEYSDRGLTQFSXX 1189
                            G  +++ +  +D   DA+    + M++++      RG+ +    
Sbjct: 1138 EDGIKDEQDADQDKPSGIPDDEKIQEKD---DAD-NNHHSMNIDEMSSEISRGIPKLCEE 1193

Query: 1190 XXXXXXXXXXXXXXXXXQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAVEERNXXXX 1249
                               +++ ++ DI VLEEY RRLIEFK R+LDLNQAV++R+    
Sbjct: 1194 ELKDLDIELLESDISGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQAVQKRDEVKE 1253

Query: 1250 XXXXXXXXRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVTFSVMPPK 1309
                    RFDEFM GF IISMTLKEMYQMITMGGNAELELVD+LDPFSEGVTFSVMPPK
Sbjct: 1254 QLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPK 1313

Query: 1310 KSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1369
            KSWRNITNLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANYIKERTK
Sbjct: 1314 KSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1373

Query: 1370 NAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFV 1410
            NAQFIVISLRNNMFELAQQL+GIYKRDN+TKS T+KNID +
Sbjct: 1374 NAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDIL 1414

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 1469 bits (3804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 776/1423 (54%), Positives = 1025/1423 (72%), Gaps = 26/1423 (1%)

Query: 4    DDSLSKRQKVDGLNQ----IDGKHPTVDL------DQGENLSLPTTSSSQNTFAHAKTPR 53
            D  LSKRQK   + +    +D    T +L      D+ E    P + + + ++A + TPR
Sbjct: 3    DSPLSKRQKRKAVEEPELSLDDSDATQELQAEKQADRSEKTPDPNSPALETSYAKSHTPR 62

Query: 54   KLVVGNGDNRYAHXXXXXXXXXXXXXXX-XXXATSSRGRGSKTYXXXXXXXXXXXXXXKL 112
            KLV+ +G+NRYA                     TSSRGR  K Y              +L
Sbjct: 63   KLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGTSSRGRDYKAYSQSPPRSPGRSPTRRL 122

Query: 113  ELIQISPLKNSRLELQKIYDAQQNQARHT-RLCIDQLILQDFKSYAGRQVVGPFNTSFSA 171
            EL+Q+SP+KNSR+ELQK+Y++ Q+  +   RL I++L+L++FKSYAGRQVVGPF+TSFSA
Sbjct: 123  ELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQVVGPFHTSFSA 182

Query: 172  VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFKYVIDE 231
            VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE +P+L SCSV VHF+YVIDE
Sbjct: 183  VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSVAVHFEYVIDE 242

Query: 232  PSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQ 291
             SG +RIDEEKP LV+TRKAF+NN+SKYY+N +E++Y EVTKLLK EG+DLDHKRFLILQ
Sbjct: 243  SSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQ 302

Query: 292  GEVENIAQMKSKAXXXXXXXXXXXXXXIIGTAKYKPLIEKNLADMESLNDICIEKENRFQ 351
            GEVENIAQMK KA              IIGTA YKPLIE+ +  +E+LN++C+EKENRF+
Sbjct: 303  GEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENRFE 362

Query: 352  IVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLE 411
            IVDREKNSLE+GKE AL FL  E++LT+ KSKL+Q+ +L SN KL +TL+KI++LN+  E
Sbjct: 363  IVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKDFE 422

Query: 412  KESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEK 471
             E  K     K++++++    E++ ++ + ++ EK L+ ++REL+G  V  EE+ KN   
Sbjct: 423  TEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTKNLAN 482

Query: 472  KRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKD 531
            K +K+E+T     RSIS +E  L EL   Q ++E+ +K+LN+  E E+  L++IK SLKD
Sbjct: 483  KIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIKLSLKD 542

Query: 532  KTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIET 591
            KT  IS EI Q EKELEPW+ QLQEK++QIQLAES++SL++E ++KL + ++  +++I  
Sbjct: 543  KTKDISTEIIQHEKELEPWDLQLQEKESQIQLAESELSLLEETQSKLKKNVETMEEKILA 602

Query: 592  RKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKALDARSA 651
            RK    +    + +L  +  S+++E S GE+   +A ++L+EMQ +LNT RQ+A++ARS+
Sbjct: 603  RKAHKQELQDLILNLKKKLSSLRDERSQGEENFSSAHLKLEEMQKVLNTHRQRAMEARSS 662

Query: 652  LSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVETVE 711
            LS A+NKSKVLTALS+LQKSGRI+GFHGRLGDLG+ID  +DVAISTACPRL+D+VV+TVE
Sbjct: 663  LSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPRLDDVVVDTVE 722

Query: 712  CGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSSAFFSV 771
            C QQCI+YLRKNKLGYARFILLD+LR+FNL  I+TPE+VPRLFDL+ PKDPKFS+AF+SV
Sbjct: 723  CAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKDPKFSNAFYSV 782

Query: 772  LGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRNKTED 831
            L +TLVA  LKQAN VAYG+KRFRVVT+DG LIDISGT+SGGG+ VS+GLM++  N++  
Sbjct: 783  LRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQSNK 842

Query: 832  IEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEIES 891
            I+ Y+ EEV ++E  L ERE NF+VA+DT+++ME +LK+L+++EPAIE+ IS+  ME +S
Sbjct: 843  IDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEMEADS 902

Query: 892  WNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIETL 951
              SE+ + E Q+ E+  AY     +  ++   +++++ LK E   +Q++TK+KK +I+ L
Sbjct: 903  ITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIKVL 962

Query: 952  KNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETSRD 1011
            + EIM+IGG +L++Q+SKV S+ QR+DI+V+K KK +S IKK+E ++ K  K    + RD
Sbjct: 963  QGEIMKIGGTKLQMQNSKVGSLCQRLDILVAKLKKVKSGIKKSEGDVLKFQKQLKNSERD 1022

Query: 1012 LENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDINEDIAIF 1071
            +E  + E++ ++  ++  +  L++    +T   + +  L EES  L++ + +  E+I  F
Sbjct: 1023 VELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRSELKEESEQLKEMVAETEENIDEF 1082

Query: 1072 KSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDESNNASDPXXX 1131
            KS E+EMKN+LEKLNSL  H+KKEI   E+ L +L IRDVT  L  L    NN  D    
Sbjct: 1083 KSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEIL---DNNTMDIVKT 1139

Query: 1132 XXXXXXXXXXXXXXGKDENKDLDAQDQ--VQDAEKQGDNQ--MDVEDGGEYSDRGLTQFS 1187
                             E +  + QD+  +Q+ E+  D+   MD+++      RG+ +FS
Sbjct: 1140 DNKIEQAVVK-------EKRSSETQDEKNIQEEERTCDDHHSMDIDETSNEVIRGIPRFS 1192

Query: 1188 XXXXXXXXXXXXXXXXXXXQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAVEERNXX 1247
                                 ++D +N DI VLEEYARRL EFK R+LDLNQAV++R+  
Sbjct: 1193 EEELKELDIELLEKEISELSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEV 1252

Query: 1248 XXXXXXXXXXRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVTFSVMP 1307
                      RFDEFM GF IISMTLKEMYQMITMGGNAELELVD+LDPFSEGVTFSVMP
Sbjct: 1253 KGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMP 1312

Query: 1308 PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1367
            PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER
Sbjct: 1313 PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1372

Query: 1368 TKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFV 1410
            TKNAQFIVISLRNNMFELAQQLVGIYKRDN+T+S T+KNID +
Sbjct: 1373 TKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDIL 1415

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 1468 bits (3800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 786/1435 (54%), Positives = 1035/1435 (72%), Gaps = 50/1435 (3%)

Query: 4    DDSLSKRQKVDGLNQIDGKHPTVDLDQG---------------ENLSLPTTSSSQNTFAH 48
            D  LSKRQK     +   + P + LDQG               EN   P   + + +++ 
Sbjct: 3    DSPLSKRQK-----RKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSK 57

Query: 49   AKTPRKLVVGNGDNRYAHXXXXXXXXXXXXXXXXXXA-TSSRGRGSKTYXXXXXXXXXXX 107
            + TPRKLV+ +G+NRYA                     TSSRGR  K+Y           
Sbjct: 58   SYTPRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSSRGRDHKSYSQSPPRSPGRS 117

Query: 108  XXXKLELIQISPLKNSRLELQKIYDAQQNQARH-TRLCIDQLILQDFKSYAGRQVVGPFN 166
               +LEL+Q+SP+KNSR+ELQKIYD  Q+ ++  +RL I++L+L++FKSYAG+QVVGPF+
Sbjct: 118  PTRRLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFH 177

Query: 167  TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFK 226
            TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE +PSL SCSV VHF+
Sbjct: 178  TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQ 237

Query: 227  YVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKR 286
            YVIDE SG +RIDEEKP L++TRKAF+NN+SKYY+N++E++Y EVTKLLK EG+DLDHKR
Sbjct: 238  YVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKR 297

Query: 287  FLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGTAKYKPLIEKNLADMESLNDICIEK 346
            FLILQGEVENIAQMK KA              IIGTA YKPLIE+ +  +E+LN++C+EK
Sbjct: 298  FLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEK 357

Query: 347  ENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNL 406
            ENRF+IVDREKNSLE+GKE AL FLE E++LT+ +SKL+Q+ +L SN KL +TL+KI++ 
Sbjct: 358  ENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSS 417

Query: 407  NQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKI 466
            N+ LE E  K     K++D+++A   E++ ++ +C+++EK L+ ++REL+G  V  EE+ 
Sbjct: 418  NKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERT 477

Query: 467  KNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIK 526
            KN   K +KAEKTL S   SIS +E  L EL+  Q ++E  +K+L +  E E+  L+ IK
Sbjct: 478  KNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIK 537

Query: 527  FSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFK 586
             SLKDKT  IS EI + EKELEPW+ QLQEK++QIQLAES++SL++E +AKL + ++  +
Sbjct: 538  LSLKDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVETLE 597

Query: 587  QEI---ETRKQQ----ILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILN 639
            ++I   +T KQ+    IL   K+L+SL       K+E S GEK   +A ++LKEMQ +LN
Sbjct: 598  EKILAKKTHKQELQDLILDLKKKLNSL-------KDERSQGEKNFTSAHLKLKEMQKVLN 650

Query: 640  TQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTAC 699
              RQ+A++ARS+LS A+NKSKVLTALSRLQKSGRI+GFHGRLGDLGVID+ +DVAISTAC
Sbjct: 651  AHRQRAMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTAC 710

Query: 700  PRLEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHP 759
            PRL+D+VV+TVEC Q CI+YLRKNKLGYARFILLD+LR+FNL  I+TPE+VPRLFDL+ P
Sbjct: 711  PRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKP 770

Query: 760  KDPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSR 819
            K+PKFS+AF+SVL +TLVA +LKQAN VAYGKKRFRVVT+DG LIDISGTMSGGG+ V++
Sbjct: 771  KNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAK 830

Query: 820  GLMQINRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIE 879
            GLM++  N+++ ++ Y+ EEV ++E  L ERE NF+VASDT+++MEE+LK L++ EP +E
Sbjct: 831  GLMKLGTNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLE 890

Query: 880  NNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQN 939
            + IS+  ME +S  SE+ + E Q+ E+E AY     +  +L   +++++ L+ E+  +Q+
Sbjct: 891  SQISKAEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQS 950

Query: 940  QTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEIN 999
            +TK+KK +I+ L++EIM+IGG +L++Q+SKV+SV Q++DI+V+K KK +S  KK+  ++ 
Sbjct: 951  ETKTKKEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSASKKSGGDVV 1010

Query: 1000 KSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLED 1059
            K  K+   + RD+E  + E++ ++  ++  + +L +   ++    + K  L E+S  L++
Sbjct: 1011 KFQKLLQNSERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLKE 1070

Query: 1060 KLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLK 1119
            ++ D+ E I  FKS E+EMKN+LEKLNSL  ++K EI   E+ L +L IRDVT  L  L 
Sbjct: 1071 QMEDMEESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLD 1130

Query: 1120 DESNNASDPXXXXXXXXXXXXXXXXXGKDENKDLDAQD--QVQDAEKQGDN--QMDVEDG 1175
            D   N  D                     E +  + QD  +++DAE   DN   M++++ 
Sbjct: 1131 D---NKMDSVKEDVKNNQELDQ-------EYRSCETQDESEIKDAETSCDNYHPMNIDET 1180

Query: 1176 GEYSDRGLTQFSXXXXXXXXXXXXXXXXXXXQNFLDASNADIDVLEEYARRLIEFKSRRL 1235
             +   RG+ + S                     +++ +N DI VLEEYARRL EFK R+L
Sbjct: 1181 SDEVSRGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKL 1240

Query: 1236 DLNQAVEERNXXXXXXXXXXXXRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLD 1295
            DLN AV++R+            RFDEFM GF IISMTLKEMYQMITMGGNAELELVD+LD
Sbjct: 1241 DLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLD 1300

Query: 1296 PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1355
            PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR
Sbjct: 1301 PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1360

Query: 1356 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFV 1410
            NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG+YKRDN+TKS TIKNID +
Sbjct: 1361 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDIL 1415

>NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8.259
            YLR086W
          Length = 1409

 Score = 1447 bits (3747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 767/1410 (54%), Positives = 1010/1410 (71%), Gaps = 28/1410 (1%)

Query: 8    SKRQKVDGLNQIDGKHPTVDL-DQGENLSL------PTTSSSQNTFAHAK--TPRKLVVG 58
            +KRQKV    + + K P     DQ  N SL      P    S +   ++K  TPRKL++G
Sbjct: 6    TKRQKV---TEPESKTPEQGTEDQQANASLRSPLQRPEHQQSISPINNSKSHTPRKLILG 62

Query: 59   NGDNRYAHXXXXXXXXXXXXXX-XXXXATSSRGRGS-KTYXXXXXXXXXXXXXXKLELIQ 116
              DNRYA                    ++SSRGR   K+Y              +LELIQ
Sbjct: 63   QNDNRYAFSQPSVSSSSFQVPTLQPPDSSSSRGRKDIKSYSQSPPRSPGRSPKRRLELIQ 122

Query: 117  ISPLKNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPN 176
            +SP+KN+R++L+++YDA  +Q++  RL I++L L +FKSYAG+QVVGPF+TSFSAVVGPN
Sbjct: 123  LSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPN 182

Query: 177  GSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGET 236
            GSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE++P L SCSV+V F Y IDE  G+T
Sbjct: 183  GSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDT 242

Query: 237  RIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVEN 296
            +I E KP LV++RKAF+NN+SKYY+N +E+NY +VTKLLK+EG+DLDHKRFLILQGEVEN
Sbjct: 243  KISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVEN 302

Query: 297  IAQMKSKAXXXXXXXXXXXXXXIIGTAKYKPLIEKNLADMESLNDICIEKENRFQIVDRE 356
            IAQMK KA              IIGT+KYK LIEK+L ++ESLN+ICIEKENRF+IVDRE
Sbjct: 303  IAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDRE 362

Query: 357  KNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDK 416
            KNSLE+GK  AL FLE E++LT+SKSKL QY++  +N KL NTL KI+ LN++   E  K
Sbjct: 363  KNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSK 422

Query: 417  NASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKA 476
            N +++ E+++ +   +E +SK+K    EEKQ L  KR L+G++V  +EK+KN  +K+ K 
Sbjct: 423  NQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKT 482

Query: 477  EKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGI 536
            EK +++ +++ISS  + + EL++ Q +Y + L+ LN+Q + E+  LE +K  LK+KT+GI
Sbjct: 483  EKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGI 542

Query: 537  SLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQI 596
            S EI   E +LEPWN ++QEKKT+IQL ESQISL++E + KL  +I    QE+  +    
Sbjct: 543  SEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALK 602

Query: 597  LQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKALDARSALSNAE 656
            ++  ++L +L  Q  S+ +EIS GE EC + R +LKEM+N+LN QRQ+A +AR AL+N +
Sbjct: 603  IKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLALANVQ 662

Query: 657  NKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVETVECGQQC 716
            N+ KVLTAL +LQKSGRI GFHGRLGDLG ID  YDVA+STACPRL+DIVVETVECGQQC
Sbjct: 663  NRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETVECGQQC 722

Query: 717  IEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSSAFFSVLGNTL 776
            IEYLRKNKLGYARFILLDKLR FN ++I TP++VPRLFDLI PKD KF  AF+SVL +TL
Sbjct: 723  IEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSVLRDTL 782

Query: 777  VANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRNKTEDIEIYS 836
            VA DLKQANRVAYG++R+RVVTLDG LID+SGTMSGGG+ VS+GLM + R      + Y+
Sbjct: 783  VAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNYFDDYN 842

Query: 837  SEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEI 896
             E+V Q+E +L ++EKNF++A++  Y+ME +L+ L  ++P IE  IS++ MEI+++++EI
Sbjct: 843  PEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEI 902

Query: 897  KIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEIM 956
            K KE Q+ E     ++   +N EL+  I+++Q LK+E  ++Q++TK+KK +I +LK +IM
Sbjct: 903  KSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIM 962

Query: 957  EIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETSRDLENFN 1016
            +IGG EL++Q+SKV S++QRIDI+ +KQKK+R+  KK++ E+ K+ K  L +  D+    
Sbjct: 963  KIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITLIT 1022

Query: 1017 QEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDINEDIAIFKSFEM 1076
             +I+ +   I+ +  SLN + +S+   Q  KE L +E   L+DK+ D+ E+I  FKSFE+
Sbjct: 1023 DDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSFEI 1082

Query: 1077 EMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDESNNASDPXXXXXXXX 1136
            E+ N+LEKLN L  H+K +IK  E+ L  L +R + Q+L  L DE + A  P        
Sbjct: 1083 EVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMAL-DEESEAKAPNNGTLS-- 1139

Query: 1137 XXXXXXXXXGKDENKDLDAQDQVQDAEKQGDNQMDVEDGGEYSDRGLTQFSXXXXXXXXX 1196
                       DE        ++ +   Q D+ MD+++G E    GL   S         
Sbjct: 1140 -----------DEQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSALDI 1188

Query: 1197 XXXXXXXXXXQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAVEERNXXXXXXXXXXX 1256
                      + ++++++A+I+VLEEY +RL EFK+R+LDLN AV++R            
Sbjct: 1189 TLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKK 1248

Query: 1257 XRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVTFSVMPPKKSWRNIT 1316
             R++EFM GFGIISMTLKEMYQMITMGGNAELELVD+LDPFSEGVTFSVMPPKKSWRNI+
Sbjct: 1249 TRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIS 1308

Query: 1317 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1376
            NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI
Sbjct: 1309 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1368

Query: 1377 SLRNNMFELAQQLVGIYKRDNKTKSATIKN 1406
            SLRNNMFELAQQLVGIYK +N+T SATIKN
Sbjct: 1369 SLRNNMFELAQQLVGIYKCENRTHSATIKN 1398

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 1399 bits (3620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 741/1420 (52%), Positives = 1004/1420 (70%), Gaps = 23/1420 (1%)

Query: 7    LSKRQKVDGLNQIDGKHPTVDLDQGEN-LSLPTTSSSQNTFAHAKTPRKLVVGNGDNRYA 65
            LSK+QKV      D +  T + ++ +N  + P  ++S  +F  + TPRKL++G+ DN+Y 
Sbjct: 6    LSKKQKVVS----DEERITPNQNEQDNDKTHPEVTAS--SFLKSHTPRKLLLGSADNKYV 59

Query: 66   ------HXXXXXXXXXXXXXXXXXXATSSRGRGSKTYXXXXXXXXXXXXXXKLELIQISP 119
                                     +  SRGR  K Y              KLELIQ+SP
Sbjct: 60   LSQPIISSSSHGSSSLQVPNLQPPLSQPSRGRDKKAYSQSPPRSPGRSPVRKLELIQLSP 119

Query: 120  LKNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSG 179
            +KN+R+ELQK+Y+++ NQ +  RL ID+L+LQDFKSYAG Q+VGPFNTSFSA+VGPNGSG
Sbjct: 120  IKNNRIELQKLYNSK-NQNK-VRLYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSG 177

Query: 180  KSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRID 239
            KSNVIDSMLFVFGFRANKMRQDRL DLIHKSE +P++ SCSVEVHF+YVIDE  G ++I 
Sbjct: 178  KSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKII 237

Query: 240  EEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQ 299
            E++  LVV RKAF+NN+SKYY+N +E+NY EVT+LLK+EG+DLDHKRFLILQGEVENIAQ
Sbjct: 238  EDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQ 297

Query: 300  MKSKAXXXXXXXXXXXXXXIIGTAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNS 359
            MK+KA              IIGT+KYK LIE  + ++E+LN+IC+EKE RF+IV+ EKNS
Sbjct: 298  MKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNS 357

Query: 360  LENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNAS 419
            LE+ K+ AL F+  E++LT+ +SKL QY +  +N KL  TLDKI+N    L++E  K   
Sbjct: 358  LESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEK 417

Query: 420  VKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKT 479
            ++ E+D+      E   K+     +E++L+ KKRE DG+ V  EE+IKN  +K+ KAEKT
Sbjct: 418  IQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQKKTKAEKT 477

Query: 480  LSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLE 539
            L      I  +E+ L +L+  Q++Y++    L ++ + E+ KL+ IK SLKDKT  IS +
Sbjct: 478  LHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERSKLDDIKLSLKDKTKDISSQ 537

Query: 540  IAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQG 599
            I+  EK++EPW +++QEK+ QIQLAES+ISL+KE++AKL + +   K EI+  +++I   
Sbjct: 538  ISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDNK 597

Query: 600  SKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKALDARSALSNAENKS 659
            +  +++L  +  S+K+E+S GE EC  A+ + KEM+ ILN+ RQ+A+DARSAL  AENKS
Sbjct: 598  NSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSALHMAENKS 657

Query: 660  KVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVETVECGQQCIEY 719
             VL+AL+RLQKSGRI+GFHGRLGDLGVI +KYD+AISTAC RL+DIVV++VECGQQCIEY
Sbjct: 658  TVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDDIVVDSVECGQQCIEY 717

Query: 720  LRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSSAFFSVLGNTLVAN 779
            LRKNKLGYARFILLDKLR F L  + TPE+V RLFDL+ P D KFS+AF+SVL +TLVA 
Sbjct: 718  LRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDTLVAT 777

Query: 780  DLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRNKTEDIEIYSSEE 839
            D++QANRVAYGK+R+RVVTLDG LIDISGTM+GGGS VS+GLM++  +  E +E+Y + +
Sbjct: 778  DIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKLKNSNMEHLEVYEAGD 837

Query: 840  VAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIK 899
            V ++E +L ERE NF++A DT+ +M  +LK L++KEP IE  I++L M+++S N ++ +K
Sbjct: 838  VEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLLMDVDSLNDQLNLK 897

Query: 900  EIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIG 959
            E Q+ E E+ Y+   +    L      +Q+L++E +++++Q++SKK +I TLK EIM+IG
Sbjct: 898  EQQLKELEKNYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKEKINTLKEEIMKIG 957

Query: 960  GAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETSRDLENFNQEI 1019
            G EL+IQ+SKV S+ +RI IV +K KK+++ IK+TE E+ K  ++  +   D      ++
Sbjct: 958  GKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFKQAELDNTACVNDL 1017

Query: 1020 QTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDINEDIAIFKSFEMEMK 1079
            +TL+T +  ++  L +       + + K+ L  +  +L++K+ D+ E +  +KSFE+E+K
Sbjct: 1018 ETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEESMNEYKSFEIEIK 1077

Query: 1080 NELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDE-SNNASDPXXXXXXXXXX 1138
            N+LEKLNSL  + KK+I+   ++L    +RDVTQ L  +++E +NN+             
Sbjct: 1078 NKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENANNSVGVKQSSNNLDVS 1137

Query: 1139 XXXXXXXGKD------ENKDLDAQDQVQDAEKQGDNQMDVEDGGEYSDRGLTQFSXXXXX 1192
                    K       E+ D D+Q+++++ E+  D  MD+++  E   +G+ + +     
Sbjct: 1138 SSHTPNVDKHDDEISMEDADNDSQNEIEEKEQDAD-IMDLDNVTEEVSKGIPKLTDDDLK 1196

Query: 1193 XXXXXXXXXXXXXXQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAVEERNXXXXXXX 1252
                          Q++++ SNADI++LEEY RRL EFK R+LDLN  V  R+       
Sbjct: 1197 SIDLDSLESEINQLQDYVENSNADIELLEEYIRRLEEFKKRKLDLNTTVARRDEVRDELE 1256

Query: 1253 XXXXXRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVTFSVMPPKKSW 1312
                 R DEFM+GF IIS+TLKEMYQMITMGGNAELELVD+LDPFSEGVTFSVMPPKKSW
Sbjct: 1257 KLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSW 1316

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQ 1372
            RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQ
Sbjct: 1317 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQ 1376

Query: 1373 FIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFVSV 1412
            FIVISLRNNMFELAQQLVGIYKR N T+SAT+KN D ++ 
Sbjct: 1377 FIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILNC 1416

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 1383 bits (3580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 752/1429 (52%), Positives = 988/1429 (69%), Gaps = 32/1429 (2%)

Query: 4    DDSLSKRQKV--DGLNQIDGKHPTVDL---DQGENLSLPTTSSSQNTFAHAKTPRKLVVG 58
            D  L+K+QK   D   QI   +PTV       G +L    +S ++     + TPRKLV+G
Sbjct: 3    DSPLAKKQKTRTDDRGQIQS-NPTVSPIPPVSGSSLMAVKSSPTRQDRLPSPTPRKLVLG 61

Query: 59   NGDNRYAHXXXXXXXXXXXXXXXXXXATSSRGRG--SKTYXXXXXXXXXXXXXXKLELIQ 116
            + + +YA+                     SRGR   S++               +LELIQ
Sbjct: 62   SPEKKYAYSQPSTSSSLSVPNLQPPNVDGSRGRRFYSQSPPRSPHRSPNRSPTRRLELIQ 121

Query: 117  ISPLKNSRLELQKIYDAQQ---NQARHTRLCIDQLILQDFKSYAGRQVVGPFNTSFSAVV 173
            +SP+KN+R ELQKIYD +    NQ  H RLCID+L L +FKSYAG Q++GPF+TSFSAVV
Sbjct: 122  LSPVKNNRAELQKIYDEKNKDGNQCVH-RLCIDKLSLHNFKSYAGTQIIGPFHTSFSAVV 180

Query: 174  GPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFKYVIDEPS 233
            GPNGSGKSNVIDSMLFVFGFRANKMRQ +LSDLIHKSE YP+L SCSV++HF+YV+DE  
Sbjct: 181  GPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDIHFRYVVDESD 240

Query: 234  GETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGE 293
            G TR D+EKP +V+TRKAFRNN+SKYY++ +E+NY EVT+LL+ +G+DLDHKRFLILQGE
Sbjct: 241  GTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGE 300

Query: 294  VENIAQMKSKAXXXXXXXXXXXXXXIIGTAKYKPLIEKNLADMESLNDICIEKENRFQIV 353
            VE+I+QMK KA              IIGTAKYK  IE  L ++++LND+C+EKENRF++V
Sbjct: 301  VESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELV 360

Query: 354  DREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKE 413
            ++EKNSLE+GK+EAL FLE E+ LT+ KSKL QYHI     KL  TL KI+ LN+ L +E
Sbjct: 361  EKEKNSLESGKDEALEFLEKEKSLTLLKSKLAQYHIWQDQRKLSETLGKISELNEHLGQE 420

Query: 414  SDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKR 473
              K    ++E+ +LR   ++ + ++   + E K L  K+R +D +    EEK +N +KKR
Sbjct: 421  KAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKR 480

Query: 474  DKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKT 533
             KAEK L S + S++ S+ +L EL   Q  Y+  L +LNE    E+ KL++IK SL+DKT
Sbjct: 481  LKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKT 540

Query: 534  NGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRK 593
            + IS EIA  E++LEPWNAQLQEKK+Q++L ESQI+++KE++ K  Q I Q K EIE   
Sbjct: 541  SEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAFA 600

Query: 594  QQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKALDARSALS 653
            ++       +  L  +  ++ + I  GEKEC +A  +L EM+N+L + RQ+A++ARS LS
Sbjct: 601  EKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEARSTLS 660

Query: 654  NAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVETVECG 713
            N ENK+KVL+AL RLQ+SGRI+GFHGRLGDLG ID+ YDVAISTACPRL+DIVV+ VECG
Sbjct: 661  NVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLDDIVVDNVECG 720

Query: 714  QQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSSAFFSVLG 773
            QQCIE+LRKNKLGYARFI+LDKLRKFNL  I TPE+VPRLFDL+  K+ KF  AF+SVL 
Sbjct: 721  QQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGKFLPAFYSVLR 780

Query: 774  NTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRNKTEDIE 833
            +TLV +DLKQANRVAYGK+RFRVVTLDG LID SGT+SGGG+ V +GLM   ++K +   
Sbjct: 781  DTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLM---KSKQQPGA 837

Query: 834  IYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEIESWN 893
             Y+ EEV  +E  L EREKNF +A +T + MEE LK  K++EP IE  I++  ++IES +
Sbjct: 838  GYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKRRLDIESSS 897

Query: 894  SEIKIKEIQM--LESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIETL 951
            +E+K+K+ Q+  LE++R   + +D   EL +    +Q L +E+  I+N+TK+K+  I +L
Sbjct: 898  TELKLKQEQLKELETDRDGGSVEDR--ELADAESKLQVLSEEYDEIENETKNKQQLINSL 955

Query: 952  KNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETSRD 1011
            K +IM+IGG +L++Q+SKV+S+ ++I+I+ SKQKK+R+  KK EN++ +      E S D
Sbjct: 956  KEKIMKIGGTKLQLQNSKVNSINEQINIISSKQKKDRTATKKAENDLKRLENQCREASND 1015

Query: 1012 LENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDINEDIAIF 1071
            +E+ N EI  +      L+  + K+  S+   +  KE + EE   ++  L +   + + F
Sbjct: 1016 IESCNLEISKISVLNTELEAKIYKLDTSLNETESLKEEVEEEFERVKTNLEEKTNNTSDF 1075

Query: 1072 KSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDESNNASDPXXX 1131
            KS E+E+ N LEKLN L+ H+KKEIK+ +++L  LKIRD+TQ L  L    N    P   
Sbjct: 1076 KSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQAL----NEGKLPEEN 1131

Query: 1132 XXXXXXXXXXXXXXGKDENKDLDAQ--DQVQDAE----KQGDNQMDVEDGGEY---SDRG 1182
                           ++ + D +A   D+ Q AE    +Q D ++D  D  EY   +  G
Sbjct: 1132 EDDFEVQDEEVQREQREMSSDPNAMDIDEEQAAEQFQVQQTDGEIDSMDIDEYENETSNG 1191

Query: 1183 LTQFSXXXXXXXXXXXXXXXXXXXQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAVE 1242
            L +FS                    +++D ++ DIDVLEEYARRL E+K R+LDLNQAV 
Sbjct: 1192 LPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLNQAVL 1251

Query: 1243 ERNXXXXXXXXXXXXRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVT 1302
            +R+            R D+FM+GF IISMTLKEMYQMITMGGNAELELVD+LDPFSEGV 
Sbjct: 1252 KRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVL 1311

Query: 1303 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1362
            FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVAN
Sbjct: 1312 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVAN 1371

Query: 1363 YIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFVS 1411
            YIKERTKNAQFIVISLRNNMFELAQQLVGIYK +N T+S T++NID ++
Sbjct: 1372 YIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILN 1420

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 1371 bits (3549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 728/1389 (52%), Positives = 980/1389 (70%), Gaps = 17/1389 (1%)

Query: 37   PTTSSSQNTFAH----AKTPRKLVVGNGDNRYAHXXXXXXXXXXXXXXXXXXAT--SSRG 90
            PTT  +    +H    ++TP+KL++ + D+                       T  SSRG
Sbjct: 40   PTTQDAA-AVSHLNFKSQTPKKLILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESSSRG 98

Query: 91   RGSKTYXXXX----XXXXXXXXXXKLELIQISPLKNSRLELQKIYDAQQNQARHTRLCID 146
            R ++TY                  KLELIQ+SP+KNSR+ LQKIY+++ N+ +  RLCID
Sbjct: 99   RTARTYSQSPPRSPARSPARSPTRKLELIQLSPVKNSRIALQKIYESK-NEKQIERLCID 157

Query: 147  QLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDL 206
            +L+L DFKSYAG QVVGPF++SFSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQDRLSDL
Sbjct: 158  KLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDL 217

Query: 207  IHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQET 266
            IHKSE +P L SCSVEVHF+YVID+P G T I+  K  LV+TRKAF+NNTSKYY+N +E+
Sbjct: 218  IHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKES 277

Query: 267  NYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGTAKYK 326
            NY  VTKLLK EG+DLDH RFLILQGEVENIAQMK KA              IIGTAKYK
Sbjct: 278  NYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPKAENDGDDGLLEYLEDIIGTAKYK 337

Query: 327  PLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQ 386
            PLIEK   ++E+LN+ICIEKENRF+IVDREK SLE+GK+EAL FLE E++LT+ KSKLYQ
Sbjct: 338  PLIEKKFEEIEALNEICIEKENRFEIVDREKASLESGKDEALEFLEKEKELTLVKSKLYQ 397

Query: 387  YHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEK 446
            Y +   N KL  TL+K++N+ ++ E+   K+++ + +++++     E+   +K    +EK
Sbjct: 398  YKLWQDNKKLSTTLEKLSNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEK 457

Query: 447  QLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYEN 506
            +L  +KR  D + V  EE+ KN  KK+ K EK L   +++IS+++ ++ +L + + +YE+
Sbjct: 458  KLNIQKRNYDTERVSLEEQRKNIMKKKKKMEKELEDCNKTISNTKIKIEDLGKNESEYES 517

Query: 507  SLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAES 566
             L ELN Q ++E+  LE+IK SLKDKT   S EI+Q EKELEPWN QLQ KK+QIQ+ ES
Sbjct: 518  QLDELNAQLQIERGLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKES 577

Query: 567  QISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLN 626
            +ISLIKE   KL  +I+     I  + ++ +   KE+ SL ++   + +E+S G+ E  N
Sbjct: 578  EISLIKEGRVKLENDIENLNSLISVKIEEKISREKEIGSLRNELNRITKEVSIGDTEYTN 637

Query: 627  ARIRLKEMQNILNTQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGV 686
            A+ +L+EM+ +LN  RQKA+DAR++LS  ENK++VL +L RLQKSGRISGF+GRLGDLG 
Sbjct: 638  AKEKLREMKAVLNQHRQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGA 697

Query: 687  IDEKYDVAISTACPRLEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINT 746
            ID++YD+AISTACPRL D+VVETVECGQQCIEYLRKNKLGYARFILL+KLR F+++ I+T
Sbjct: 698  IDDRYDIAISTACPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKIST 757

Query: 747  PESVPRLFDLIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDI 806
            P +VPRLFDL+   DPKF  AF+SVL +TLV N+LK ANRVAYG KRFRVVTL G LID+
Sbjct: 758  PNNVPRLFDLVISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDV 817

Query: 807  SGTMSGGGSRVSRGLMQINRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEE 866
            SGTMSGGG++ SRGLM++ ++     + Y+ E+V ++E  L  REKNF++A++T  +ME 
Sbjct: 818  SGTMSGGGTQTSRGLMKLTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMET 877

Query: 867  QLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQH 926
            +L+ LK+++P +E  IS+  +EI SW +E ++ + Q+ E +++      NN EL      
Sbjct: 878  ELRRLKDRKPDVELEISKFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHE 937

Query: 927  VQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKK 986
            + +L++++KS+Q +TKSKK RI+ LK+EIM++GG +L++QSSKVDS+IQ+ DI+  K KK
Sbjct: 938  LGTLQNDYKSLQLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDILNGKHKK 997

Query: 987  ERSVIKKTENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHT 1046
            +++ +KK E E+ +  K + E S DL     +++     +  +  SL++    +  ++ +
Sbjct: 998  DKNDLKKAETELKRLSKKQSECSTDLLTSTDKLENTDGQLSKISKSLSETETLLHELEFS 1057

Query: 1047 KEGLIEESRTLEDKLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDL 1106
            +E  ++ S  L+D+L +  E++  FK F++E +N+ EKLN+L   +KK+I+  + +L  L
Sbjct: 1058 REESLQNSENLKDQLKEFEENLNSFKVFQLEHQNKEEKLNNLLNFIKKDIRSTDSELQSL 1117

Query: 1107 KIRDVTQILHDLKDESNNASDPXXXXXXXXXXXXXXXXXGKDENKD-LDAQDQVQDAEKQ 1165
            KIRD+T  L +L + + +  +                  G  EN + ++ +    D    
Sbjct: 1118 KIRDITHTLQELDNGNIDQDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPD 1177

Query: 1166 GDNQMDV---EDGGEYSDRGLTQFSXXXXXXXXXXXXXXXXXXXQNFLDASNADIDVLEE 1222
             +N +++   ED  E S +G+ + S                   Q+++D  N +IDVLEE
Sbjct: 1178 ANNDLEMEIDEDNNEIS-KGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEE 1236

Query: 1223 YARRLIEFKSRRLDLNQAVEERNXXXXXXXXXXXXRFDEFMQGFGIISMTLKEMYQMITM 1282
            YARR+ E+K R+LDLN AV+ER             RF+EFMQGFG+IS+TLKEMYQMITM
Sbjct: 1237 YARRVAEYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITM 1296

Query: 1283 GGNAELELVDTLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPL 1342
            GGNAELELVD+LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPL
Sbjct: 1297 GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPL 1356

Query: 1343 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSA 1402
            YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK +N+TKSA
Sbjct: 1357 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSA 1416

Query: 1403 TIKNIDFVS 1411
            T++N D ++
Sbjct: 1417 TLQNNDIIN 1425

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 1347 bits (3486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 697/1328 (52%), Positives = 936/1328 (70%), Gaps = 18/1328 (1%)

Query: 90   GRGSKTYXXXXXXXXXXXXXXKLELIQISPLKNSRLELQKIYDAQQNQARHTRLCIDQLI 149
             RG   Y               +ELIQ+SP+KNSRLELQ++YD +Q +    RLCI  L+
Sbjct: 55   SRGRSQYSQSPPRSPNRSPGRAVELIQLSPIKNSRLELQRLYDTKQKKVE--RLCIRTLV 112

Query: 150  LQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHK 209
            L++FKSYAGRQVVGPF++SFSAVVGPNGSGKSNVIDSMLF FGFRANKMRQ +LS LIHK
Sbjct: 113  LENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHK 172

Query: 210  SEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYG 269
            SE+YP L  CSVE+ F+YV+DEP G TR+   KP L V RKAF+NNTSKYY+N +E+ Y 
Sbjct: 173  SEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYT 232

Query: 270  EVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGTAKYKPLI 329
            EVT+LL+ EG+DLDHKRFLILQGEVE+IAQMK KA              IIGT KYK  I
Sbjct: 233  EVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQI 292

Query: 330  EKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHI 389
            E+ L +++SLNDIC+EKENRF +V++EK SLE GK+EAL FL+ E+ LT+  SK YQYH+
Sbjct: 293  EQALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHL 352

Query: 390  LNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLL 449
             ++  KL  TL  ++N   KLE+E  K    +KE+ +L    ++L ++L + NN  K+ L
Sbjct: 353  FHNGSKLAKTLSNVSNTMNKLEQEKAKKVEAQKEIVELTDASEQLANRLVSMNNTNKESL 412

Query: 450  GKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLK 509
             K R+L+ + V NEEK K+  +KR KAEKTL+++++SI   E ++ E      +YE SL 
Sbjct: 413  AKMRQLERELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLT 472

Query: 510  ELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQIS 569
             LN      + +LEK+K +L DKT  I+ E+A LEKELEPW  +++EKK++I+L ES+IS
Sbjct: 473  TLNHTIVDAQAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEIS 532

Query: 570  LIKEAEAKLAQEIDQFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARI 629
            +IKEA+ KL  EI    QEIE  +  I    + +++L+ +  S+++ I  GE+EC +AR 
Sbjct: 533  IIKEADLKLESEIANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARS 592

Query: 630  RLKEMQNILNTQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDE 689
            +L+EM+ +L T RQ+  DARSA+S+AENK+KVLTALSRLQKSGRI G+HGRLGDLG ID+
Sbjct: 593  KLEEMKKVLVTHRQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDD 652

Query: 690  KYDVAISTACPRLEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPES 749
            KYD+AISTACPRL+DIVV+TVECGQQCIE+LRKNKLGYARFILLDKLRKFNL   +TPE+
Sbjct: 653  KYDIAISTACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPEN 712

Query: 750  VPRLFDLIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGT 809
            VPRLFDL+ PK+PKF+ AF+SVL +TLV  DL QANRVAYGKKR+RVVTLDG LIDISGT
Sbjct: 713  VPRLFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGT 772

Query: 810  MSGGGSRVSRGLMQINRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLK 869
            M+GGG R + GLM+     T+   +Y+ EEV ++E  L EREKNF+VA +T  +ME  L+
Sbjct: 773  MTGGGDRAASGLMK----STQQSSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQ 828

Query: 870  DLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQS 929
            +  +++P IE  +S+  M+IE+ ++E++ K  + LE ER+   + +++ ELR   + + +
Sbjct: 829  NYLDRQPEIEVELSKQKMDIETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAA 888

Query: 930  LKDEFKSIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERS 989
            L  +  S  + ++SK  RI+ L+ +IMEIGG EL+  +SKVDS+ Q+I IV +KQKK+++
Sbjct: 889  LNADLNSFMSASESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNQQIKIVAAKQKKDKT 948

Query: 990  VIKKTENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEG 1049
              KK E E+ ++ K ++    D+E+ + EIQ +K++ + +   + ++ + ++ +Q     
Sbjct: 949  AQKKAELELKRARKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGT 1008

Query: 1050 LIEESRTLEDKLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIR 1109
            L +E    + +L+  NE I  + S E+E+  +L+KL +L+ +LKKE+  Y+ KL  LK+R
Sbjct: 1009 LTDEHAVTKHELDQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLR 1068

Query: 1110 DVTQILHDLKDESN-----NASDPXXXXXXXXXXXXXXXXXGKDENKDLDAQDQVQDAEK 1164
            D+ Q++ DL++  +     ++  P                     N     + ++  AE 
Sbjct: 1069 DLGQVMLDLEENKSLQSFSHSPTPDTKRENIQSSMLETHLASPSPN-----ERKISIAE- 1122

Query: 1165 QGDNQMDVEDGGEYSDRGLTQFSXXXXXXXXXXXXXXXXXXXQNFLDASNADIDVLEEYA 1224
              +  M+V++     + GL +                     Q+++D S  DI++L+EYA
Sbjct: 1123 -NNLSMEVDEQASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYA 1181

Query: 1225 RRLIEFKSRRLDLNQAVEERNXXXXXXXXXXXXRFDEFMQGFGIISMTLKEMYQMITMGG 1284
            +RL E++ RR+DLN+A+ +R+            R DEFM+GFGIIS+TLKEMYQMITMGG
Sbjct: 1182 KRLAEYRRRRIDLNEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGG 1241

Query: 1285 NAELELVDTLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYV 1344
            NAELELVD+LDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYV
Sbjct: 1242 NAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYV 1301

Query: 1345 MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATI 1404
            MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ+LVGIYK  N T+S T+
Sbjct: 1302 MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTL 1361

Query: 1405 KNIDFVSV 1412
            +N D ++V
Sbjct: 1362 QNRDIINV 1369

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 1336 bits (3457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 710/1377 (51%), Positives = 951/1377 (69%), Gaps = 19/1377 (1%)

Query: 47   AHAKTPRKLVVGNGDNRYAHXXXXXXXXXXXXXXXXXXA--TSSRGRGSKTYXXXXXXXX 104
            + ++TPRKLV+G+ D R+A                   +  +SSRGR    Y        
Sbjct: 32   SRSRTPRKLVLGSPDKRFAFSQPVTSSSSNVPYLQPLKSELSSSRGR---VYSQSPPRSP 88

Query: 105  XXXXXXKLELIQISPLKNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVGP 164
                  KLELIQ+SP K +RLE QK    +       RLCI++L L +FKSYAG QVVGP
Sbjct: 89   TRSPTRKLELIQLSPTKKTRLESQKTEQVRGLAQPIERLCINRLSLHNFKSYAGTQVVGP 148

Query: 165  FNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVH 224
            F++SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LSDLIHKSE +P+L SC VEV 
Sbjct: 149  FHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDSCHVEVF 208

Query: 225  FKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDH 284
            F+YV DE  G T + +++P LVVTRKAF+NNTSKYYVN +E++Y +VT+LL+KEG+DLDH
Sbjct: 209  FQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDH 268

Query: 285  KRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGTAKYKPLIEKNLADMESLNDICI 344
            KRFLILQGEVE+IAQMK KA              IIGTAKYKPLIE+ L  ++ LND+C 
Sbjct: 269  KRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQ 328

Query: 345  EKENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKIT 404
            EKENR++IV+REK+SLE+GK+EAL FLE E+KLT  +SKL Q+ +  ++ K  NT +KI 
Sbjct: 329  EKENRYEIVEREKSSLESGKDEALEFLEKEKKLTFLRSKLLQHKLWKNSFKSTNTQEKIK 388

Query: 405  NLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEE 464
             L +KL  E  K    K+E+ +L +    L   ++   + E  L  +KR  D   V  EE
Sbjct: 389  TLEEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDRVSLEE 448

Query: 465  KIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEK 524
            K+KN  +K+ KAEKT  +   SI++++A+L EL + QV YE  L ELN+   VEK KL++
Sbjct: 449  KLKNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDE 508

Query: 525  IKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQ 584
            IK SLK KT  IS++I ++E+ELEPWN +LQEK++QI+L E++IS++KE+ AK+A+EI +
Sbjct: 509  IKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISK 568

Query: 585  FKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQK 644
             + +I   ++++ +  + ++ L  +H  ++ +I  G+ EC NA  ++KEM+ +L T RQ+
Sbjct: 569  SENDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQR 628

Query: 645  ALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLED 704
            +LDA+S+LS  ENK+KVL+AL RLQ+SGRISGFHGRLGDLG ID+KYDVAISTACPRL+D
Sbjct: 629  SLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDD 688

Query: 705  IVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKF 764
            +VVETVECGQQCIE+LRKNKLGYARFILLDKLR FN+++I TP +V RLFDL+HP D KF
Sbjct: 689  VVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHPIDNKF 748

Query: 765  SSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQI 824
             +AF+SVL +TLVA DLK+ANRVAYGK+RFRVVTLDG LID+SGTMSGGG+  + G+M+ 
Sbjct: 749  RNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMMKS 808

Query: 825  NRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQ 884
             R  T     +++EEV Q++  L ERE+NF++A+DT+++ME+ L+ LK++EP IE +IS+
Sbjct: 809  ERLNTG--ASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETDISK 866

Query: 885  LTMEIESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSK 944
              MEI+S  SEIK+ E +    ++     + ++  L E    + SLK E K ++ + KSK
Sbjct: 867  RRMEIDSLLSEIKLCEDRAASLKKEQKLNESSDDTLIEANSRLDSLKAECKLLEGEMKSK 926

Query: 945  KHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKM 1004
            K++I+ L+ +IM+IGG +L++Q S VDS+ QRI I + KQK++++ +KK EN++ +  K 
Sbjct: 927  KNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAVKKAENDLKRYEKQ 986

Query: 1005 KLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDI 1064
              + S D++    E++++K  I    + + ++  S+  +Q   E + E+ R +E  + + 
Sbjct: 987  AGQLSVDIDQCTNELESIKELISSSDNKILELEASIDKLQKEGEEIEEKVREIERLIEEK 1046

Query: 1065 NEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDESNN 1124
            + +   F  FE+++ N+LEKLN L  H+ K+     ++L  LKIRDVT  L  L    N 
Sbjct: 1047 SSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLKIRDVTATLQTL----NK 1102

Query: 1125 ASDPXXXXXXXXXXXXXXXXXGKDENKDLDAQDQVQDA------EKQGDNQMDVEDGGEY 1178
                                  +  N DL   D V+          Q ++QMDV++  E 
Sbjct: 1103 LLLSESRSGDELHGQSSEARSQEPSNGDLMEVDTVEGCMGNEPTASQPEDQMDVDEPEEM 1162

Query: 1179 --SDRGLTQFSXXXXXXXXXXXXXXXXXXXQNFLDASNADIDVLEEYARRLIEFKSRRLD 1236
              S   L + +                    +F++ + ADI+VLEEY +RL++F++R+L+
Sbjct: 1163 ETSPSDLPKLTEAQLKELNVEEVELEIGQLNDFVENAYADIEVLEEYTKRLVDFQARKLE 1222

Query: 1237 LNQAVEERNXXXXXXXXXXXXRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDP 1296
            LN+AVE+R+            R DEFM GF  ISMTLKEMYQMITMGGNAELELVD+LDP
Sbjct: 1223 LNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSLDP 1282

Query: 1297 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1356
            FSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN
Sbjct: 1283 FSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1342

Query: 1357 VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFVSVS 1413
            VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK  N TKS  ++N D ++ S
Sbjct: 1343 VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLINRS 1399

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 1335 bits (3454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 708/1390 (50%), Positives = 962/1390 (69%), Gaps = 18/1390 (1%)

Query: 35   SLPTTSSSQNT--FAHAKTPRKLVVGNGDNRYAHXXXXXXXXXXXXXXXXXX-----ATS 87
            SLP   SS +   F    TPRKL++G  +N+YA                        +  
Sbjct: 49   SLPKLQSSVSPLDFKKTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQD 108

Query: 88   SRGRGSKTYXXXXXXXX----XXXXXXKLELIQISPLKNSRLELQKIYDAQQNQ-ARHTR 142
            SRGR  K Y                  KLELIQ+SP+KNSRLELQK+YDA   +  +  R
Sbjct: 109  SRGRRIKMYSQSPPRSPGRSPNRSPVRKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNR 168

Query: 143  LCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 202
            L I +L+L +FKSYAG Q +GPF+ SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR
Sbjct: 169  LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 228

Query: 203  LSDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRID--EEKPNLVVTRKAFRNNTSKYY 260
            LSDLIHKSE + +L  CSVEVHF+YV DE +  T  D  E +  LV+TRKAF+NN+SKY+
Sbjct: 229  LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYF 288

Query: 261  VNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXII 320
            +N +E+N+ EVTKLLK++G+DLDHKRFLILQGEVENIAQMK+KA              II
Sbjct: 289  INGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDII 348

Query: 321  GTAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLTVS 380
            GT  YKPLIE+   ++E++N++CIEKENRF+IVD EKNSLE  K+ AL FLE E++LT+ 
Sbjct: 349  GTKHYKPLIEQKTVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAALEFLEKEKQLTLL 408

Query: 381  KSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKN 440
            KSKL QYH+  +N K+K TL +I +L    E+E  +++   KE++ L+   DE ++ L +
Sbjct: 409  KSKLTQYHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTS 468

Query: 441  CNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQL 500
               EEK L+ +KRE++ ++V  EE  KN ++K  KA+ T+ S    IS +E  L E  QL
Sbjct: 469  LTTEEKSLIQRKREINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNEHELQEQSQL 528

Query: 501  QVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQ 560
            Q +YE  + +L++Q EVE+  L  IK  LKDKT   S EIA +EKELEP N ++QEKK+Q
Sbjct: 529  QEEYEAEVNDLSKQREVEEKILLDIKLQLKDKTVTFSDEIASIEKELEPSNTEIQEKKSQ 588

Query: 561  IQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTG 620
            I+L E +I LI++++ K+  EI+  K+E+   ++ +    K++  L+   +++ +E   G
Sbjct: 589  IKLVEMEIDLIRDSKRKVGAEIESLKEELLKLQKDLEDNEKDVTDLNKSKRNLVKEKQEG 648

Query: 621  EKECLNARIRLKEMQNILNTQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGR 680
            +KEC +A ++L EM+ ILN+ RQK ++ARS +S A+NK+KVLT+L R+Q+SGRI+GFHGR
Sbjct: 649  DKECKDAGVKLNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGR 708

Query: 681  LGDLGVIDEKYDVAISTACPRLEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFN 740
            LGDLG+I ++YDVAISTACPRL+D+VVE+VECGQ CIE+LRKNKLGYARF++LDKL++F+
Sbjct: 709  LGDLGIIADQYDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFD 768

Query: 741  LDSINTPESVPRLFDLIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLD 800
            +  I TPE+VPRLFDL+ PK+ +F+ A +SVL +TLVA DLKQANRVAYGK+RFRVVTLD
Sbjct: 769  MSPIQTPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLD 828

Query: 801  GNLIDISGTMSGGGSRVSRGLMQINRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDT 860
            G LIDISGTMSGGGSRV +GLM +    +   EI+S E++ +LE+ L  REK F VAS+T
Sbjct: 829  GQLIDISGTMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASET 888

Query: 861  IYQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVEL 920
             + ME++L+ L ++EP +E  IS+  ++I++   +I++   Q+ E    Y  +  +  +L
Sbjct: 889  FHSMEQELRKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKDTDDL 948

Query: 921  RETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIV 980
               + ++++L  E K +Q+Q+K+   R+  LK+EIM IGG+EL++Q+SKV S+ QRIDI+
Sbjct: 949  DLLLGNLEALNQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDIL 1008

Query: 981  VSKQKKERSVIKKTENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESV 1040
             +K KK ++V+KK   E+ K+ K  + ++ +  N  +EI   K   E  ++SL  +++S+
Sbjct: 1009 QAKLKKSKTVVKKLNTELKKARKSLIASTEESTNSTEEIAHAKARAEVAKNSLLDINKSL 1068

Query: 1041 TSVQHTKEGLIEESRTLEDKLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYE 1100
             S+Q  K  L +E     DKL++ NE++  FK+ ++E++N++E+ NS+  +LKKE     
Sbjct: 1069 ESIQDEKINLEQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLL 1128

Query: 1101 EKLGDLKIRDVTQILHDLKDESNNASD--PXXXXXXXXXXXXXXXXXGKDENKDLDAQDQ 1158
            E+L + ++RDVT  L  L++E    ++  P                   D   +      
Sbjct: 1129 EELNNFRLRDVTHTLDLLREEEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSS 1188

Query: 1159 VQDAEKQGDNQ--MDVEDGGEYSDRGLTQFSXXXXXXXXXXXXXXXXXXXQNFLDASNAD 1216
            + ++ K   ++  MDV+D G+   +G+ + S                   Q+F++  + +
Sbjct: 1189 LSNSVKVASDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSIN 1248

Query: 1217 IDVLEEYARRLIEFKSRRLDLNQAVEERNXXXXXXXXXXXXRFDEFMQGFGIISMTLKEM 1276
            I++LEEYA+RL+EFK R++DLN +V ERN            R++EFM+GF IISMTLKEM
Sbjct: 1249 IEILEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEM 1308

Query: 1277 YQMITMGGNAELELVDTLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHK 1336
            YQMITMGGNAELELVD+LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHK
Sbjct: 1309 YQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHK 1368

Query: 1337 YKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRD 1396
            YKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK +
Sbjct: 1369 YKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHE 1428

Query: 1397 NKTKSATIKN 1406
            N TK+ATI+N
Sbjct: 1429 NMTKNATIRN 1438

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 1330 bits (3443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 716/1383 (51%), Positives = 962/1383 (69%), Gaps = 24/1383 (1%)

Query: 33   NLSLPTTSSSQNTFAHAKTPRKLVVGNGDNRYAHXXXXXXXXXXXXXXXXXXATSS---R 89
            +LS P  S S        TPRKL++   DNRYA                    TSS   R
Sbjct: 46   SLSPPAISKSH-------TPRKLILHQSDNRYAFSQPTVSASSLQVPSLQPPETSSSSSR 98

Query: 90   GRGS-KTYXXXXXXXXXXXXXXKLELIQISPLKNSRL-ELQKIYDAQQNQARHTRLCIDQ 147
            GR   K Y              KLELIQ+SP+KN+R+ +LQ++Y++Q    +  RL I++
Sbjct: 99   GRRDIKVYSQSPPRSPGRSPTRKLELIQLSPVKNNRIRKLQELYNSQ---IKKERLFINK 155

Query: 148  LILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 207
            L+L +FKSYAG QV+GPFNT+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI
Sbjct: 156  LVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 215

Query: 208  HKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETN 267
            HKSE +P+LPSCSV+V F+YV+D+ +G ++ID+ KP L++TRKAF+NN+SKY++N +E++
Sbjct: 216  HKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESS 275

Query: 268  YGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGTAKYKP 327
            Y EVTKLLK+EG+DLDHKRFLILQGEVENIAQMK KA              IIGTA YK 
Sbjct: 276  YTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKS 335

Query: 328  LIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQY 387
             IEKN  ++++LN+ICIEKENRF+IV+REKNSLE+ K  AL F++ ER+LT+SKSKL QY
Sbjct: 336  SIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQY 395

Query: 388  HILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQ 447
            +IL  + KL +TL K++ L ++ + ES K  + ++E +KL     ++  K+ +   + K 
Sbjct: 396  NILKEHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKN 455

Query: 448  LLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENS 507
               KKREL  K    EEKIK++ +K++KA K+++   + + +    +  L   Q + E++
Sbjct: 456  NTSKKRELQNKKASLEEKIKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDQQERESN 515

Query: 508  LKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQ 567
            L+ L  + + EK  LE+IK SLKDKT  IS EIAQ E+ELEPW  QLQEKK +IQ+AESQ
Sbjct: 516  LQSLLSELKKEKNVLEEIKLSLKDKTTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQ 575

Query: 568  ISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNA 627
            ISL++E ++KL  EI++ K +++ + +      ++L  L  Q  ++  E   GE EC NA
Sbjct: 576  ISLLQENQSKLKDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANA 635

Query: 628  RIRLKEMQNILNTQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVI 687
            + ++K+MQ++L TQRQK +DARS L+  ENKSKVL+AL +LQKSGRISGF+GRLGDLGVI
Sbjct: 636  KSKIKDMQHVLQTQRQKVMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVI 695

Query: 688  DEKYDVAISTACPRLEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTP 747
            D +YD+AISTA  RL+DIVV++VECGQ CIEYLRKNKLGYARFILL+KLR   L  I TP
Sbjct: 696  DNEYDIAISTASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTP 755

Query: 748  ESVPRLFDLIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDIS 807
            E+V RLFDL+ P    F  AF+SVL NTLVA DLKQANRVAYG  RFRVVT+DG LIDIS
Sbjct: 756  ENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDIS 815

Query: 808  GTMSGGGSRVSRGLMQINRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQ 867
            GT++GGG + ++GLM++ +   E+I+IYS++++ ++E  LVERE NF+ A+DT ++ME+ 
Sbjct: 816  GTITGGGKQTAQGLMKLRKKGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQA 875

Query: 868  LKDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHV 927
            L+ LK+++P +E  IS+  M+ +  + E++  + Q+ +    Y     N  E+ E    +
Sbjct: 876  LQRLKDRKPELELEISKCLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHQL 935

Query: 928  QSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKE 987
              L+ E++ + + TK+   +I+ LK  IMEIGG +L++Q+SKV+S+IQ IDI+ SKQK+ 
Sbjct: 936  NLLQKEYQLLLDSTKNISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRG 995

Query: 988  RSVIKKTENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTK 1047
             S +KK ENEI +S K       D +  ++E+ +    +E ++ SL  + E+   +++  
Sbjct: 996  ISSMKKIENEIRRSEKALSGAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENEN 1055

Query: 1048 EGLIEESRTLEDKLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLK 1107
              L  E   L++K+N+   +   FKS+E+++K+ LEKLN+L  H+K+ IK Y+E+L  L+
Sbjct: 1056 SELEIECCNLKEKINEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALE 1115

Query: 1108 IRDVTQILHDLKDESNNASDPXXXXXXXXXXXXXXXXXGKDENKDLDAQDQVQDAEKQGD 1167
            +R+ T I  D  D  NN+ +                   +D+NK +  ++ +++ +   +
Sbjct: 1116 LRNTTTIFGDEGD--NNSINGVDRTSHGGGVPL------QDQNK-VVRENNMRNEKNSTE 1166

Query: 1168 NQMDVEDGGEYSDRGLTQFSXXXXXXXXXXXXXXXXXXXQNFLDASNADIDVLEEYARRL 1227
             +M+++D  +    G+ + S                   + ++  +N +IDVLEEYARRL
Sbjct: 1167 AEMEIDDVADEFSPGIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRL 1226

Query: 1228 IEFKSRRLDLNQAVEERNXXXXXXXXXXXXRFDEFMQGFGIISMTLKEMYQMITMGGNAE 1287
             ++ SR+LDLNQAVE R             R+DEFMQGFGIISMTLKEMYQMITMGGNAE
Sbjct: 1227 ADYNSRKLDLNQAVERREALKKLLDELKKKRYDEFMQGFGIISMTLKEMYQMITMGGNAE 1286

Query: 1288 LELVDTLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1347
            LEL+D+LDPFSEGVTFSVMPPKKSWRNI NLSGGEKTLSSLALVFALHKYKPTPLYVMDE
Sbjct: 1287 LELIDSLDPFSEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1346

Query: 1348 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNI 1407
            IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYKRDNKTKSA I+N 
Sbjct: 1347 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNK 1406

Query: 1408 DFV 1410
            DF+
Sbjct: 1407 DFL 1409

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
            similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 1322 bits (3422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 703/1370 (51%), Positives = 929/1370 (67%), Gaps = 11/1370 (0%)

Query: 48   HAKTPRKLVVGNGDNRYAHXXXXXXXXXXXXXXXXXXATSSR-GRGSKTYXXXXXXXXXX 106
            H  TP KL+ G+   ++                     T S+  RG   Y          
Sbjct: 12   HLDTPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSVYSQSPPRSPNR 71

Query: 107  XXXXKLELIQISPLKNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVGPFN 166
                ++ELIQ+SP+KNSRLELQKIYD +Q   +  RL I  LIL +FKSYAG QVVGPF+
Sbjct: 72   SPARRIELIQLSPIKNSRLELQKIYDGKQTTTK--RLSIKNLILNNFKSYAGVQVVGPFH 129

Query: 167  TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFK 226
            +SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE + +L  CSVE+ F+
Sbjct: 130  SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQ 189

Query: 227  YVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKR 286
            YV+D+  G T++  +   L V RK F+NNTSKYY+N +E++Y EVT+ L+ EG+DLDHKR
Sbjct: 190  YVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKR 249

Query: 287  FLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGTAKYKPLIEKNLADMESLNDICIEK 346
            FLILQGEVE+IAQMK KA              IIGTAKYK  I   L +M++LNDIC+EK
Sbjct: 250  FLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEK 309

Query: 347  ENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNL 406
            E RF++V++EK SLE GKE+AL F+  E++LT+ KSK  Q+ I     KL  TLDKI+  
Sbjct: 310  EIRFELVEKEKRSLEAGKEQALEFIAKEKQLTLLKSKQLQWDINKETKKLAVTLDKISAF 369

Query: 407  NQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKI 466
             +KLE E +K   ++KE+  LR   D LE ++   N E+ QL+  K +L  + V +EEK+
Sbjct: 370  TEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKL 429

Query: 467  KNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIK 526
            K+  +KR KAEKTL   +++I   E  +  L + Q ++ENSL ELNE    E+ +L+ IK
Sbjct: 430  KSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELNESLHSERSELDAIK 489

Query: 527  FSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFK 586
             SL+DKT+ IS E+A LEKELEPW  +L+ K +QI+LAES+I +IKE++ KL QEI Q +
Sbjct: 490  MSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLR 549

Query: 587  QEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKAL 646
            ++IE+ K +I    K+++ L  +  ++   IST + EC +A+ +L +M+ +L   RQ+  
Sbjct: 550  KDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMT 609

Query: 647  DARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIV 706
            DAR ALSN ENK+KVL AL RLQKSGRI GFHGRLGDLG ID+KYD+AIS ACPRL+DIV
Sbjct: 610  DARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDIV 669

Query: 707  VETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSS 766
            VETVEC QQCIE+LRKNKLGYARFILLDKL+KFN+  + TPE+VPRLFDL  PK+  F+ 
Sbjct: 670  VETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFAP 729

Query: 767  AFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINR 826
            A +SVL +TLVA DL QANRVAYG +RFRVVTLDG LIDISGTMSGGG RV +GLM   +
Sbjct: 730  ALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLM---K 786

Query: 827  NKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLT 886
            +K    ++Y+SEEV ++E  L +RE NF++A+DT  +ME  L+  K+++P I+  IS+  
Sbjct: 787  SKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHK 846

Query: 887  MEIESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKH 946
            ++I++ +SE++ K+  ++E E      Q +N  L +    + +L  E  ++++++K K  
Sbjct: 847  IDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNE 906

Query: 947  RIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKL 1006
            +I  L+ +IM+IGG +L+ Q+SKVDS+ Q++ I+V+KQKK R+ +KK E E+N++ K KL
Sbjct: 907  QISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKL 966

Query: 1007 ETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDINE 1066
                D+ +   E+     + E LQ+ L +    +  ++  KE L +E  T +  L+D   
Sbjct: 967  GAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAA 1026

Query: 1067 DIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDESNNAS 1126
             +  FKS E+EM   LEKL +L  H+K EI   +E+L  LK+RDV Q+L  L DE N   
Sbjct: 1027 YVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKL-DEHNLPL 1085

Query: 1127 DPXXXXXXXXXXXXXXXXXGKDENKDL---DAQDQVQDAEKQGDNQ-MDVEDGGEYSDRG 1182
            +                   +D + D+   +A+   +D     D + MDV+    Y   G
Sbjct: 1086 ESLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDASYIGPG 1145

Query: 1183 LTQFSXXXXXXXXXXXXXXXXXXXQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAVE 1242
            L + +                   + ++D + ADID+LEEYA RL E+K R+LDLN++VE
Sbjct: 1146 LPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNESVE 1205

Query: 1243 ERNXXXXXXXXXXXXRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVT 1302
            +R             R +EFM GFGIISMT+KE+YQMITMGGNAELELVD+LDPFSEGV 
Sbjct: 1206 KREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSEGVL 1265

Query: 1303 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1362
            FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN
Sbjct: 1266 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1325

Query: 1363 YIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFVSV 1412
            YIKERTKNAQFIVISLRNNMFELAQQL+GIYK  N TKS T++NID +++
Sbjct: 1326 YIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILNI 1375

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] {ON}
            YLR086W (SMC4) - SMC chromosomal ATPase family member
            [contig 172] FULL
          Length = 1396

 Score = 1300 bits (3364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 699/1383 (50%), Positives = 939/1383 (67%), Gaps = 34/1383 (2%)

Query: 47   AHAKTPRKLVVGNGDNRYA--HXXXXXXXXXXXXXXXXXXATSSRGRGSKTYXXXXXXXX 104
            + ++TPRKLV+G+ D R+A                      +SSRGR    Y        
Sbjct: 32   SRSRTPRKLVLGSPDKRFAFSQPVSSSSSNVPHLQPLKNELSSSRGR---VYSQSPPRSP 88

Query: 105  XXXXXXKLELIQISPLKNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVGP 164
                  KLELIQ+SP+K SRLE QK  +++       RLCID+L+L +FKSYAG QVVGP
Sbjct: 89   NRSPTRKLELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVVGP 148

Query: 165  FNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVH 224
            F+ SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LS+LIHKSE +P L SC V++ 
Sbjct: 149  FHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIF 208

Query: 225  FKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDH 284
            F+YV DEP G T I ++KP++V+ RKAFRNNTSKYY+N +E++Y  +T+LL+ EG+DLDH
Sbjct: 209  FQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDH 268

Query: 285  KRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGTAKYKPLIEKNLADMESLNDICI 344
            KRFLILQGEVE+IAQMK KA              IIGTA+YKPLIE  L+++  LNDIC 
Sbjct: 269  KRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDICE 328

Query: 345  EKENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKIT 404
            EKENRF+IV+REK+SLE GK EAL +LE E+ LT+ +SKL QYH+  +  KL +T +KI 
Sbjct: 329  EKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEKIA 388

Query: 405  NLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEE 464
               +KL  E  K     +E+  ++A    L+  L +    EK+L  +KR  D   V  EE
Sbjct: 389  KAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSLEE 448

Query: 465  KIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEK 524
            K+KN  +K  K+ ++L S+  SIS+++A++ EL   Q  +E  L ELN   + EK KL++
Sbjct: 449  KLKNLTQKEVKSSRSLQSITSSISTTQAKMEELANDQEQHEKDLLELNGTMKEEKEKLDE 508

Query: 525  IKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQ 584
            IK SLKDK + IS +I ++EKELEPWN +LQEKK Q++L E+ IS+ KE+ AK+ Q+I  
Sbjct: 509  IKSSLKDKISLISEQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDIIL 568

Query: 585  FKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQK 644
              + I+  + ++ +    + SL  +   +  +++ G+ EC NA  ++KEM+ IL   RQ+
Sbjct: 569  VNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHRQR 628

Query: 645  ALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLED 704
            ++DARS+LS  ENK+KVL AL RLQ+SGRISGFHGRLGDLG ID+KYDVAISTACPRL+D
Sbjct: 629  SIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDD 688

Query: 705  IVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKF 764
            IVVETVECGQQCIEYLRKNKLGYARFILLDKLR FNL  I TPE+VPRL+DL+ P +PKF
Sbjct: 689  IVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNNPKF 748

Query: 765  SSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQI 824
             +AF+SVL +TLVA DLK+AN+VAYGK+R+RVVTLDG LID+SGTMSGGG+  +RG+M  
Sbjct: 749  RNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGMM-- 806

Query: 825  NRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQ 884
             +++ +    +++EEV Q++  L ERE NFQ+A+DT+++MEE L+ LK++EP IE +IS+
Sbjct: 807  -KSEQQSNSAFTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDISK 865

Query: 885  LTMEIESWNSEIKIKE--IQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTK 942
              ++I+S +SE+K  E  ++ L  E+A    + +N EL      ++SLK E++ ++N+ +
Sbjct: 866  RKLDIDSLSSEMKASEGRLEYLLQEKA--QKESSNEELSTAEVKLKSLKSEYRELENEMQ 923

Query: 943  SKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSH 1002
            SKK  ++ L+ +IM++GG +L++QSS VDSV QRI IV++K KK ++ +KK +N+I +  
Sbjct: 924  SKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVLAKSKKTKTDLKKAQNDIKRYQ 983

Query: 1003 KMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLN 1062
            K   + + +L++ +QE   ++  ++     ++++ ES+  ++   E   E  R  E+ ++
Sbjct: 984  KQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDELELTEERVRKAEESID 1043

Query: 1063 DINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDES 1122
            +   +   F++ E++   +L+KL  L   L KE   +   L  LKIRDVT  L  L +  
Sbjct: 1044 EKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIRDVTATLQALDESL 1103

Query: 1123 NNASDPXXXXXXXXXXXXXXXXXGKDENKDLDA-QDQVQDAEKQGDNQMDVE---DGGEY 1178
             N S                   G+++ +   +  D +   E QG++    E     GE 
Sbjct: 1104 ENES----------KNEVAAETPGEEDGEHSSSLHDPMDVDENQGESTSTTEAQLQAGEA 1153

Query: 1179 SDR--------GLTQFSXXXXXXXXXXXXXXXXXXXQNFLDASNADIDVLEEYARRLIEF 1230
              R        GL +                     Q++++ + ADI++LEEYARRLIE+
Sbjct: 1154 ERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYARRLIEY 1213

Query: 1231 KSRRLDLNQAVEERNXXXXXXXXXXXXRFDEFMQGFGIISMTLKEMYQMITMGGNAELEL 1290
            K+R++DLN AV+ER+            R DEFM+GF  I M LKEMYQMITMGGNAELEL
Sbjct: 1214 KARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELEL 1273

Query: 1291 VDTLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1350
            VD+LDPFSEGV FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA
Sbjct: 1274 VDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1333

Query: 1351 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFV 1410
            ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVG+YK  N TKS  ++N D +
Sbjct: 1334 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDLI 1393

Query: 1411 SVS 1413
              S
Sbjct: 1394 DRS 1396

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 1271 bits (3289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 703/1378 (51%), Positives = 942/1378 (68%), Gaps = 27/1378 (1%)

Query: 42   SQNTFAHAKTPRKLVVGNGDNRYAHXXXXXXXXXXXXXXXXXXATSSRGRGSKTYXXXX- 100
            SQ+    ++TPRKL+V + D+R+                    + S+ GR  K Y     
Sbjct: 61   SQDRHGRSRTPRKLIVSSADHRFTMSQPNLLSADSQTPSLQHPSVST-GREHKFYSQSPP 119

Query: 101  ---XXXXXXXXXXKLELIQISPLKNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKSYA 157
                          LELIQ+SP+KN+R ELQK+Y+ QQ Q R  RL I++L+L +FKSYA
Sbjct: 120  RSPHRSPVRSPKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLVLTNFKSYA 179

Query: 158  GRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLP 217
            GRQVVGPF+T+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIHKSE+YP L 
Sbjct: 180  GRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPELS 239

Query: 218  SCSVEVHFKYVIDEPSG-ETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLK 276
            SCSVE+HF+YVID+P+G  ++IDE K  LVV RKAF+NN+SKYY+ND+E+++ +VT LLK
Sbjct: 240  SCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLK 299

Query: 277  KEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGTAKYKPLIEKNLADM 336
             EG+DLDHKRFLILQGEVENIAQMK K+              IIGT+ YK  IE NL+ +
Sbjct: 300  NEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKV 359

Query: 337  ESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKL 396
            E+LN+ICIEKENRF IV++EK+SL +GK EAL +L NE+ L ++KSK YQ+ +   N KL
Sbjct: 360  EALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNKKL 419

Query: 397  KNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELD 456
             +TL KIT+  +  +KE +K +++ KEL  L+     L  +L      E++LL  +R+ +
Sbjct: 420  TSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRKNN 479

Query: 457  GKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTE 516
             + +  +E IKN EKK+D AEK +++ ++SI+ +  +L  L   Q DY   ++ELNE+ +
Sbjct: 480  SELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQIEELNEKLK 539

Query: 517  VEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEA 576
            +EK KLE+IK SLK KT   S EI + EKELEP+  QLQEK +QIQL +S+ISL+ E + 
Sbjct: 540  IEKSKLEEIKISLKGKTEQFSNEILKNEKELEPYQIQLQEKMSQIQLLQSEISLLNENKD 599

Query: 577  KLAQEIDQFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQN 636
             L+ EI   K+ IE +K  +++ S+++     Q    ++E+ +G+ E      +++EM++
Sbjct: 600  NLSNEIISIKKLIEEKKLSVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEMRD 659

Query: 637  ILNTQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAIS 696
             L++ RQKA D+R++LSN +NK+ VLTAL +LQKSGRISGF+GRLGDLGVIDEKYDVAIS
Sbjct: 660  KLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVAIS 719

Query: 697  TACPRLEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDL 756
            TACPRLED+VV++V+CGQQCI+YLRKN+LGYARFILLDKLRKFNL+ I TP++ PRLFDL
Sbjct: 720  TACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLFDL 779

Query: 757  IHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSR 816
            I  ++ KF  AF+SVL +TLVA +L  AN+VAYGK+RFRVVTLDG LIDISGTMSGGG+ 
Sbjct: 780  IQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGGNY 839

Query: 817  VSRGLMQINRNKTE-DIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKE 875
            V RGLM++ ++  E D E  S EEV +LE  L   EKNF+VA +++ +M +++  +KE+ 
Sbjct: 840  VLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKEQI 899

Query: 876  PAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFK 935
            PA E NIS+ T+EIE   +EIK    Q+ E +  +    +NN E++     +Q+LK E+ 
Sbjct: 900  PATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKEYY 959

Query: 936  SIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTE 995
            S+ +QTK  K  IE L+ +IM+ GG ELK+Q+SKV S++ ++ IV SKQK ++S IKK  
Sbjct: 960  SLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIKKNN 1019

Query: 996  NEINKSHKMKLETSRD--LENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEE 1053
            N I K  + +L T++D  LE F   ++  K  +  L + L K+   +   Q+ KE ++  
Sbjct: 1020 N-ILKKLQNELNTTKDNSLE-FKTNLENSKKKVTLLSEELAKLESDINDTQNAKEEILLN 1077

Query: 1054 SRTLEDKLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQ 1113
                ++K  ++ ED   FKSFE+E+KN+L+KL  LS HL+K+I   + +L  L IR+++Q
Sbjct: 1078 IDGNKEKAQELEEDSRNFKSFELEIKNKLDKLKDLSHHLEKQIGKLDTELNALTIREISQ 1137

Query: 1114 ILHDLKDESNNASDPXXXXXXXXXXXXXXXXXGKDENKDLDAQDQVQDAEKQGDNQMDVE 1173
             L    DE     D                   +D      A + V +      + MD++
Sbjct: 1138 NLESF-DERLEKYD------------ISKNGATEDTQHTSSALNSVSNI---NTDTMDID 1181

Query: 1174 DGGEYSDRGLTQFSXXXXXXXXXXXXXXXXXXXQNFLDASNADIDVLEEYARRLIEFKSR 1233
                  + G+ + S                   +  L+ S A+I++LEEY RRL E+K R
Sbjct: 1182 STDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKR 1241

Query: 1234 RLDLNQAVEERNXXXXXXXXXXXXRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDT 1293
            + DL++++ E+             R +EF  GF IIS+TLKEMYQMITMGGNAELELVD+
Sbjct: 1242 KSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELVDS 1301

Query: 1294 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1353
            LDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD
Sbjct: 1302 LDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1361

Query: 1354 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFVS 1411
            FRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QLVGIYK +N T+SAT+ N D ++
Sbjct: 1362 FRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVNNDMLN 1419

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 1243 bits (3216), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 695/1370 (50%), Positives = 926/1370 (67%), Gaps = 35/1370 (2%)

Query: 51   TPRKLVVGNG-DNRYAHXXXXXXXXXXXXXXXXXXATSSRGRGSKTYXXXXXXXX----X 105
            TP K+++ N   N  +                   ++SSRGR  K Y             
Sbjct: 48   TPMKVIISNNHSNSISPLPSQLMSSSTQPPSLQHPSSSSRGRAVKAYSQSPPRSPDRSPV 107

Query: 106  XXXXXKLELIQISPLKNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVGPF 165
                 KLELIQ+SP+KNSR ELQKIY ++Q + +  R+C+++L+L +FKSYAG Q +GPF
Sbjct: 108  RSPTRKLELIQLSPIKNSRSELQKIYSSKQ-EEKIERICLNKLVLHNFKSYAGTQTIGPF 166

Query: 166  NTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHF 225
            ++SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L+DLIHKSEEYP L SC+V+VHF
Sbjct: 167  HSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHF 226

Query: 226  KYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHK 285
            +Y+ID P   T+I+  K  L++TR+AF+N+TSKYY+N +E+NY  +T LLK+EG+DLDH 
Sbjct: 227  EYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHN 286

Query: 286  RFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGTAKYKPLIEKNLADMESLNDICIE 345
            RFLILQGEVENIAQMK KA              IIGT KYK LI+K   ++E+LNDICIE
Sbjct: 287  RFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIE 346

Query: 346  KENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITN 405
            +ENRF I+DREK SLE+ KE AL +L  E++  + KSKL QY I  +N+KL NTL+KIT 
Sbjct: 347  RENRFDIIDREKESLESEKESALEYLSKEKEQVIVKSKLIQYKIWQNNIKLSNTLEKITK 406

Query: 406  LNQKLEKESDKNASVKKELDKLRAF----GDELESKLKNCNNEEKQLLGKKRELDGKNVL 461
            L  +  +E +KN  +K ++D+LR       DEL++ LK    +EK+L+  KR LD  NV 
Sbjct: 407  LEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLK----DEKELVNAKRSLDSDNVS 462

Query: 462  NEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMK 521
            N E++KN EKK  K  K +    ++ISSS  RL      +  +E  L EL+     E   
Sbjct: 463  NTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQL 522

Query: 522  LEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQE 581
            LE IK  LKDKT G+S EI + EK+LEPWN +L E K++IQ+ ES+ +L +E++ KL   
Sbjct: 523  LENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKAN 582

Query: 582  IDQFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQ 641
            I+  ++++  + +      KE+ +L ++ ++V +E+  G  E   A  +L EMQ IL   
Sbjct: 583  IEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQD 642

Query: 642  RQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPR 701
            RQKA DAR++LSN EN+SKVL AL +LQKSGRI+GFHGRLG+LGVIDEKYDVAISTACPR
Sbjct: 643  RQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPR 702

Query: 702  LEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKD 761
            L DIVV++VECGQQCIEYLRKN LG+ARFILLDKL KF+++ I+TP +VPRLFDLI   D
Sbjct: 703  LNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVND 762

Query: 762  PKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGL 821
             KF  AF+SVL NTLVANDLK+AN VAYGK R+RVVTL GNLIDISGTMSGGG++ S+G 
Sbjct: 763  EKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGA 822

Query: 822  MQINRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENN 881
            MQ++ + +++   YSSEEV ++E  L  REKN+Q A +T+ +ME +L++LKE EP IE  
Sbjct: 823  MQLSNSTSKEKSTYSSEEVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELE 882

Query: 882  ISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQT 941
            IS+L  EI+S  +E  +K  Q+ E   ++S   + + ++ E    + +L ++ K I++Q 
Sbjct: 883  ISKLNFEIDSLENECSLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQM 942

Query: 942  KSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKS 1001
            KSKK RI+ L+++IM+IGG +L++Q+SKVDS+ ++  I++ KQK E++ I K E+++ K 
Sbjct: 943  KSKKDRIKELQDKIMKIGGIKLQMQNSKVDSLQEQKKILIKKQKSEKAGIMKIESDVRKL 1002

Query: 1002 HKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKL 1061
             K   E+  D    N++   L+  ++ +++ L +   ++  +Q  K  L E+S    ++L
Sbjct: 1003 SKKLKESESDNTKLNEKKIALENELKNIEELLAQNENNMNCIQDKKFTLREKSEITMNEL 1062

Query: 1062 NDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDE 1121
             ++   ++ FK+ E+E K + EKL SL   +KK +K  EE    L IR+V   L  L  +
Sbjct: 1063 TEMEGLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIREVAYDLDLLNIK 1122

Query: 1122 SNNASDPXXXXXXXXXXXXXXXXXGKDENKDLDAQDQVQDAEKQGDNQMDVEDGGEYSDR 1181
               A                          D + Q+Q  D     +++M +ED      +
Sbjct: 1123 EQEAQKIKTELYA-----------------DFE-QNQSNDV---INDEMIIEDNNNEIAK 1161

Query: 1182 GLTQFSXXXXXXXXXXXXXXXXXXXQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAV 1241
            G+  +                    Q++ + +  D+D+LEEY RR+IE++ R+ DLNQ+V
Sbjct: 1162 GIPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSV 1221

Query: 1242 EERNXXXXXXXXXXXXRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGV 1301
            E+R+            RF+EFM+ F IISMTLKEMYQ+ITMGGNAELELVD+LDPFSEGV
Sbjct: 1222 EQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGV 1281

Query: 1302 TFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1361
            TFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA
Sbjct: 1282 TFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1341

Query: 1362 NYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFVS 1411
            NYIKERTKNAQFIVISLRNNMFELA+QLVGIYK  N+TKSAT+KN D + 
Sbjct: 1342 NYIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDILC 1391

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 1210 bits (3130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 671/1328 (50%), Positives = 898/1328 (67%), Gaps = 8/1328 (0%)

Query: 87   SSRGRGSKTYXXXXXXXXXXXXXXKLELIQISPLKNSRLELQKIYDAQQNQARHTRLCID 146
            S+RGR  K+Y              +L+LI++SP+KNSR ELQK+Y++++   +  RL I 
Sbjct: 72   SARGRDFKSYSQSPPRSPGRSPTRRLKLIELSPIKNSRAELQKLYESKKLDVKKERLFIH 131

Query: 147  QLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDL 206
            QL+L DFKSYAGRQV+GPF+TSFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDL
Sbjct: 132  QLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDL 191

Query: 207  IHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQET 266
            IHKSE +P L SCSVEVHFKYVID+  G T IDE K NLVVTRKAF+NN SKY+VN +E+
Sbjct: 192  IHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKES 251

Query: 267  NYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGTAKYK 326
            NY EVT LLKKEG+DLDHKRFLILQGEVENIAQMK+KA              IIGT+KYK
Sbjct: 252  NYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYK 311

Query: 327  PLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQ 386
              IEK   ++ESLN+IC+EKENRF IV+REKNSLE+GKEEAL FL  E++L + KSKLYQ
Sbjct: 312  ESIEKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEALQFLNKEKELVLEKSKLYQ 371

Query: 387  YHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEK 446
            Y+++  N KL + L+K TN+ Q+  K+ D+       +  + A  + L++ L+  + EE 
Sbjct: 372  YNLMQDNKKLDDVLNKKTNVQQEQTKQEDEFRKANSHISDITASLNVLKADLEKVHTEEV 431

Query: 447  QLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYEN 506
             L   KR L+ K V NE+ + N + KR + E+    +   I+S++  +  + + Q     
Sbjct: 432  NLSKTKRTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAE 491

Query: 507  SLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAES 566
                L+   ++EK KLE IK  L++KT  ++++IA+ EKEL PWN Q Q+ K +I++ ES
Sbjct: 492  GTTVLSTNLDIEKEKLENIKLKLREKTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITES 551

Query: 567  QISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLN 626
            ++S+I+E    L  +I   +  I ++K+ +    +E+ SL  Q   V +E   GE+EC N
Sbjct: 552  ELSIIEENRKGLENDIAGLENAILSQKRDLEVQEQEIKSLLEQKTKVIQERELGERECKN 611

Query: 627  ARIRLKEMQNILNTQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGV 686
            A+  L  ++  +   RQKA++ RS  S  EN +KVL+AL RLQKSGR++GFHGRLGDL V
Sbjct: 612  AQATLANVREKVEALRQKAIEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAV 671

Query: 687  IDEKYDVAISTACPRLEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINT 746
            ID KYDVAISTACPRL D+VV+TVE GQQCIEYLRKNKLGYARFILLDKL  FN + I+T
Sbjct: 672  IDPKYDVAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDT 731

Query: 747  PESVPRLFDLIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDI 806
            P+   RLFDLI  K+ +F++AF+SVL +TLV  +++QANRVAYGKKR+RVVTLDGNLID+
Sbjct: 732  PDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDL 791

Query: 807  SGTMSGGGSRVSRGLMQINRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEE 866
            SGTM+GGG  VS+GLM+++++ ++    +S EEV  +E  L ++E  ++ A D  ++MEE
Sbjct: 792  SGTMTGGGRNVSKGLMKLSKSSSKGSAFFSPEEVQAIENELNQKENQYKSALDAYHEMEE 851

Query: 867  QLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVELRET-IQ 925
            +L+ L+++ P I+N +S+  M+IE+ +++I    I +LE +R    +  N  +   T + 
Sbjct: 852  ELRRLRDRAPEIDNLVSKKEMDIETAHNDIN-SNINVLEEKRKKLESMKNQNDPSITLLA 910

Query: 926  HVQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQK 985
             ++ LK +   I  QTKS K +I+T+K++I+E+GG ELK QS  V  +  +I     + K
Sbjct: 911  KLKELKSKLDDIDVQTKSTKDKIKTIKDKIIELGGDELKNQSLLVTDITNKISENSRRLK 970

Query: 986  KERSVIKKTENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQH 1045
            K +S   K E+ + K +K   E + +L NF++  +      + ++  L  + ES+ +++ 
Sbjct: 971  KIKSNKLKKESLLKKFNKELTEANEELTNFSKNAENADIESKEIESKLLDIKESIENLKE 1030

Query: 1046 TKEGLIEESRTLEDKLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGD 1105
             +  L  E     ++L    + ++ +KS  +E  N+LEKL +    LKK IK Y + L +
Sbjct: 1031 NEVKLEHEIEMKHNELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSE 1090

Query: 1106 LKIRDVTQILHDLKDESN---NASDPXXXXXXXXXXXXXXXXXGKDENKDLDAQDQVQDA 1162
            L IRDVTQ+L+ +  E N   + SDP                    EN+  +  D+  D 
Sbjct: 1091 LTIRDVTQVLNTIMTEENASVDKSDPKLENTSAVINADDDGISAVSENQSFNHNDENDDI 1150

Query: 1163 EKQGDNQMDVEDGGEYSDRGLTQFSXXXXXXXXXXXXXXXXXXXQNFLDASNADIDVLEE 1222
            +    N+M+++  G + + G+   S                    +F+ +S A++DVLEE
Sbjct: 1151 D---SNKMEIDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEE 1207

Query: 1223 YARRLIEFKSRRLDLNQAVEERNXXXXXXXXXXXXRFDEFMQGFGIISMTLKEMYQMITM 1282
            YA R +EF  R+ DLN AV+ R+            R+DEFM+GF IISMTLKEMYQMIT+
Sbjct: 1208 YALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITL 1267

Query: 1283 GGNAELELVDTLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPL 1342
            GGNAELELVD+LDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPL
Sbjct: 1268 GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPL 1327

Query: 1343 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSA 1402
            YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL +QLVGIYK +N TKSA
Sbjct: 1328 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSA 1387

Query: 1403 TIKNIDFV 1410
             + N D V
Sbjct: 1388 ALVNEDLV 1395

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 1187 bits (3072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 671/1371 (48%), Positives = 905/1371 (66%), Gaps = 30/1371 (2%)

Query: 49   AKTPRKLVVGNGDNRYA----HXXXXXXXXXXXXXXXXXXATSSRGRG-SKTYXXXXXXX 103
             +TPRKLV+G+ + +YA                       A + RGR  S++        
Sbjct: 26   TRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQPPTAHAVRGREYSQSPPRSPTRS 85

Query: 104  XXXXXXXKLELIQISPLKNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVG 163
                   KLELI++SP K++RLELQK+++A  N     RLCID+L+L +FKSYAG Q +G
Sbjct: 86   PTRSPTRKLELIRLSPKKSTRLELQKMHEA--NTQTSQRLCIDKLVLNNFKSYAGIQEIG 143

Query: 164  PFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEV 223
            PF+TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE++PSL SCSV++
Sbjct: 144  PFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPSLASCSVQI 203

Query: 224  HFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLD 283
            HF YV D  +GET+I      +VV R+AF+NN+SKYYVN +E+NY EVT+LLK+EG+DLD
Sbjct: 204  HFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEEGIDLD 263

Query: 284  HKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGTAKYKPLIEKNLADMESLNDIC 343
            HKRFLILQGEVE+IAQMK+KA              IIGTAK+KP IEK L ++E+LN++C
Sbjct: 264  HKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIETLNEVC 323

Query: 344  IEKENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKI 403
            +EKENRF++VD+EK +LE+GKEEAL FL+ ERK T+ K++L Q  I +SN KL  + DKI
Sbjct: 324  MEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDSNRKLATSCDKI 383

Query: 404  TNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNE 463
            + LN + ++E  +   ++KE + L    +  + +      E K +  KKR L+   +  +
Sbjct: 384  SALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEKDFIATD 443

Query: 464  EKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLE 523
            EK+K+  +K   AEK  S  + +  ++   +  LK+   D E  L  LN    +EK KL 
Sbjct: 444  EKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLN 503

Query: 524  KIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEID 583
            +IK  L +KT  +S E+  LE++LEP+  Q+QEK+++I+L+E++I+++K + + L +E  
Sbjct: 504  EIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKA 563

Query: 584  QFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQ 643
              + +IE  + + L+  +   SL ++   V+  IST +KEC  A+ +  EM+++L  QRQ
Sbjct: 564  TIESKIEDLQLEELKQKETETSLRNEKSKVEARISTAQKECEEAQKQTNEMRDVLIQQRQ 623

Query: 644  KALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLE 703
               +A++ L+  +NK++VL AL++LQ SGRI+GFHGRLGDLG ID++YD+AISTACPRL+
Sbjct: 624  IVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYDIAISTACPRLD 683

Query: 704  DIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPK 763
            DIVVETVECGQQCI++LRKNKLGY RFILLDKLRK NLD I TPE+VPRLFDLI P    
Sbjct: 684  DIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRLFDLITPVRDL 743

Query: 764  FSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQ 823
            F  AF+SVL +TLVA DL+QANRVAYGK+RFRVVTLDG LIDISGTMSGGGS    GLM 
Sbjct: 744  FRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGGGSSPQSGLM- 802

Query: 824  INRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNIS 883
              R+K      YS +EV ++EV L  +E N++ A   +++ME  L+ L ++ P I+  IS
Sbjct: 803  --RSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPEIDIQIS 860

Query: 884  QLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKS 943
            ++ +E  S  +E++    ++ +  R  S  + N   L +  + +  L+   +   + +K 
Sbjct: 861  KIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKLDILRQHLQQTIDASKF 920

Query: 944  KKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHK 1003
             + +I+ LK+ IM+ GG ELK+Q +KV S+ Q I+I+  KQKKE++  KK + ++ ++ +
Sbjct: 921  SQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEKQKKEKTRSKKLDIDLARATR 980

Query: 1004 MKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLND 1063
             K + S ++   N++I  L   +E ++    ++ E V      K  L      L+ +L  
Sbjct: 981  EKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNERKAELNSSVEKLKQELLS 1040

Query: 1064 INEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDESN 1123
            I  D   FK+ E+E  + LEKL+ L  ++KK+++ YE  L  LKIRDV+++L  L D   
Sbjct: 1041 IERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKLLSQLND--- 1097

Query: 1124 NASDPXXXXXXXXXXXXXXXXXGKDENKDLDAQDQVQDAEKQGDNQMDVEDGGEYSDR-G 1182
                                   K  N D+     + D    G+N   +ED GE +   G
Sbjct: 1098 ------------GIIESCTDVTAKVMNGDIVQTQSITDV---GNNDA-MEDSGEAATHSG 1141

Query: 1183 LTQFSXXXXXXXXXXXXXXXXXXXQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAVE 1242
            L   +                   Q++LD  N DI+VLEEYARRL E++ R+LDLNQAV 
Sbjct: 1142 LPSLTETELENLDLETLELELHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLNQAVA 1201

Query: 1243 ERNXXXXXXXXXXXXRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVT 1302
            +R             R ++FM+GFGIISMTLKEMYQMITMGGNAELELVD+LDPFSEGV 
Sbjct: 1202 KREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVL 1261

Query: 1303 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1362
            FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN
Sbjct: 1262 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1321

Query: 1363 YIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFVSVS 1413
            YIKERTKNAQFIVISLRNNMFELAQ LVGIYK +N TKS T++NID +  S
Sbjct: 1322 YIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDILHSS 1372

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score =  152 bits (384), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 253/1041 (24%), Positives = 463/1041 (44%), Gaps = 183/1041 (17%)

Query: 148  LILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 207
            L L +FKSY G   VG  +++F++++GPNGSGKSN++D++ FV G R++ +R + + DLI
Sbjct: 7    LELNNFKSYKGITKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNIVKDLI 66

Query: 208  HK--------SEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKY 259
            ++        + E+  + S  V+  ++    +       D+E+P + + R    N  + Y
Sbjct: 67   YRGVINDNGDTNEHGKVTSAYVKAFYEKNTADDGDNDDDDDERP-VELMRAISTNGDTTY 125

Query: 260  YVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXI 319
             +N +   Y E ++ L++E + +  K FL+ QG+VE IA                    +
Sbjct: 126  KINGKTVTYKEYSEFLERENILIKAKNFLVFQGDVEQIASQSP-------MDLSKLFEEV 178

Query: 320  IGTAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLTV 379
             G+ +YK   ++    +E LN    E     + +  E  + + G     +  + E K  +
Sbjct: 179  SGSIQYKKEYDELKEQIEKLNQSAAESIRNRRRIHGELKTYKEG-----ITKDEEYKNNI 233

Query: 380  SKSKLYQ--------YHILNSNMK----LKNTLDKITNLNQKLEKESDKN-----ASVKK 422
             K K Y         YH+ N   K    LKN   +I+ L  K+  E +KN     +S  K
Sbjct: 234  EKRKKYYMYLVLWQLYHLENEKKKSLDNLKNAKSEISQLKNKITNE-EKNLQRSKSSFLK 292

Query: 423  ELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSS 482
            E  K+    ++L  +LK    E+ +LL     +        ++I N EK+ +  +K +  
Sbjct: 293  ENLKVNKKREQLNYQLK----EKDKLLEDLNSIKIPQRAASKRINNIEKRIESIQKDIER 348

Query: 483  MDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQ 542
                I++ E +L  + + +  +E  +KE  + +          K+SL D  + + L  + 
Sbjct: 349  QQGYINTFENQLKVVTKAKESFEREIKESAQNSN---------KYSLSD--DDLKLYESL 397

Query: 543  LEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQI------ 596
             EK        L E  + I   E QISL+   + ++ +E+D+  ++I+  K++I      
Sbjct: 398  NEK-------YLMENGSAI---EQQISLLNNDKQEVLEEMDRLNRKIDASKKRITEELLI 447

Query: 597  ------------LQGSKELDSLHSQH----KSVKEEISTGEKECLNARIRLKEM---QNI 637
                        +    E +S+ S+     K+++ EI +   +  +   +L+E     + 
Sbjct: 448  SQERIQNENIELVSSLNEKNSIFSEKTHELKTLQAEIESSNNQEYDTNYKLRETLLKLDD 507

Query: 638  LNTQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVI-DEKYDVAIS 696
            LN  +++++  +    N       +T L R        G  G + DL     +KY +A+S
Sbjct: 508  LNANQRESIKEKKLREN-------VTMLKRF-----FPGVRGLVHDLCRPKKDKYGLAVS 555

Query: 697  TACPR-LEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFD 755
            T   +  + I+V+ +   Q+CI + +K + G A FI LD +      ++N P S   +  
Sbjct: 556  TILGKNFDSIIVDNLNVAQECIAFFKKQRSGTASFIPLDTISS-EQPTLNLPSSQDYILT 614

Query: 756  L-IHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKK-RFRVVTLDGNLIDISGTMSGG 813
            +     DP++  A   V  ++++ N L  A  + + K  R ++VT++G LI  +G M+GG
Sbjct: 615  INAIEYDPEYERAMQYVCSDSIICNSLDIARDLKWNKGVRSKLVTIEGALIHKAGLMTGG 674

Query: 814  GSRVSRGLMQINRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEE-----QL 868
             S+ S      NR        +  EE   L            +    + Q+EE     +L
Sbjct: 675  ISKDSN-----NR--------WDKEEYQSL----------MTLKDKLLLQVEEISTKSRL 711

Query: 869  KDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQ 928
               + ++  IE  +S L  EI S    +++ ++Q    E        N +  ++    ++
Sbjct: 712  SSTRARDVEIE--LSTLNAEISSL--RMQLSQVQRSLDENKTEINHQNTLLDQQYNPKLK 767

Query: 929  SLK---DEFKSIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDI----VV 981
            SLK   DEF    N+ KS K   E L+NEI        K  + KV   I+  +     ++
Sbjct: 768  SLKEKVDEFDKSWNELKSNK---EKLQNEI-------FKELTDKVGFTIEEYERHSGELL 817

Query: 982  SKQKKERSVIKKTENEI-NKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESV 1040
             KQ KE   +++ + EI N  +K++ E  R LEN  + + + ++ +E       K HE++
Sbjct: 818  RKQSKE---LQQLQKEILNIENKLQFEIER-LENTQKRLTSAESNLE-------KAHETL 866

Query: 1041 TSVQHTKEGLIEESRTLEDKLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYE 1100
             S+Q  +  L E+ + +E ++N                +NEL+ +N +    + +I   E
Sbjct: 867  KSLQKDENELAEQVKQIESEINS--------------ARNELDSVNKVFTAQQLDINRME 912

Query: 1101 EKLGDLKIRDVTQILHDLKDE 1121
            E LG+L   D +Q L   +DE
Sbjct: 913  ESLGELN--DNSQTLKRNRDE 931

 Score =  134 bits (338), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 66/155 (42%), Positives = 99/155 (63%), Gaps = 12/155 (7%)

Query: 1262 FMQGFGIISMTLKEMYQMIT---------MGGNAELELVDTLDPFSEGVTFSVMPPKKSW 1312
            F   F  +S  L  +Y+ +T          GGNA L L D  +PF+ GV +   PP K +
Sbjct: 1070 FENAFDFVSEHLDNIYRELTRNPNSSADLAGGNASLTLEDEDEPFNAGVRYHATPPLKRF 1129

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNA 1371
            +++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI+     N 
Sbjct: 1130 KDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYIRRHGNPNL 1189

Query: 1372 QFIVISLRNNMFELAQQLVGIYK--RDNKTKSATI 1404
            QFIVISL+N MFE +  LVG+++  ++N +K  T+
Sbjct: 1190 QFIVISLKNTMFEKSDALVGVFRQQQENSSKIVTL 1224

>KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  142 bits (358), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 105/159 (66%), Gaps = 12/159 (7%)

Query: 1258 RFDEFMQGFGIISMTLKEMYQMIT---------MGGNAELELVDTLDPFSEGVTFSVMPP 1308
            R D F   F  +S  + ++Y+ +T          GGNA L L D  +P+  G+ +   PP
Sbjct: 1063 RKDAFESAFDHVSNAIDDVYRELTRDPHSTAELAGGNASLTLEDEDEPYLAGIRYHATPP 1122

Query: 1309 KKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1368
             K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV  +A YI++R 
Sbjct: 1123 TKRFKDMEFLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDILNVERIATYIRQRA 1182

Query: 1369 -KNAQFIVISLRNNMFELAQQLVGIYK--RDNKTKSATI 1404
              N QFIVISL+N MFE +Q LVG+++  RDN +++ T+
Sbjct: 1183 LSNLQFIVISLKNTMFEKSQALVGVFRQQRDNTSRALTL 1221

 Score =  116 bits (290), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 253/1042 (24%), Positives = 442/1042 (42%), Gaps = 208/1042 (19%)

Query: 150  LQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI-- 207
            L +FKSY G+  +G   ++F++V+GPNGSGKSN++D++ FV G ++  +R   L+DLI  
Sbjct: 9    LYNFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMDAISFVLGMKSIHLRSHTLADLIYR 68

Query: 208  ---------------HKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAF 252
                           H +E  PS  S  V+  +      PSG     +E     +TR   
Sbjct: 69   GTLQDGDADSGYSETHDNENNPS--SAYVKAFYS-----PSG-----QENDVAELTRTIT 116

Query: 253  RNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXX 312
             +  S Y +N +  ++ +    L+ E + +  + FL+ QG+VE +A  K +         
Sbjct: 117  LSQESTYKLNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQVASQKPR-------EL 169

Query: 313  XXXXXXIIGTAKYKPLIEKNLADME---SLNDICIEKENRFQIVDREKNSLENGKEEALL 369
                  + G+ +YK   ++   ++E   S     I+   R  I  +      N  EE   
Sbjct: 170  TTLFEQVSGSIQYKQEYDRLREELEKARSATSELIQSRKRANIGLKSFKEGVNKDEEY-- 227

Query: 370  FLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRA 429
                 RK    ++KL Q  I+     L+   D +T                    + L++
Sbjct: 228  -----RKHLEERNKLQQQLIVWQLFHLQAKRDSLT--------------------ESLKS 262

Query: 430  FGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISS 489
               EL+S     N+EE+ +  KK     K  L  ++      K  K +   SS+    SS
Sbjct: 263  SQRELQSLDSELNSEEQIVAKKKLSYAKKQTLAAKQRTRLSDKTKKVDHLTSSLLPIKSS 322

Query: 490  SE-------ARLSELKQLQVD----------YENSLKELNE-----QTEVEKMKLEKIKF 527
             E       A +++++ LQ D          YE+ LK +N+     Q E+++       F
Sbjct: 323  KESIDKRLSAAVTKIESLQRDIDRQESLVKQYEHQLKVVNKAKTNFQAEIDESAKSSGDF 382

Query: 528  SLKD---------KTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQIS--------- 569
             L +         K   +S   ++LE +L     + QE   +I+L   Q+          
Sbjct: 383  KLNEANLKRYEDLKETFLSSGGSELEDKLLLEKNESQEISDEIELYSRQLDASRLKVNEE 442

Query: 570  LIKEAEAKLAQEIDQFKQEIETRKQQILQGSKELDSLHSQ---HKSVKEEISTGEKECLN 626
            L  E EA L  E+ +  +E+  +  Q+    K+L  L S+   + + + E+S   KE L 
Sbjct: 443  LGAEKEA-LENEVSELTKELSGKTSQVSAAVKKLKELQSRAEYNNNREYEVSFKLKETLT 501

Query: 627  ARIRLKEMQNILNTQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGV 686
               +L +M     TQR+ A + R    N       ++ L RL       G  G + +L  
Sbjct: 502  ---KLDDMN---ATQRETAKE-RKLREN-------VSILRRL-----FPGVRGLVHELCR 542

Query: 687  I-DEKYDVAISTACPR-LEDIVVETVECGQQCIEYLRKNKLGYARFILLDKL--RKFNLD 742
               EKY VA+ST   +  + ++V+     QQC+ +L+K + G   FI LD +   K ++ 
Sbjct: 543  PKKEKYTVAVSTILGKSFDAVIVDHFSVAQQCVSFLKKQRSGILSFIPLDTIDVNKVSMM 602

Query: 743  SINTPESVPRLFDLIHPKDPKFSSAFF---SVLGNTL-VANDLKQANRVAYGKKRFRVVT 798
            +++T      +  + + +D + +  +    S++ ++L +A DLK    V     R ++V+
Sbjct: 603  ALDTKGCTLAIDAIDYERDLERAMQYVCSDSIICDSLAIAKDLKWRRNV-----RAKLVS 657

Query: 799  LDGNLIDISGTMSGGGSRVS---------RGLMQINRNKTEDI-EIYSSEEVAQLEVNLV 848
            LDG+++  +G M+GG ++ S         +GLM +      +I E+ S+  +    +   
Sbjct: 658  LDGSIVHKAGLMTGGTTKSSGNRWDKEEYQGLMSLKDTLLGEISELSSANTIDSERIRST 717

Query: 849  EREKNFQVASDTI---YQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLE 905
            E E +F + SD +    Q+ +  + L EKE  I     Q   E+     E KI+ ++  E
Sbjct: 718  ENELSF-LNSDVMSLRTQLNQVKRSLNEKETEI-----QYQQELIKGEFEPKIQSLK--E 769

Query: 906  SERAYSATQDNNVELRETIQHVQSLKDE----FKSIQNQTKSK---KHRIETLKNEIMEI 958
            +  A++ T     E ++ +        E    FK  Q +  S    + ++E L+   M+I
Sbjct: 770  AMTAHAKTTARFEEEKDRLLDSVYADFEGDIGFKVSQYEKHSGEMMRRQLEDLRKLQMQI 829

Query: 959  GGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLET-SRDLENFNQ 1017
             G E K++        +R+     +Q++ +  I+K         K+KLE  + D +    
Sbjct: 830  AGIEKKLEFE-----TERLQSTQERQQRVQVDIEKA--------KIKLEALNSDEQRITD 876

Query: 1018 EIQTLKTTI-------EGLQDSLNK----VHESVTSVQHTKEGLIEESRTLEDKLNDINE 1066
            EIQ ++ TI       + LQ+ +NK    ++ S  ++Q   E L    R  E    DI+ 
Sbjct: 877  EIQGVELTINEEQTRLDNLQNEINKDLVELNSSEETIQEATEHLQSAKRMHEALAEDID- 935

Query: 1067 DIAIFKSFEMEMKNELEKLNSL 1088
                        KN LEK N L
Sbjct: 936  ------------KNSLEKANVL 945

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
            (SMC1) - SMC chromosomal ATPase family member [contig 7]
            FULL
          Length = 1225

 Score =  137 bits (346), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 65/159 (40%), Positives = 107/159 (67%), Gaps = 12/159 (7%)

Query: 1258 RFDEFMQGFGIISMTLKEMYQMIT---------MGGNAELELVDTLDPFSEGVTFSVMPP 1308
            R + F + F  +S ++ E+Y+ +T          GGNA L L D  +P+  G+ +   PP
Sbjct: 1060 RKEAFEKAFDHVSSSIDEIYRELTRDPHSRAELAGGNASLTLEDEDEPYLAGIRYHATPP 1119

Query: 1309 KKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1368
             K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV  VA+YI+ + 
Sbjct: 1120 AKRFKDMEYLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDISNVERVASYIRRKA 1179

Query: 1369 -KNAQFIVISLRNNMFELAQQLVGIYK--RDNKTKSATI 1404
              + QFIVISL+N MFE +Q LVG+++  ++N +K+ T+
Sbjct: 1180 GADLQFIVISLKNTMFEKSQALVGVFRQQQNNTSKALTL 1218

 Score = 89.7 bits (221), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 90/161 (55%), Gaps = 12/161 (7%)

Query: 148 LILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 207
           L L +FKSY G+  +G  +++F++++GPNGSGKSN++D++ FV G ++  +R   L+DLI
Sbjct: 7   LELNNFKSYKGKVSIGFRDSNFTSIIGPNGSGKSNLMDAISFVLGVKSVHLRSHLLADLI 66

Query: 208 HK---SEEYPSLPSCSVEVH----FKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYY 260
           ++   SEE  S      E H    +      PS     + E   + ++R   R+  S Y 
Sbjct: 67  YRGTLSEEEASSADFESENHPNSAYVKAFYSPS-----NNEDDVVELSRTVTRSQESTYR 121

Query: 261 VNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMK 301
           ++ +   Y + ++ L+ E + +  + FL+ QG+VE +A  K
Sbjct: 122 IDGKTVGYKKYSQFLESENILIKARNFLVFQGDVEQVAAQK 162

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
            (REAL)
          Length = 1230

 Score =  136 bits (343), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 99/153 (64%), Gaps = 10/153 (6%)

Query: 1262 FMQGFGIISMTLKEMYQMIT---------MGGNAELELVDTLDPFSEGVTFSVMPPKKSW 1312
            F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+ +   PP K +
Sbjct: 1069 FEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRF 1128

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNA 1371
            +++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI + R  + 
Sbjct: 1129 KDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDL 1188

Query: 1372 QFIVISLRNNMFELAQQLVGIYKRDNKTKSATI 1404
            QFIVISL+N MFE +  LVG+Y++  +  S TI
Sbjct: 1189 QFIVISLKNTMFEKSDALVGVYRQQQENSSKTI 1221

 Score =  129 bits (324), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 172/701 (24%), Positives = 313/701 (44%), Gaps = 65/701 (9%)

Query: 148 LILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 207
           L L +FKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNVLKDLI 66

Query: 208 HKS---EEYPSLPSCSVEVHFKYVIDEP-SGETRIDEEKPNLVV--TRKAFRNNTSKYYV 261
           ++    +   +                P S   +   +K N +V   R   RN  + Y +
Sbjct: 67  YRGILNDGNDNDNDDDSASDDDATTSNPKSAYVKAFYQKGNKLVELMRIISRNGDTSYKI 126

Query: 262 NDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIG 321
           + +  +Y + +  L+ E + +  K FL+ QG+VE IA                    + G
Sbjct: 127 DGKSVSYRDYSVFLENENILIKAKNFLVFQGDVEQIAAQSP-------IELSKMFEEVSG 179

Query: 322 TAKYKPLIEKNLADMESLNDICIEK-ENRFQIVDREKNSLE--NGKEEALLFLENERKLT 378
           + +YK   ++    +E L     E  +NR +I    K   E  N  EE +  ++ + +L 
Sbjct: 180 SIQYKKEYDELKEKIEKLGKSATESIKNRRRIHGELKTYKEGINKNEEYIKQVDKKNELQ 239

Query: 379 VSKSKLYQYHILNSNMKLKNTL----DKITNLNQKLEKESDKNASVKKELDKLRAFGDEL 434
             ++    YH+     +L + L     ++++L +K+  E       K    K      + 
Sbjct: 240 RFQALWQLYHLEQQKEELMDKLSASNSEVSSLKEKINNEMKSLQRSKSSFVKEGTIISKQ 299

Query: 435 ESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARL 494
           +SKL+    ++++L+   R +        ++I + EK+ +  ++ L   +  +   E +L
Sbjct: 300 KSKLEYIVKDKEKLVSDLRLIKVPQQAAGKRISHIEKRIESLQRDLGRQEAYVERFETQL 359

Query: 495 SELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQL 554
             + + +  +E  +KE       EK KL +      D  +         EK L    + L
Sbjct: 360 KVVTKSKKTFEEEIKE--SARNYEKFKLNENDLKTYDLLH---------EKYLTQGGSVL 408

Query: 555 QEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQI----LQGSKELDSLHSQH 610
           +EK          ISL    + ++  E+D+F +  +  K++I    L   ++LD+  +  
Sbjct: 409 EEK----------ISLSNNHKQEILDELDRFNKRADISKRRITEELLITGEKLDTQLNDL 458

Query: 611 KSVKEEISTGEKECLNARIRLKEMQNILNTQRQKALDARSALSNAENKSKVLTALSRLQK 670
           ++   E +    E LN   +LK++Q+ + +   K  D    L     K   L+A  R   
Sbjct: 459 RASLNEKNALHTERLN---QLKKLQSDIESANNKEYDLNFKLRETLVKIDDLSANQRETM 515

Query: 671 SGR------------ISGFHGRLGDLG-VIDEKYDVAISTACPR-LEDIVVETVECGQQC 716
             R              G  G + DL     EKY +A+ST   R  + ++VE +   Q+C
Sbjct: 516 KERKLRENIAMLKRFFPGVKGLVHDLCHPKKEKYGLAVSTILGRNFDSVIVENLTVAQEC 575

Query: 717 IEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDL-IHPKDPKFSSAFFSVLGNT 775
           I +L+K + G A FI LD +   +L +++ P+S   +  +     D ++  A   V G++
Sbjct: 576 IAFLKKQRAGTASFIPLDTIET-DLPTLSLPDSQDYILSINAIDYDSEYEKAMQYVCGDS 634

Query: 776 LVANDLKQANRVAYGKK-RFRVVTLDGNLIDISGTMSGGGS 815
           ++ N L  A  + + K  R ++VT++G LI  +G M+GG S
Sbjct: 635 IICNTLNIAKDLKWKKSVRAKLVTIEGALIHKAGLMTGGIS 675

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (REAL)
          Length = 1264

 Score =  136 bits (342), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 64/153 (41%), Positives = 99/153 (64%), Gaps = 10/153 (6%)

Query: 1262 FMQGFGIISMTLKEMYQMIT---------MGGNAELELVDTLDPFSEGVTFSVMPPKKSW 1312
            F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+ +   PP K +
Sbjct: 1103 FEKTFDYVSDHLDAIYRELTKNPNSTVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRF 1162

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNA 1371
            +++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI + R  + 
Sbjct: 1163 KDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDL 1222

Query: 1372 QFIVISLRNNMFELAQQLVGIYKRDNKTKSATI 1404
            QFIVISL+N MFE +  LVG+Y++  +  S T+
Sbjct: 1223 QFIVISLKNTMFEKSDALVGVYRQQQENSSKTV 1255

 Score =  131 bits (329), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 196/729 (26%), Positives = 333/729 (45%), Gaps = 99/729 (13%)

Query: 135 QNQARHTRLCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFR 194
           +NQ+   RL    L L +FKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R
Sbjct: 32  KNQSTMGRLV--GLELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVR 89

Query: 195 ANKMRQDRLSDLIHKS-------EEYPSLPSCSVEVHFKYVIDEP-SGETRIDEEKPNLV 246
           +N +R + L DLI++        E   S    +       +   P S   +   +K N +
Sbjct: 90  SNHLRSNILKDLIYRGVLDDGNDENIDSGADDNA------ITSNPNSAYVKAFYQKGNKL 143

Query: 247 V--TRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKA 304
           V  TR   RN  + Y ++ +   Y + +  L+ E + +  K FL+ QG+VE IA      
Sbjct: 144 VELTRLISRNGDTTYKIDGKTVTYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSP-- 201

Query: 305 XXXXXXXXXXXXXXIIGTAKYKPLIEKNLADMESLNDICIEK-ENRFQIVDREKNSLE-- 361
                         + G+ +YK   ++    +E L+    E  +NR +I    K   E  
Sbjct: 202 -----TDLSRMFEEVSGSIQYKKEYDELKEKIEKLSKSATESIKNRRRIHGELKTYKEGI 256

Query: 362 NGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASVK 421
           N  EE        RK    K++L ++            L K+ +L QK           K
Sbjct: 257 NKNEEY-------RKQVDKKNELQKFQ----------ALWKLYHLEQK-----------K 288

Query: 422 KEL-DKLRAFGDELESKLKNCNNEEKQLLGKKRE-LDGKNVLNEEKIKNFEKKRDKAEKT 479
           +EL DKL A   E+ S  +  NNE K L   K   +    V++++K K     +DK EK 
Sbjct: 289 EELTDKLSASNSEIMSLKERINNETKSLQRSKSSFVKESTVISKQKSKLDYIVKDK-EKL 347

Query: 480 LSSM----------DRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSL 529
           +S +           R IS  E R+  L Q  ++ + S  E  E T+++ +   K  F  
Sbjct: 348 MSDLRLIKVPQQAAGRRISHIEKRIGSL-QRDLERQESYVERFE-TQLKVITKSKKTFEE 405

Query: 530 KDKTNGISLEIAQL-EKELEPWNAQLQEKKTQ-IQLAESQISLIKEAEAKLAQEIDQFKQ 587
           + K +  + +  +L E +L+ +++  ++  TQ   + E +ISL    + ++  E+D+F +
Sbjct: 406 EIKESARNYDKFKLNESDLKTYDSLHEKYLTQGGSILEEKISLSNNDKQEIVDELDRFNK 465

Query: 588 EIETRKQQI-----LQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQR 642
             +  K++I     + G K LD+  +  ++   E +    E LN    LK++Q+ + +  
Sbjct: 466 RADISKRRITEELFITGEK-LDTQLNDLRASLNEKNALHTERLN---ELKKLQSDIESAN 521

Query: 643 QKALDARSALSNAENKSKVLTALSRLQKSGR------------ISGFHGRLGDLG-VIDE 689
            +  D    L     K   L+A  R     R              G  G + DL     E
Sbjct: 522 NQEYDLNFKLRETLVKIDDLSANQRETMKERKLRENIAMLKRFFPGVKGLVHDLCHPKKE 581

Query: 690 KYDVAISTACPR-LEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPE 748
           KY +A+ST   R  + ++VE +   Q+CI +L+K + G A FI LD +    L +++ P+
Sbjct: 582 KYGLAVSTILGRNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLDTIET-ELPTLSLPD 640

Query: 749 SVPRLFDL-IHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKK-RFRVVTLDGNLIDI 806
           S   +  +     +P++  A   V G++++ N L  A  + + K  R ++VT++G LI  
Sbjct: 641 SQDYILSINAIDYEPEYEKAMQYVCGDSIICNTLNIAKDLKWKKGVRAKLVTIEGALIHK 700

Query: 807 SGTMSGGGS 815
           +G M+GG S
Sbjct: 701 AGLMTGGIS 709

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
           SMC2Subunit of the condensin complex; essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase; Smc2p/Smc4p
           complex binds DNA; required for clustering of tRNA genes
           at the nucleolus
          Length = 1170

 Score =  135 bits (341), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 189/724 (26%), Positives = 340/724 (46%), Gaps = 95/724 (13%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 203
           +++LI+  FKSYA R V+  ++  F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 204 SDLIHKSEEYPSLPSCSVEVHFKYV--IDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYV 261
            DLI+K  +   +   SV + F      + P G T      P + VTR+     TSKY +
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNTDKSNSPIGFTN----SPQISVTRQVVLGGTSKYLI 117

Query: 262 NDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIG 321
           N        V +L +   +++++  FLI+QG++  +  MK                   G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSEILSLIEEAA-------G 170

Query: 322 TAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENE------- 374
           T  ++   EK    M         +ENR  + +  +  LE  + E  +FLE +       
Sbjct: 171 TKMFEDRREKAERTMSKKETKL--QENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQTDLE 228

Query: 375 --RKLTVSKSKLYQYH-ILNSNMKLKNTLD----KITNLNQKLEKESDKNASVKKELDKL 427
              ++ VS    Y+Y+ I + +  ++ TL+    ++  LN+ ++K S++  S+ ++++++
Sbjct: 229 KTERIVVS----YEYYNIKHKHTSIRETLENGETRMKMLNEFVKKTSEEIDSLNEDVEEI 284

Query: 428 RAFGD-EL--ESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMD 484
           +   + EL  E  +    N+E  LL +   L     +   K++N     D  EK+  +++
Sbjct: 285 KLQKEKELHKEGTISKLENKENGLLNEISRLKTSLSI---KVENL---NDTTEKS-KALE 337

Query: 485 RSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLE 544
             I+SS A+L E K    + E   K + EQ   ++   ++ +  +   T GIS   A   
Sbjct: 338 SEIASSSAKLIEKKSAYANTEKDYKMVQEQLSKQRDLYKRKEELVSTLTTGISSTGAA-- 395

Query: 545 KELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKELD 604
                +NAQL + KT++    +++SL   A  K + +++  K+E+ T + ++ + +K+ +
Sbjct: 396 --DGGYNAQLAKAKTEL----NEVSL---AIKKSSMKMELLKKELLTIEPKLKEATKD-N 445

Query: 605 SLHSQHKSVKEEISTGEKECLNARI--------RLKEMQNILNTQRQKALDAR--SALSN 654
            L+ +H  VK+   T +K  L AR+        R+K+++     QR+  L +       N
Sbjct: 446 ELNVKH--VKQCQETCDK--LRARLVEYGFDPSRIKDLK-----QREDKLKSHYYQTCKN 496

Query: 655 AENKSKVLTAL----SRLQKSGRISGFHGRLGDLGVIDE---KYDVAIST-ACPRLEDIV 706
           +E   + +T L    ++   +   S  HG +G L  ID    +Y  A+ T A  RL ++V
Sbjct: 497 SEYLKRRVTNLEFNYTKPYPNFEASFVHGVVGQLFQIDNDNIRYATALQTCAGGRLFNVV 556

Query: 707 VETVECGQQCIEYLRKNKLGYARFILLDKL-------RKFNLDSINTPESVPRLFDLIHP 759
           V+  +   Q +E  R  K      I LDK+       +  +L     P  V    +LI  
Sbjct: 557 VQDSQTATQLLERGRLRK--RVTIIPLDKIYTRPISSQVLDLAKKIAPGKVELAINLIRF 614

Query: 760 KDPKFSSAFFSVLGNTLVANDLKQANRVAYGKK-RFRVVTLDGNLIDISGTMSGGGSRVS 818
            D   + A   + GN+L+  D + A ++ +  K R R +TL G++ D  GT+SGG    S
Sbjct: 615 -DESITKAMEFIFGNSLICEDPETAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTS 673

Query: 819 RGLM 822
             L+
Sbjct: 674 ESLL 677

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1312 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1370
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1371 AQFIVISLRNNMF 1383
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
            (REAL)
          Length = 1228

 Score =  134 bits (338), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 64/153 (41%), Positives = 98/153 (64%), Gaps = 10/153 (6%)

Query: 1262 FMQGFGIISMTLKEMYQMIT---------MGGNAELELVDTLDPFSEGVTFSVMPPKKSW 1312
            F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+ +   PP K +
Sbjct: 1067 FEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRF 1126

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNA 1371
            +++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI + R  + 
Sbjct: 1127 KDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDL 1186

Query: 1372 QFIVISLRNNMFELAQQLVGIYKRDNKTKSATI 1404
            QFIVISL+N MFE +  LVG+Y++  +  S  I
Sbjct: 1187 QFIVISLKNTMFEKSDALVGVYRQQQENSSKII 1219

 Score = 85.9 bits (211), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 85/155 (54%), Gaps = 4/155 (2%)

Query: 148 LILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 207
           L L +FKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 208 HKSEEYPSLPSCSVEVHFKYVI--DEPSGETRIDEEKPNLVV--TRKAFRNNTSKYYVND 263
           ++            +     V   +  S   +   +K N +V   R   RN  + Y +++
Sbjct: 67  YRGVLNDDNDDNYNDTSDDDVASSNPKSAYVKAFYQKGNKMVELMRIISRNGDTSYKIDE 126

Query: 264 QETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIA 298
           +  +Y + +  L+ E + +  K FL+ QG+VE IA
Sbjct: 127 KTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIA 161

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 93/363 (25%), Positives = 167/363 (46%), Gaps = 54/363 (14%)

Query: 676  GFHGRLGDLG-VIDEKYDVAISTACPR-LEDIVVETVECGQQCIEYLRKNKLGYARFILL 733
            G  G + DL     EKY +A+ST   +  + ++VE +   Q+CI +L+K + G A FI L
Sbjct: 531  GVKGLVHDLCHPKKEKYGLAVSTILGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPL 590

Query: 734  DKLRKFNLDSINTPESVPRLFDL-IHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKK 792
            D +    L +++ P+S   +  +     +P++  A   V G++++ N LK A  + + K 
Sbjct: 591  DTIET-ELPTLSLPDSQEYILSINAIDYEPEYEKAMQYVCGDSIICNSLKIAKGLKWNKG 649

Query: 793  -RFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRNKTEDIEIYSSEEVAQLEVNLVERE 851
             R ++VT++G LI  +G M+GG S         + N   D E Y S         L+  +
Sbjct: 650  VRAKLVTIEGALIHKAGLMTGGISG--------DANNRWDKEEYQS---------LMSLK 692

Query: 852  KNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYS 911
                V  D +   +     ++ +E  +EN++S L       NS+I     Q+ + +R+  
Sbjct: 693  DKLLVQIDELSNSQRS-NSIRARE--VENSVSLL-------NSDIASLRTQVTQQKRSLD 742

Query: 912  ATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVD 971
               +NN+E++    H   L+ E +    + + K   +E  KN      G E      K  
Sbjct: 743  ---ENNLEIK---YHNDLLEKEIQPKITELEKKLDDLENTKN------GLE------KEK 784

Query: 972  SVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQD 1031
             ++Q  DI      K    IK+ EN    S ++  + S++L+   ++I T++  ++   D
Sbjct: 785  EILQN-DIFKEFTSKIGFSIKEYENH---SGELMRQQSKELQQLQKQILTVENKLQFETD 840

Query: 1032 SLN 1034
             LN
Sbjct: 841  RLN 843

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit of
            the multiprotein cohesin complex, essential protein
            involved in chromosome segregation and in double-strand
            DNA break repair; SMC chromosomal ATPase family member,
            binds DNA with a preference for DNA with secondary
            structure
          Length = 1225

 Score =  134 bits (338), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 64/153 (41%), Positives = 98/153 (64%), Gaps = 10/153 (6%)

Query: 1262 FMQGFGIISMTLKEMYQMIT---------MGGNAELELVDTLDPFSEGVTFSVMPPKKSW 1312
            F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+ +   PP K +
Sbjct: 1064 FEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRF 1123

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNA 1371
            +++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI + R  + 
Sbjct: 1124 KDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDL 1183

Query: 1372 QFIVISLRNNMFELAQQLVGIYKRDNKTKSATI 1404
            QFIVISL+N MFE +  LVG+Y++  +  S  I
Sbjct: 1184 QFIVISLKNTMFEKSDALVGVYRQQQENSSKII 1216

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 89/160 (55%), Gaps = 17/160 (10%)

Query: 148 LILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 207
           L L +FKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 208 HK-------SEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVV--TRKAFRNNTSK 258
           ++       S++Y +  + S      YV        +   +K N +V   R   RN  + 
Sbjct: 67  YRGVLNDENSDDYDNEGAASSNPQSAYV--------KAFYQKGNKLVELMRIISRNGDTS 118

Query: 259 YYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIA 298
           Y ++ +  +Y + +  L+ E + +  K FL+ QG+VE IA
Sbjct: 119 YKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIA 158

 Score = 73.6 bits (179), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 180/820 (21%), Positives = 359/820 (43%), Gaps = 166/820 (20%)

Query: 440  NCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLS-ELK 498
            N N E ++ L KK EL     L   ++ + E+++++    LS+++  ISS + +++ E+K
Sbjct: 218  NKNEEYRKQLDKKNELQKFQAL--WQLYHLEQQKEELTDKLSALNSEISSLKGKINNEMK 275

Query: 499  QLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGIS-------------LEIAQLEK 545
             LQ    + +KE    + V   +  K+ +  KDK   +S               I+ +EK
Sbjct: 276  SLQRSKSSFVKE----SAVISKQKSKLDYIFKDKEKLVSDLRLIKVPQQAAGKRISHIEK 331

Query: 546  ELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEI-------DQFK------------ 586
             +E     LQ +KT ++  E+Q+ ++  ++    +EI       D+FK            
Sbjct: 332  RIESLQKDLQRQKTYVERFETQLKVVTRSKEAFEEEIKQSARNYDKFKLNENDLKTYNCL 391

Query: 587  --------QEIETRKQQILQGSK-----ELDSLHSQ----HKSVKEEIS-TGEK---ECL 625
                      I   K  +L   K     EL+  + +     + + EE+S TGEK   +  
Sbjct: 392  HEKYLTEGGSILEEKIAVLNNDKREIQEELERFNKRADISKRRITEELSITGEKLDTQLN 451

Query: 626  NARIRLKEMQNILNTQRQKALDA-RSALSNAENKS--------KVLTALSRLQKSGR--- 673
            + R+ L E +N L+T+R   L   +S + +A N+         + L  +  L  + R   
Sbjct: 452  DLRVSLNE-KNALHTERLHELKKLQSDIESANNQEYDLNFKLRETLVKIDDLSANQRETM 510

Query: 674  ---------------ISGFHGRLGDLG-VIDEKYDVAISTACPR-LEDIVVETVECGQQC 716
                             G  G + DL     EKY +A+ST   +  + ++VE +   Q+C
Sbjct: 511  KERKLRENIAMLKRFFPGVKGLVHDLCHPKKEKYGLAVSTILGKNFDSVIVENLTVAQEC 570

Query: 717  IEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDL-IHPKDPKFSSAFFSVLGNT 775
            I +L+K + G A FI LD +    L +++ P+S   +  +     +P++  A   V G++
Sbjct: 571  IAFLKKQRAGTASFIPLDTIET-ELPTLSLPDSQDYILSINAIDYEPEYEKAMQYVCGDS 629

Query: 776  LVANDLKQANRVAYGKK-RFRVVTLDGNLIDISGTMSGG--GSRVSRG------------ 820
            ++ N L  A  + + K  R ++VT++G LI  +G M+GG  G   +R             
Sbjct: 630  IICNTLNIAKDLKWKKGIRGKLVTIEGALIHKAGLMTGGISGDANNRWDKEEYQSLMSLK 689

Query: 821  ---LMQIN-------------RNKTEDIEIYSSE------EVAQLEVNLVEREKNFQVAS 858
               L+QI+             R     + + +S+      +V Q + +L E     +  +
Sbjct: 690  DKLLIQIDELSNGQRSNSIRAREVENSVSLLNSDIANLRTQVTQQKRSLDENRLEIKYHN 749

Query: 859  DTI-YQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNN 917
            D I  +++ ++ +LK+K   +EN    L  E E+  + I     +   S+  ++  +  N
Sbjct: 750  DLIEKEIQPKITELKKKLDDLENTKDNLVKEKEALQNNI----FKEFTSKIGFTIKEYEN 805

Query: 918  VE---LRETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEI------MEIGGAELKIQSS 968
                 +R+  + +Q L+ +  +++N+ + +  R+ T +         +E    E+K    
Sbjct: 806  HSGELMRQQSKELQQLQKQILTVENKLQFETDRLSTTQRRYEKAQKDLENAQVEMKSLEE 865

Query: 969  KVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETSRD-LENFNQEIQTLKTTIE 1027
            +  ++  +I  + SK ++ ++ + + + +   + + +L +S D LE+ N  +Q LK   +
Sbjct: 866  QEYAIEMKIGSIESKLEEHKNHLDELQKKF-VTKQSELNSSEDILEDMNSNLQVLKRERD 924

Query: 1028 GLQDSLNKVH-ESVTSVQHTKEGLIEESRTLEDKLNDI------NEDIAIFKSFEMEMKN 1080
            G+++ + K   E VT++++ K   I    + E  ++D+      NE I I          
Sbjct: 925  GIKEDIEKFDLERVTALKNCKISNINIPISSETTIDDLPISSTDNEAITIS--------- 975

Query: 1081 ELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKD 1120
                 NS+  + K   K Y+E   D   +++ Q +H++++
Sbjct: 976  -----NSIDINYKGLPKKYKENNTDSARKELEQKIHEVEE 1010

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  134 bits (336), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 65/155 (41%), Positives = 100/155 (64%), Gaps = 12/155 (7%)

Query: 1262 FMQGFGIISMTLKEMYQMITM---------GGNAELELVDTLDPFSEGVTFSVMPPKKSW 1312
            F   F  ++  L  +Y+ +T          GGNA L L D  +PF+ G+ +  MPP K +
Sbjct: 1062 FENAFDFVNEHLDPIYRELTRNPNSSALLSGGNASLTLEDEDEPFNAGIKYHAMPPLKRF 1121

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNA 1371
            +++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI+     + 
Sbjct: 1122 KDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYIRRHGNPDL 1181

Query: 1372 QFIVISLRNNMFELAQQLVGIYK--RDNKTKSATI 1404
            QFIVISL+N MFE +  LVG+Y+  ++N +K  T+
Sbjct: 1182 QFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTL 1216

 Score =  131 bits (330), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 241/1013 (23%), Positives = 445/1013 (43%), Gaps = 181/1013 (17%)

Query: 148  LILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 207
            L L +FKSY G   +G  +++F++++GPNGSGKSN++D++ FV G R++ +R + L DLI
Sbjct: 7    LELSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNILKDLI 66

Query: 208  HK------SEEYP-----SLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNT 256
            ++      SEE P       P+ +    F Y +D    E           + R    N  
Sbjct: 67   YRGVIRDFSEEDPEDGEEQHPTSAYVKAF-YEMDGKVVE-----------LMRTININGD 114

Query: 257  SKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXX 316
            + Y ++++  +Y +    L+KE + +  K FL+ QG+VE IA   +              
Sbjct: 115  TTYKIDNKTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIASQSA-------LDLSKLF 167

Query: 317  XXIIGTAKYKPLIEKNLADMESLNDICIEK-ENRFQIVDREKNSLEN-GKEEALLFLENE 374
              I G+ +YK   +    ++E L     E   NR +I    K   E   K+E       E
Sbjct: 168  EEISGSIQYKKEYDSLKDELEKLGKSTTESIRNRRRIHGELKTYKEGISKDE-------E 220

Query: 375  RKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDEL 434
             K  V K K Y+ +          TL K+ +L+ +  +  DK    K E+ KL+      
Sbjct: 221  YKNNVEKKKKYEMYF---------TLWKLFHLDAQRIQFKDKLKQAKTEMSKLK------ 265

Query: 435  ESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMD---------- 484
                +  NNEEK L   K     +N +  +K    +    + EK +S  +          
Sbjct: 266  ----EKINNEEKHLTRSKSAFLKENSILTKKRSQLDYTVKEKEKVISQCNSIKIPLRASS 321

Query: 485  RSISSSEARLSELK---QLQVDY----ENSLKELNEQTEVEKMKLEKI-----KFSLKDK 532
            + I + E R+   K   + Q DY    EN LK + +  E+ +++++K      KF L D 
Sbjct: 322  KRIMNIEKRIESFKRDIERQKDYVSTFENQLKVVTKAKELFEVEIKKSARNHDKFRLTDT 381

Query: 533  -------------TNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLA 579
                         + G SL    LE+++   N   QEK  +++L    I + K    ++ 
Sbjct: 382  DLKWYEQLNEKYLSTGGSL----LEQKISLLNNDKQEKTDEMELLNRHIDVSKN---RVT 434

Query: 580  QEIDQFKQEIETRKQQILQGSKELDSLHS-QHKSVKE-----EISTGEKECLNARIR--L 631
            +E++   + ++ +   +     E ++ ++ Q K +K+     E S  ++  LN ++R  L
Sbjct: 435  EELNITGENLQNQVTDMTSTLNEKNATYAEQMKKLKDYQMQVESSNNQEYDLNYKLRETL 494

Query: 632  KEMQNILNTQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVI-DEK 690
             ++ ++   QR+ +L  +    N       +T L R        G  G + DL     EK
Sbjct: 495  VKLDDLSANQRE-SLKEKKLREN-------VTMLKRF-----FPGVKGLVHDLCRPKKEK 541

Query: 691  YDVAISTACPR-LEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPES 749
            Y +A+S    +  + I+VE +   ++CI +L+K + G A FI LD      +DS     S
Sbjct: 542  YGLAVSVMLGKNFDSIIVENLSVARECISFLKKQRAGTASFIPLD-----TIDSEQPTLS 596

Query: 750  VPRLFDLIHP-----KDPKFSSAFFSVLGNTLVANDLKQANRVAYGKK-RFRVVTLDGNL 803
             P   + I        D  +  A   V G++++ + L  A  + + +  R ++V+LDG+L
Sbjct: 597  APPSQEYILTINAIEYDLAYERAMQYVCGDSIICDTLDIARDLKWNRGVRSKLVSLDGSL 656

Query: 804  IDISGTMSGGGSRVSRG-----------------LMQINRNKT-------EDIEIYSS-- 837
            I  +G M+GG S+ S+                  L+QI    T       +  E+ SS  
Sbjct: 657  IHKAGLMTGGISKDSKNRWDKEEYQSLMTLKDKLLIQIEEVSTVGRDAAAKARELESSLS 716

Query: 838  ---EEVAQLEVNLVEREKNFQVASDTIY--------QMEEQLKDLKEKEPAIENNISQLT 886
                E++ L   LV+ +++ +  ++ I         Q   +L+ L+E+  AIEN+IS +T
Sbjct: 717  LLNAELSSLRTQLVQVKRSVEENANEINYHNKLLTEQYTPKLESLQEEIQAIENSISSIT 776

Query: 887  MEIESWNSEIKIKEIQMLESERAYSATQD----NNVELRETIQHVQSLKDEFKSIQNQTK 942
             E  S    I  KE+    +++   + QD    +   +RE  + +Q L+ +  +I+N+ +
Sbjct: 777  AEKVSLQETI-FKEL----TDKVGFSIQDYERYSGDLMREQSKELQQLQKQILNIKNKLQ 831

Query: 943  SKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSH 1002
             +  R++T + +        L+   S + S+ +  +    K+K+    I + E E+N+  
Sbjct: 832  FESERLKTTEGK-YHASLESLESAKSNLQSLEEEENECQQKRKQIEQHISEDEAELNRLQ 890

Query: 1003 KMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESR 1055
            ++      D  N +  +      ++ L+ + N++ E +  +   + G+++  +
Sbjct: 891  RVYDARQLDFNNLDDVLAEYNNELQSLKHNRNQIREDMEKIDLERVGVLKNCK 943

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
            YFL008W
          Length = 1219

 Score =  134 bits (336), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 103/157 (65%), Gaps = 10/157 (6%)

Query: 1258 RFDEFMQGFGIISMTLKEMYQMIT---------MGGNAELELVDTLDPFSEGVTFSVMPP 1308
            R + F + F  +S  ++ +Y+ +T          GGNA L L D  +PF  G+ +   PP
Sbjct: 1054 RREVFEKAFDYVSEHIEPIYRELTKNPNSTAELSGGNASLTLEDEDEPFDAGIKYHATPP 1113

Query: 1309 KKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1368
             K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  N+  +ANYI++ +
Sbjct: 1114 LKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFILDEVDAALDVTNIERIANYIRKHS 1173

Query: 1369 -KNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATI 1404
              + QFIVISL+N+MFE +  LVGI+++  +  S  +
Sbjct: 1174 NSDIQFIVISLKNSMFEKSDALVGIHRQQQENSSRVV 1210

 Score =  125 bits (315), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 223/948 (23%), Positives = 414/948 (43%), Gaps = 106/948 (11%)

Query: 148  LILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 207
            L L +FKSY G   VG   ++F++++GPNGSGKSN++D++ FV GF+++ +R   L DL+
Sbjct: 7    LELFNFKSYKGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGFQSSNLRSSTLKDLV 66

Query: 208  HKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVV--TRKAFRNNTSKYYVNDQE 265
            ++        + + E  F     E S   +   EK   VV   R       S Y ++++ 
Sbjct: 67   YRD------IASADENEFGED-GERSAYVKAFYEKDGTVVELMRAITAGRDSVYKIDNKT 119

Query: 266  TNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGTAKY 325
            T Y   +  L  E + +  + FL+ QG+VE IA    +               + G+ KY
Sbjct: 120  TTYKHYSDFLAAENILIKARNFLVFQGDVEQIAAQSPR-------QLTKLFEEVSGSIKY 172

Query: 326  KPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENG---KEEALLFLENERKLTVSKS 382
            K   E+    +E L++   E     + +  E    E+G    E+    LE   KL V  +
Sbjct: 173  KKEYEELKEKIEKLSESAAESAKNRRRIQGEMKIYEDGISKDEKYKKQLEVRDKLQVHLA 232

Query: 383  KLYQYHILN----SNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKL 438
                +H+      S  KLK   +K+  L  ++ +E       K E+ K  +   + +++L
Sbjct: 233  LWQLFHLEQEEKLSTKKLKEVKNKVMKLTDQVNEEETNVKKAKNEVIKETSLQMKQQNRL 292

Query: 439  KNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELK 498
                 E+  LL +   +       E+++ N EK+ +   + +      +S  E +L  +K
Sbjct: 293  DYKEKEKDNLLSELTPIQLSQRSAEKRLANIEKRIESIARDMERQKTYVSRYEKQLKVVK 352

Query: 499  QLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKK 558
            + +  +E  LK+ N   +  ++  E +K   +     ++    +L+ +L   N + ++  
Sbjct: 353  KTKDTFEEELKQSNSNPDKYRLNDEDMKLYERLNEQYLTEGGFELDTKLSLLNNEKKDID 412

Query: 559  TQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKELDSLHSQHKSVKEEIS 618
             +++L + +I + K       +  D+F  + E  + Q ++ S EL+  +S H ++  ++ 
Sbjct: 413  DELELLQKRIDMSKN------RITDEFAVKGENFELQAVELSSELNEKNSLHLNLANKLK 466

Query: 619  TGEKECLNARIRLKEMQNILNTQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFH 678
              + +  +   +  E+ + L     K  DA +       + K+   +S L++     G  
Sbjct: 467  KIQSDIESTSNKEYELNHKLRDTLVKLDDASANQRETLKEKKLRENVSMLKRF--FPGVK 524

Query: 679  GRLGDLG-VIDEKYDVAISTACPR-LEDIVVETVECGQQCIEYLRKNKLGYARFILLDKL 736
            G + DL     EKY +A+ST   +  + +VV+T+   Q+CI YL+K + G   FI LD +
Sbjct: 525  GLVSDLCHPKKEKYALAVSTILGKNFDSVVVDTLSVAQECITYLKKQRAGIISFIPLDTI 584

Query: 737  RKF--NLDSINTPESVPRLFDLIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKK-R 793
              F   L + N  + +  + + I   D ++  A   V  ++++ + L  A  + +     
Sbjct: 585  DAFVPTLPTTNI-QGITLVLNAID-YDQEYDKAMQYVCSDSIMCDTLSIAKSLKWKHNVT 642

Query: 794  FRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRNKTEDIEIYSSEEVAQLEVNLVEREKN 853
             ++VTL+G LI  +G M+GG S+      Q NR   E+ +             LV  +  
Sbjct: 643  SKLVTLEGTLIHRAGLMTGGVSK-----EQGNRWDKEEYQ------------GLVTLKDK 685

Query: 854  FQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSAT 913
              +    I Q+    K    +   +E+NISQL   I    ++I           +   + 
Sbjct: 686  LLIQ---IEQLSNNSKTFAIEARDLESNISQLNSSISDLRTQIS----------QINRSI 732

Query: 914  QDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSV 973
            ++N  E++    H   LK E++  QNQ  +K   IE  K+EI  IG  EL +Q++     
Sbjct: 733  EENKAEVQ---YHEDMLKKEYEPKQNQLNTKLESIEKSKSEI--IGQKEL-LQNTVFKEF 786

Query: 974  IQRIDIVVSKQKKERSVIKKTENE---------INKSHKMKLETSR-------------D 1011
              ++   + + +       +  N+         +N   K++ E  R             D
Sbjct: 787  HNKLGFTIQEYEHHSGEALRQSNKELQQLEKQVLNIESKLQFEVERYESTEKRHKKAQID 846

Query: 1012 LENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLED 1059
            LEN N       +TIE LQ++  +V   V  ++  + G++E  + LED
Sbjct: 847  LENNN-------STIESLQENEAEV---VAKIKDIENGMLEIKKVLED 884

>KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  134 bits (336), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 65/155 (41%), Positives = 101/155 (65%), Gaps = 12/155 (7%)

Query: 1262 FMQGFGIISMTLKEMYQMITM---------GGNAELELVDTLDPFSEGVTFSVMPPKKSW 1312
            F + F  ++  L  +Y+ +T          GGNA L L D  +PF+ G+ +   PP K +
Sbjct: 1062 FEKAFEHVTNHLDSIYRELTRDPHSSAELSGGNASLTLEDEDEPFNAGIRYHATPPLKRF 1121

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNA 1371
            +++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD RNV  +A YI+     N 
Sbjct: 1122 KDMEYLSGGEKTMAALALLFAINSFQPSPFFVLDEVDAALDVRNVERIAAYIRRHGNPNL 1181

Query: 1372 QFIVISLRNNMFELAQQLVGIYK--RDNKTKSATI 1404
            QFIVISL+N MFE +  LVG+Y+  ++N +K  T+
Sbjct: 1182 QFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTL 1216

 Score =  130 bits (328), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 252/1027 (24%), Positives = 461/1027 (44%), Gaps = 189/1027 (18%)

Query: 148  LILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 207
            L L +FKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7    LELYNFKSYKGSVKLGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSSILRDLI 66

Query: 208  HK---------SEEYPSL--PSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNT 256
            ++         S+E  S+  PS +    F             ++E   + + R   RN  
Sbjct: 67   YRGVITGEDSESDEDGSVNNPSTAYVKAF------------YEKENKTIELMRTISRNGD 114

Query: 257  SKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXX 316
            + Y +  +  +Y + +  L+ E + +  K FL+ QG+VE IA                  
Sbjct: 115  TNYKIGGKVVSYKDYSSFLESENILIKAKNFLVFQGDVEQIASQSP-------MDLSRLF 167

Query: 317  XXIIGTAKYKPLIEKNLADMESLNDICIEK-ENRFQIVDREKNSLEN-GKEEALLFLENE 374
              + G+ +YK   ++    ME L+    E  +NR +I    K   E   K+E       E
Sbjct: 168  EEVSGSIQYKKEYDQLKEKMEQLSKAATESIKNRRRIHGELKTYKEGINKDE-------E 220

Query: 375  RKLTVSKSK-------LYQ-YHI----LNSNMKLKNTLDKITNLNQKLEKESDKN----- 417
             K  V+K K       L+Q YH+    +N    + +T  K++ L  K+  E ++N     
Sbjct: 221  YKSKVAKKKELQTILVLWQLYHLEQKKINIMKNMADTKSKMSVLKDKIHNE-ERNLQRAK 279

Query: 418  ASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAE 477
             S+ KE+  +    D+++ KLK    E++++    + +    +   ++I N EK+ +  E
Sbjct: 280  TSIAKEMSIITKKKDKIDYKLK----EKEKIASDLKLIKLPQLSTIKRIGNIEKRIESFE 335

Query: 478  KTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGIS 537
            K    ++R  S  E   ++LK +    E   +EL E +    M  +K + + ++K N  S
Sbjct: 336  K---DIERQSSFVERFTNQLKVVTKTKEAFERELKETS----MNFDKYRLNDEEKENYQS 388

Query: 538  LEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQI- 596
            L     EK L    + ++EK          I + +  + ++ +E+++F++ I+  KQ+I 
Sbjct: 389  LN----EKYLTSGGSSIEEK----------IMINENDKQEVGEELNRFEKLIDISKQRIN 434

Query: 597  -----------LQGSK------ELDSLHSQH----KSVKEEI--STGEKECLNARIR--L 631
                       L+ S+      E +S+H++     K ++ +I  ++ ++  LN ++R  L
Sbjct: 435  DVLMVELENNQLRASELTTLLNEKNSIHAERLKELKGLQSDIESASNQEYDLNYKLRETL 494

Query: 632  KEMQNILNTQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLG-VIDEK 690
             ++ ++   QR+ ++  R    N       +  L RL       G  G + DL     +K
Sbjct: 495  VQIDDLSANQRE-SMKERKLREN-------VAMLKRL-----FPGVKGLVYDLCHPKKDK 541

Query: 691  YDVAISTACPR-LEDIVVETVECGQQCIEYLRKNKLGYARFILLDKL-RKFNLDSINTPE 748
            Y +A+ST   R  + ++V+     Q+CI YL+K + G A FI L+ +  +    S++  +
Sbjct: 542  YSLAVSTCLGRNFDSVIVDNASVAQECIAYLKKQRAGSASFIPLETIDSEIPTLSVSNSQ 601

Query: 749  SVPRLFDLIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKK-RFRVVTLDGNLIDIS 807
                  + I   DP++  A   V  +T++ + L  A R+ + +  + ++VTL+G LI  +
Sbjct: 602  GCILAINAIE-YDPRYERAMQYVCSDTIICDTLVIAKRLKWVEGVKAKLVTLEGALIHKA 660

Query: 808  GTMSGGGSRVSRGLMQINRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEE- 866
            G M+GG S+ S      NR        +  EE   L +NL ++          I+Q+EE 
Sbjct: 661  GLMTGGVSKDSN-----NR--------WDKEEYQSL-MNLKDK---------LIHQIEEV 697

Query: 867  --QLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDN---NVELR 921
              Q +    K   +ENN+S L  EI   N  I++ +I  L  E        N   N E  
Sbjct: 698  SQQGRASSMKARDLENNLSVLNTEIS--NVRIQLTQITRLIDENKIELGYQNRLINEEYS 755

Query: 922  ETIQHVQSLKDEFK-SIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIV 980
              +  +   K+  + SI N    K+   + +  E  E  G  +K   S    +++     
Sbjct: 756  PKMSELNKKKNNLEISISNLQTDKEKLQDIIFAEFTERVGFTVKEYESHSGEIMR----- 810

Query: 981  VSKQKKERSVIKKTENEI-NKSHKMKLETSR-------------DLENFNQEIQTLKTTI 1026
              KQ K+   +++ +NEI N  +K++ E  R             DLE  N E++ L+T  
Sbjct: 811  --KQGKD---LQRLQNEILNVENKLQFEQERLFTTKKRSQKAKSDLEKANIELKDLETEE 865

Query: 1027 EGLQDSLNKVHESVTS-------VQHTKEGLIEESRTLEDKLNDINEDIAIFKSFEMEMK 1079
            + LQ+ +  +   V S       +Q+       +  T ++ LN++  ++ + K  + E  
Sbjct: 866  KSLQERIKIIEVEVGSQSEELDELQNIFNAKQRDLNTTDENLNELQMNMQLCKRQKNEFT 925

Query: 1080 NELEKLN 1086
             ++EKL+
Sbjct: 926  EDVEKLD 932

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
            YFL008W
          Length = 1226

 Score =  133 bits (335), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 100/153 (65%), Gaps = 10/153 (6%)

Query: 1262 FMQGFGIISMTLKEMYQMIT---------MGGNAELELVDTLDPFSEGVTFSVMPPKKSW 1312
            F + F  +S  +  +Y+ +T          GG+A L L D  +PF+ G+ +   PP K +
Sbjct: 1065 FDRAFDYVSTHIDGIYRELTKDPNSTAELAGGSASLTLEDEDEPFNAGIKYHATPPLKRF 1124

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNA 1371
            +++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD +NV  +A YI++    + 
Sbjct: 1125 KDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDIKNVERIAAYIRKHGNPSL 1184

Query: 1372 QFIVISLRNNMFELAQQLVGIYKRDNKTKSATI 1404
            QFIVISL+N+MFE +  LVG+Y+R  +  S  +
Sbjct: 1185 QFIVISLKNSMFEKSDALVGVYRRQQENSSRLV 1217

 Score =  119 bits (299), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 218/966 (22%), Positives = 413/966 (42%), Gaps = 116/966 (12%)

Query: 148  LILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 207
            L L +FKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R++ +R   ++DLI
Sbjct: 7    LELYNFKSYRGVVKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSYLRSSAVADLI 66

Query: 208  HKS----EEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVND 263
            ++     EE         + H  YV    S       ++  + + R   +N  S Y ++ 
Sbjct: 67   YRGVVPEEEDDGEGEGDGDAHRAYV----SAFYSKGPQESTVELKRTISKNGDSTYQIDR 122

Query: 264  QETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGTA 323
            ++  Y + ++ L+ + + +  K FL+ QG+VE +A                    + G+A
Sbjct: 123  RQVTYKQYSEFLESQNILIKAKNFLVFQGDVEQVASQSP-------LQLTKLFEEVSGSA 175

Query: 324  KYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENG---KEEALLFLENERKLTVS 380
            +YK   +     +E L+    E     + V  E  S   G    EE    LEN+++L   
Sbjct: 176  QYKKEYDLLKDQLEQLSHSATESIKDRRRVHSELKSYREGVSKDEEYKKNLENKKELEKI 235

Query: 381  KSKLYQYHILNSNMKLKNTLDKITNLNQKLEKE--------SDKNASVKKELDKLRAFGD 432
             +    YH+     KL   +    +   KL KE            AS   E   L    +
Sbjct: 236  FAMWKLYHLQMGKDKLLADMANTESTMSKLRKEIRTREATLQKSKASFASETAALLKLKN 295

Query: 433  ELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEA 492
            +L+ K+++     +++L   R +         +I+N EK+ D  +  L   +  ++  E 
Sbjct: 296  KLDYKVRD----REKVLSDIRLIKLPQRATANRIRNIEKRIDLLQNELRRQESYVARFET 351

Query: 493  RLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNA 552
            +L    + +V +E  LK         +   ++ ++ L D    +  E+  + K L   N 
Sbjct: 352  QLEVATKTKVSFEAELK---------RTAGDENRYRLTDADLALYQEL--MGKYLSEGNG 400

Query: 553  QLQEKKTQIQLAESQ---------ISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKEL 603
               E+K  + L + Q           +   A++++ +E+    ++IE +  ++     E 
Sbjct: 401  STIEEKLALLLNDKQEVDDELDRYYRMTDVAKSRINEELQVNLEKIEMQATELSSSLNEK 460

Query: 604  DSLHSQH----KSVKEEI-STGEKEC-LNARIR--LKEMQNILNTQRQKALDARSALSNA 655
            ++L++++    K+++ EI S G++E  LN ++R  L ++  +   QR+  +  R    N 
Sbjct: 461  NALNAENLKELKNLQSEIESRGKQEYDLNYKLRETLVKIDELSANQRE-TVRERKLREN- 518

Query: 656  ENKSKVLTALSRLQKSGRISGFHGRLGDLG-VIDEKYDVAISTACPR-LEDIVVETVECG 713
                  + +L RL       G  G + DL     +KY V+++T   +  + ++V+++   
Sbjct: 519  ------VVSLKRL-----FPGVKGIVSDLCHPKKDKYSVSVATVLGKNFDSVIVDSLSVA 567

Query: 714  QQCIEYLRKNKLGYARFILLDKLRK--FNLDSINTPESVPRLFDLIHPKDPKFSSAFFSV 771
            Q+CI YL+K + G   FI LD +      L S+N    +  L       + ++  A   V
Sbjct: 568  QECIAYLKKQRAGVISFIPLDTVDSAVATLPSVNIQGYL--LAKNAMEYESQYERAINYV 625

Query: 772  LGNTLVANDLKQANRVAYGKK-RFRVVTLDGNLIDISGTMSGGGSRVS---------RGL 821
             G+ ++ + L  A ++ +    + +++ LDG+LI  +G M+GG S+           + L
Sbjct: 626  CGDAIICDTLDLAKKLKWDHGFKNKLIALDGSLIHRAGLMTGGISKDGNNRWDKEEYQSL 685

Query: 822  MQINR---NKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAI 878
            M +      + ED   Y      Q      E E N  + +  I  +  QL  +     +I
Sbjct: 686  MTLKDKILQQIEDTAAYGRSASIQAR----ELESNISLLNAEIASIRTQLTQINR---SI 738

Query: 879  ENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQ 938
            E N  ++  +I   + E     I  L+ ++     Q N  EL E    VQ +   FK+  
Sbjct: 739  EENKVEINHQIHLVDKEYS-PMILSLKKKKESILKQSN--ELTEEKDRVQVVI--FKAFT 793

Query: 939  NQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEI 998
            ++        E+   E+M     EL+    ++ +V  ++     + +  R  + K E +I
Sbjct: 794  DKVGFSVRDYESHSGEVMRQNAKELQQLQKEILTVENKLQFERERLESTRGRLLKAEEDI 853

Query: 999  NKS--------------HKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQ 1044
             K+              H        D+ +F ++I+  +T IEG +  +N   ES+  VQ
Sbjct: 854  KKAQLELSLLEEQEKKYHTQIKPLEEDICSFEKQIEEKETEIEGKKLEINNKEESLNEVQ 913

Query: 1045 HTKEGL 1050
             + E +
Sbjct: 914  SSVEAV 919

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  132 bits (333), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 103/157 (65%), Gaps = 10/157 (6%)

Query: 1258 RFDEFMQGFGIISMTLKEMYQMIT---------MGGNAELELVDTLDPFSEGVTFSVMPP 1308
            R + F + +  +S  + ++Y+ +T          GG+A L L D  +P+  G+ +   PP
Sbjct: 1063 RREMFEKAYNHVSDHIDQIYRELTKDPHSTAALAGGSASLTLEDEDEPYLAGIKYHATPP 1122

Query: 1309 KKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER- 1367
             K ++++ +LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YIK   
Sbjct: 1123 MKRFKDMEHLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDNTNVEKIATYIKRHA 1182

Query: 1368 TKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATI 1404
            + N QFIVISL+N+MFE +Q LVG++++  +  S  I
Sbjct: 1183 SPNFQFIVISLKNSMFEKSQALVGVFRQQQENTSKVI 1219

 Score = 85.5 bits (210), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 83/160 (51%), Gaps = 13/160 (8%)

Query: 148 LILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 207
           L L +FKSY G   VG  + +F++++GPNGSGKSN++D++ FV G R++ +R   L DL+
Sbjct: 7   LELSNFKSYKGTVKVGFGDANFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSHLLMDLV 66

Query: 208 HKSEE---------YPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSK 258
           ++                 S        YV    +   +  EE P +   R   R+  S 
Sbjct: 67  YRGRRTGDEEESMEEEPSSSKISSTRSAYV---KAFYLKEGEESP-IEFMRTISRSGESA 122

Query: 259 YYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIA 298
           Y VN +   Y + T +L+KE + +  + FL+ QG+VE IA
Sbjct: 123 YKVNGKTVGYKDYTDILEKENILIKARNFLVFQGDVEQIA 162

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
            complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score =  131 bits (330), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 106/162 (65%), Gaps = 14/162 (8%)

Query: 1262 FMQGFGIISMTLKEMYQMIT---------MGGNAELELVDTLDPFSEGVTFSVMPPKKSW 1312
            F + F  ++  +  +Y+ +T          GGNA L L D  +P++ GV +   PP K +
Sbjct: 1060 FEKAFEYVNEHIDPIYRELTKNPNSSVELAGGNASLTLEDEDEPYNGGVKYHATPPLKRF 1119

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA- 1371
            +++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD  NV  +A YI +R  N  
Sbjct: 1120 KDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDITNVERIATYI-QRHGNPE 1178

Query: 1372 -QFIVISLRNNMFELAQQLVGIYK--RDNKTKSATIKNIDFV 1410
             QFIVISL+N+MFE ++ LVGIY+  ++N ++  T+   ++V
Sbjct: 1179 LQFIVISLKNSMFEKSEALVGIYRHQKENSSRIITLNLTNYV 1220

 Score =  119 bits (298), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 230/1002 (22%), Positives = 442/1002 (44%), Gaps = 141/1002 (14%)

Query: 148  LILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 207
            L L +FKSY G   VG   ++F++++GPNGSGKSN++D++ FV G +++ +R + L DLI
Sbjct: 7    LELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLRSNVLKDLI 66

Query: 208  HKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLV--VTRKAFRNNTSKYYVNDQE 265
                 Y    S   E +    ++  S   +   +K ++   + R    +  S Y +N++ 
Sbjct: 67   -----YRGFLSGDDEDNNNEDVNPNSAYVKAFYQKEDVTHELMRSISNSGDSTYKINNKT 121

Query: 266  TNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGTAKY 325
             +Y + T  L+ E + +  K FL+ QG+VE IA   +                + G+ +Y
Sbjct: 122  VSYKQYTSFLEDENILIKAKNFLVFQGDVEQIASQST-------TDLTKLFEEVSGSIQY 174

Query: 326  KPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENG-----KEEALLFLENERKLTVS 380
            K   E+    +E L+    E     + ++ E    ++G     K +A L  E  R L V 
Sbjct: 175  KKEYEELKEKVEKLSQSTAESIKNRRRINNEIKVYKDGITKDEKYKAQL--EKRRNLLVY 232

Query: 381  KSKLYQYHI----LNSNMKLKNTLDKITNLNQKLEKESD-----KNASVKKELDKLRAFG 431
             S    YH+      S  KLK    K++ L +KL  E       KN S+ K+   +  + 
Sbjct: 233  SSLWQLYHLDEKKSQSKNKLKEAKSKVSKLKEKLANEEKILQKAKN-SIVKDTAAITKYK 291

Query: 432  DELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSE 491
            ++LE + K       QL+  K  +  +N    +KI N E++ +  E+ +      +   E
Sbjct: 292  NKLEYRSKEKEKLASQLIPIK--VSQRNTT--KKISNIERRIEGIERDIERQKSYVERYE 347

Query: 492  ARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIA--QLEKELEP 549
            ++L  + + +  +E  +KE       +K +L        D  +   L      ++ ++  
Sbjct: 348  SQLKVVTKSKESFELEIKE--SAKNFDKYRLSDEDLVTYDALSEKYLSSGGFDIDTKISL 405

Query: 550  WNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKELDSLHSQ 609
             N   QE   ++ + +++I L   A++K+A ++    + +E    ++     E +SLHSQ
Sbjct: 406  LNNDKQETSDEVAMFKNRIEL---AKSKIADDLVLQGERLELEISELTSSLNEKNSLHSQ 462

Query: 610  H----KSVKEEI-STGEKEC-LNARIR--LKEMQNILNTQRQKALDARSALSNAENKSKV 661
                 K+++ EI ST  KE  LN ++R  L ++ ++  +QR+           + N+ K+
Sbjct: 463  KVSELKTLQGEIESTSNKEYDLNYKLRETLVKLDDLSASQRE-----------STNERKL 511

Query: 662  LTALSRLQKSGRISGFHGRLGDLGVI-DEKYDVAISTACPR-LEDIVVETVECGQQCIEY 719
               +S L++     G  G + DL     EKY +A+ST   +  + I+ + +   Q+CI Y
Sbjct: 512  RENVSMLRR--LFPGVRGLVSDLCQPKKEKYALAVSTILGKNFDSIITDNISVAQECIAY 569

Query: 720  LRKNKLGYARFILLDKLRKFNLDSINTPESVPRL-----------FDLIHPKDPKFSSAF 768
            L+K + G A FI L+ +             VP L            + I   +P++  A 
Sbjct: 570  LKKQRAGVASFIPLESIES----------EVPTLPFSDGQGCILTINAIE-YEPEYERAM 618

Query: 769  FSVLGNTLVANDLKQANRVAYGKK-RFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRN 827
              V  ++++ + L  A  + +    + ++VTL+G LI  +G M+GG  R +    + ++ 
Sbjct: 619  QYVCSDSIICDTLTIAKDLKWKHNVKSKLVTLEGALIHKAGLMTGGILRDATN--RWDKE 676

Query: 828  KTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTM 887
            + + + +   + ++Q+E  L    K+F +            +DL       E+ IS L  
Sbjct: 677  EFQSLTVLKDKLLSQIE-ELSTSSKSFAIKG----------RDL-------ESTISLLNT 718

Query: 888  EIESWNSEIKIKEIQMLESERAYSATQDNNVEL--------RETIQHVQSLKDEFKSIQN 939
            +I S  SE            +   A ++N VE+        +E    + +L D+ K    
Sbjct: 719  DITSLRSEFT----------QLNRALEENKVEIQYQTDMIDKEFGPKLDALNDKIKVYDE 768

Query: 940  QTKSKKHRIETLKNEIM---------------EIGGAELKIQSSKVDSVIQRIDIVVSKQ 984
            +    +++ E L+ EI                E  G   + Q+ ++  + ++I  + +K 
Sbjct: 769  EISQFENKKEDLQGEIFKEFTNRLGFTIKEYEEHSGEIRRKQAKELQQLQRQILNIENKL 828

Query: 985  KKERSVIKKTENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQ 1044
            + E+  +  TE    K      +T   L++   E   L+T IE + + L      +  +Q
Sbjct: 829  QFEQERLASTEKRFEKGQSELQKTKISLDSLETEESELQTQIEEIDNELETQRTEIDEMQ 888

Query: 1045 HTKEGLIEESRTLEDKLNDINEDIAIFKSFEMEMKNELEKLN 1086
               +  +++   +ED LN+++  + I K  ++   +++EK++
Sbjct: 889  KALDSKLKDISFIEDSLNEVSNSLEISKREKLGFNDDIEKVD 930

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1170

 Score =  130 bits (326), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 235/976 (24%), Positives = 435/976 (44%), Gaps = 146/976 (14%)

Query: 145  IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 203
            I++LI+  FKSYA R V+  ++  F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3    IEELIIDGFKSYAARTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 204  SDLIHKSEEYPSLPSCSVEVHFKYV--IDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYV 261
             DLI+K  +   +   SV V F      + P G T      P + VTR+     TSKY +
Sbjct: 63   QDLIYKRGQ-AGVTKASVTVVFDNSDRDNSPIGFTN----SPKISVTRQVVLGGTSKYLI 117

Query: 262  NDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIG 321
            N        V +L +   +++++  FLI+QG++  +  MK                   G
Sbjct: 118  NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTEILSLIEEAA-------G 170

Query: 322  TAKY---KPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLT 378
            T  +   +   E+ +A  E+       +ENR  + +  +  LE  + E  +FL+      
Sbjct: 171  TKMFEDRREKAERTMAKKETK-----LQENRALLAEEIEPKLEKLRSEKRIFLD----FQ 221

Query: 379  VSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKL 438
             +++ L +   + S     N   + ++  Q L+   DK   +K+E++K       +  ++
Sbjct: 222  TTQTDLERTSRVVSAFNYYNMKHRQSSFEQTLQDSEDKCNHLKEEIEK-------VSEEI 274

Query: 439  KNCNNEEKQL-LGKKRELDGKNVLNEEKIKNFEKKR-------DKAEKTLSSMDRSISSS 490
            K+ N + ++L L KK E+D     NE ++ NFEK+         + + TLS  + SI  +
Sbjct: 275  KSLNEDLEELKLQKKNEMD-----NEGRLVNFEKEESDLLKQISRIKTTLSIKNDSIDEA 329

Query: 491  EARLSELKQLQVDYENSLKELN----EQTEVEK---------MKLEKIKFSLKDKTNGIS 537
            E    EL++L  + E   KEL     + T  EK          +L++++    +  + +S
Sbjct: 330  E---KELQKLNSNNEELTKELEMKLAQYTSTEKEYEIANSELTRLKELQGKKSELLSTLS 386

Query: 538  LEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQIL 597
              I+      + ++AQL   K ++   E    LIK    KL  +    ++E+ + + ++ 
Sbjct: 387  TGISSNGATDDGYSAQLVATKKKLNDTE---VLIK----KLNMKRSMLQKELASNEPKLF 439

Query: 598  QGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEM---QNILNTQRQKALDARSALSN 654
            Q  +E    H +   + E+    EK C   R +L       ++L   R++  + +  L  
Sbjct: 440  QAKRE----HEKSSKIMEQ---NEKYCGELRSQLASFGYDPDLLKFLRKEESEVQQQLYR 492

Query: 655  AENKSKVLTA--------LSRLQKSGRISGFHGRLGDLGVID-EKYDVAIS---TACPRL 702
            A  +++ L           +R   +       G    L  +D +++D AI+    A  RL
Sbjct: 493  ANEEAEALKRRVANIEFNYTRPSANFDPKSVKGVAAQLFTVDQQQFDNAIALQVCAGGRL 552

Query: 703  EDIVVETVECGQQCIEYLRKNKLGYARFILLDKL--RKFNLDSIN-----TPESVPRLFD 755
             +I+V+      Q +E  R  K      I L K+  R  N +++       P  V    +
Sbjct: 553  YNIIVDNEITASQLLERGRLKK--RVTIIPLSKIATRTLNKNTLALAKELAPGKVELALN 610

Query: 756  LIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKK-RFRVVTLDGNLIDISGTMSGGG 814
            LI   D + S A   + GN LV  D   A +V +    R R +T  G++ D  GT+SGG 
Sbjct: 611  LI-GYDDEVSKAMEFIFGNGLVCKDADTAKKVTFHPNIRTRSITQQGDVYDPEGTLSGGS 669

Query: 815  SRVSRGLMQINRNKTEDIEIY--SSEEVAQLEVNLVEREKNFQVASDT-----IYQMEEQ 867
               +R L+        DI+ Y  +  +V +LE+ L+E +K  +   +T       Q E  
Sbjct: 670  RNTTRSLLV-------DIQKYNHAVAKVNELELKLIEMQKKLKEQEETSQKTKSLQNELN 722

Query: 868  LKDLK---EKEPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVELRETI 924
            L D K    +   +EN+ +Q+    +  + E++  E Q+L  ++  SA +   +E+  T 
Sbjct: 723  LADHKLNIAQRRLVENSAAQIIKRNKELHEELQGCEEQILVEKKNASALE---IEIETTK 779

Query: 925  QHVQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGGA--ELKIQSSKVDSVIQRIDI--- 979
            +      +EF      +K K  ++  LKNEI ++  A  +++ +S  +  + Q + +   
Sbjct: 780  KDA----EEF------SKDKNSKLSKLKNEIEKLNKAIEDVENKSESLYDLYQNLQLETE 829

Query: 980  -VVSKQKKERSVIKKTENEINKSHKMKLETSRDLENFNQEIQTLKTTIE-------GLQD 1031
             + ++ K  + ++++T+  + K  + K+     L+  N  +  ++T ++       G+ +
Sbjct: 830  QLANEIKSNKEMMEQTKANVGKLEEEKVSVDSHLQELNTSLIEVQTRVKEERARLLGIDE 889

Query: 1032 SLNKVHESVTSVQHTK 1047
             L ++   V S Q TK
Sbjct: 890  ELKELESLVKSKQDTK 905

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1312 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1370
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1371 AQFIVISLRNNMF 1383
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
           Anc_8.68 YFL008W
          Length = 1232

 Score =  129 bits (325), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 206/810 (25%), Positives = 360/810 (44%), Gaps = 130/810 (16%)

Query: 150 LQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHK 209
           L +FKSY G   +G  +++F++++GPNGSGKSN++D++ FV G R+N +R   + DLIH+
Sbjct: 9   LSNFKSYKGTVKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSNDLRSSGMKDLIHR 68

Query: 210 S---EEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQET 266
           S    +  +    S  V   Y + + S  T +          R    +  + Y +N + T
Sbjct: 69  SVRDSQSSNDDPTSAYVKAFYKVTDASEITEL---------MRIVNLSGETIYKINGKTT 119

Query: 267 NYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGTAKYK 326
           ++   +  L KE + +  K FL+ QG+VE IA   S                + G+ +YK
Sbjct: 120 SFKNYSDWLAKENILIKAKNFLVFQGDVETIASQSS-------LELTKLFEQVSGSIQYK 172

Query: 327 P---LIEKNLADMESLNDICIEKENRFQ---IVDREKNSLENGKEEALLFLENERKLTVS 380
               L++++L  +  L +  I+   R      + +E     N   E +  +   +K  V 
Sbjct: 173 KEYDLLKEDLNKINRLTNDAIKNRRRINGELKIYKEGIKKNNQYNEQINNIIQLKKFFVL 232

Query: 381 KSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKL-RAFGDE------ 433
              L  YH+ N     +  L KI       ++ +D N   +  L  L + F  E      
Sbjct: 233 ---LQLYHLSNEKSTFEKNLKKIL---VDFDELNDTNKEFQSNLSNLKKIFIKEDLLIIK 286

Query: 434 ----LESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISS 489
               ++ KLKN N    + L  K  +  KN+   +KIKN  K  +  +  ++    SI  
Sbjct: 287 QNSLIDQKLKNLNQLNNKFLPIK--ISSKNL--NKKIKNSNKILENLDLDITRQLDSIKL 342

Query: 490 SEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLE-KELE 548
            E  LS +K   + Y+N   E+N+  E      +   +  KD  +   LE + L  K L 
Sbjct: 343 LEKNLSTIK---LTYDNFKLEINQSNE------KNSTYQFKDSND--ELEYSNLNAKYLN 391

Query: 549 PWNAQLQEKKTQIQLAESQI--------SLIKEAEAKLAQE----IDQFKQEIETRKQQI 596
               +L+EK   +   +++I         LI  +  K+  E    ID    +IE     +
Sbjct: 392 NGGFELEEKLNLLINEKNEIIDQKLIVEKLINNSNEKILNEFNINIDSLNLKIEDLNSNL 451

Query: 597 LQGSKELDSLHSQHKSVKEEI-STGEKEC-LNARIR--LKEMQNILNTQRQKALDARSAL 652
            + +  + +     KS++  I S+  KE  LN ++R  L ++ NI  T+R+         
Sbjct: 452 TEKNSTVKAKIKSLKSLQSIIESSNNKEYDLNFKLRDTLLKLDNINATKRE--------- 502

Query: 653 SNAENKSK--VLTALSRLQKSGRISGFHGRLGDLG-VIDEKYDVAISTACPR-LEDIVVE 708
           SN E K +  VLT L R+       G  G + DL     +KY +AI T   +    ++V+
Sbjct: 503 SNKEKKLRENVLT-LKRI-----FPGVRGLVHDLCHPKKDKYALAILTILGKNFNSVIVD 556

Query: 709 TVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLI--HPK------ 760
           ++   Q+CI YL+K + G   FI LD +             +P L  +I  +PK      
Sbjct: 557 SLSVAQECISYLKKQRAGIISFIPLDTIEA----------QIPSLPTIIQNNPKYNNDSN 606

Query: 761 ----------DPKFSSAFFSVLGNTLVANDLKQANRVAYGK--KRFRVVTLDGNLIDISG 808
                     +P+F  A   +  N+++ ++L  A  + + +  K  + VTLDG++I  S 
Sbjct: 607 CILTINAIEYEPEFERAMQYICSNSIICDNLDIAKDLKWNQNVKNVKFVTLDGSIIHKSN 666

Query: 809 TMSGGGSRVSRGLMQINR--NKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEE 866
            M+GG S+ S   MQ N   +K E   + + ++   LE+  + +E   ++AS    ++E 
Sbjct: 667 LMTGGASKNS---MQSNNRWDKDEYSSLMTLKDNLILEIETISKEN--KLASINSRELET 721

Query: 867 QLKDLKEKEPAIENNISQLTMEIESWNSEI 896
           ++  L  +   ++  ++QLT  ++  N+E+
Sbjct: 722 EISLLNSEITNLKTQLTQLTRNLKDNNTEL 751

 Score =  127 bits (319), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 102/155 (65%), Gaps = 12/155 (7%)

Query: 1262 FMQGFGIISMTLKEMYQMITM---------GGNAELELVDTLDPFSEGVTFSVMPPKKSW 1312
            F   F  ++  ++ +Y+ +T          GG A L L D  +PF+ GV +   PP K +
Sbjct: 1071 FESCFDFVNEHIEPIYKELTKDPNSTTELGGGQATLTLEDEDEPFNGGVKYHATPPLKRF 1130

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNA 1371
            +++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI++   K+ 
Sbjct: 1131 KDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDHTNVERIAAYIRKHGNKDL 1190

Query: 1372 QFIVISLRNNMFELAQQLVGIYKR--DNKTKSATI 1404
            QFI+ISL+N MFE +  LVG++++  +N +K+ T+
Sbjct: 1191 QFIIISLKNTMFEKSDALVGVFRQQTENSSKALTL 1225

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  129 bits (323), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 190/722 (26%), Positives = 327/722 (45%), Gaps = 91/722 (12%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 203
           +++LI+  FKSYA R V+  ++  F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMTTVRASSL 62

Query: 204 SDLIHKSEEYPSLPSCSVEVHFKYV--IDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYV 261
            DLI+K  +   +   SV + F      + P G T      P + VTR+     TSKY +
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNTDKSNSPIGFTN----SPQISVTRQVVLGGTSKYLI 117

Query: 262 NDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIG 321
           N        V +L +   +++++  FLI+QG++  +  MK                   G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTEILSLIEEAA-------G 170

Query: 322 TAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLT--- 378
           T  ++   EK    M         +ENR  + +  +  LE  + E  +FLE +   T   
Sbjct: 171 TKMFEDRREKAERTMSKKETKL--QENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQTDLE 228

Query: 379 ----VSKSKLYQYHILNSNMKLKNTLD----KITNLNQKLEKESDKNASVKKELDKLRAF 430
               +  S  Y Y+I + +  ++ TL+     +  LN+ +EK + +  S+ +++ +++  
Sbjct: 229 KTERIVASCDY-YNIKHKHTSIRETLENGEAHMKELNEFIEKTAQEIESLNEDVKEIKLQ 287

Query: 431 GD-EL--ESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSI 487
              EL  +S++     +E  LL +   L     +  E +       D  EK L +++  I
Sbjct: 288 KQKELHKDSEISKLETQESTLLNEISRLKTSLSIKAESV------NDTTEK-LKALELEI 340

Query: 488 SSSEARLSELK----QLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQL 543
           ++S ARL+E K    + + DY+   +EL++Q E+ K K E++  +L   T GIS   A  
Sbjct: 341 ANSSARLNEKKIEYTKTEEDYKTVQEELSKQRELYKKK-EELVSTL---TTGISSTGAA- 395

Query: 544 EKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSK-- 601
                 +NAQL + K  +    S +SL   A  K   ++D  K+E+   + ++ Q +K  
Sbjct: 396 ---DGGYNAQLIKAKAGL----SDVSL---AIKKSTMKMDLLKRELSVIEPKLTQATKDN 445

Query: 602 ELDSLH---SQHKSVKEEISTGEKECLNARIR-LKEMQNILNTQ-RQKALDARSALSNAE 656
           EL+  H    Q    K +    E     +RI+ LK+ +N L +Q  Q + D+        
Sbjct: 446 ELNIKHVKECQDNCNKLQAQLTEYGFDPSRIKDLKQKENELKSQYYQISNDSEYLKRRVA 505

Query: 657 NKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAIST-ACPRLEDIVVETVECGQQ 715
           N     T      K+  + G  G+L +L     +Y  A+ T A  RL ++VV+  +   Q
Sbjct: 506 NLEFNYTTPYPDFKANLVYGVVGQLFELDDDKIRYSTALQTCAGGRLFNVVVQDSQTATQ 565

Query: 716 CIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDL---IHPK-----------D 761
            +E  R          L  ++    L+ I+T    P++ +L   I P            D
Sbjct: 566 LLERGR----------LRKRVTIIPLNKISTRPISPQVLELAKKIAPGKVELAINLIKFD 615

Query: 762 PKFSSAFFSVLGNTLVANDLKQANRVAYGKK-RFRVVTLDGNLIDISGTMSGGGSRVSRG 820
              + A   + GN+L+  D + A ++ +  K R R +TL G++ D  GT+SGG    S  
Sbjct: 616 KSVTKAMEFIFGNSLICEDPETAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSDS 675

Query: 821 LM 822
           L+
Sbjct: 676 LL 677

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1312 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1370
            W++ +  LSGG+++L +LAL+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALALIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1371 AQFIVISLRNNMF 1383
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score =  128 bits (322), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 200/845 (23%), Positives = 378/845 (44%), Gaps = 75/845 (8%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 203
           +++LI+  FKSYA R V+  ++  F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 204 SDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVND 263
            DLI+K  +   +   SV + F     +PS      E  P + VTR+     TSKY +N 
Sbjct: 63  QDLIYKRGQ-AGVIKASVTIVFDN--SDPSSSPFGFETYPKISVTRQIILGGTSKYLING 119

Query: 264 QETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGTA 323
                  V  L +   +++++  FLI+QG++  +  MK                      
Sbjct: 120 HRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPDEILALIEEAAGTRMFEDRRE 179

Query: 324 KYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKL--TVSK 381
           K +  + K    ++ +  + +E+      ++ + N L N K   L F + +  L  T   
Sbjct: 180 KAEKTMAKKETKLQEIRALLLEE------IEPKLNRLRNEKRAFLEFQQTQTDLEKTSRI 233

Query: 382 SKLYQYHIL---NSNM--KLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGD---E 433
              Y Y  L    S+M  +L++   +I +L   +EK  D+ +++ ++ + +R   +   +
Sbjct: 234 VNTYDYQTLVQKRSSMQERLQSDQKRIKDLEFSVEKYRDEISTLTEDFESIRRQKEKQLQ 293

Query: 434 LESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEAR 493
            ++ L+    +E  L  +   +     +  + + +        ++ LS+++ SI+ SE  
Sbjct: 294 KDTTLQTLEAKENSLSTELSRVTAALGITRDDLAD-------EQRNLSALNLSIAKSEQE 346

Query: 494 LSELKQLQVDYENSLKELNEQTEVEKMKL-----EKIKFSLKDKTNGISLEIAQLEKELE 548
           L+ L +   + EN    LN   E+EK+K      E++  +L    +           +L 
Sbjct: 347 LTSLSKTYSETENEYVVLN--AEIEKLKTICRNKEELLSTLTTGISSTGTTEGGYTAQLN 404

Query: 549 PWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKELDSLHS 608
               QL E +  ++  E +I+++++  A     +++ K+E E ++ ++ +    ++ L  
Sbjct: 405 NAKLQLNEAQIAVKKVEMRITMLRKELATNEPLLERAKKENEVKRAELSENKSHVERLQE 464

Query: 609 QHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQK-ALDARSALSNAENKSKVLTALSR 667
                    ++G K  L  +++ KE +  L T+    + DA        N     +  S+
Sbjct: 465 SL------TASGFKPELLKQLKQKEAE--LKTELYAISTDAEYLKRKVANLEFSYSPPSK 516

Query: 668 LQKSGRISGFHGRLGDLGVIDEKYDVAIS---TACPRLEDIVVETVECGQQCIEYLRKNK 724
                 + G   ++  L   +E +D A +    A  RL +++V+  +   Q +E  R  K
Sbjct: 517 EFNPKSVKGIAAQVFTLS--EENFDSANALQVCAGGRLFNVIVDNEKTASQLLERGRLRK 574

Query: 725 LGYARFILLDKL--RKFNLDSIN-----TPESVPRLFDLIHPKDPKFSSAFFSVLGNTLV 777
                 I L+K+  R  N D++N      P +V    +LI   + + + A   + G +L+
Sbjct: 575 --RVTIIPLNKISARVINTDALNKAKSLAPGAVELALNLIG-YEAEVARAMEFIFGGSLI 631

Query: 778 ANDLKQANRVAYGKK-RFRVVTLDGNLIDISGTMSGGG-SRVSRGLMQINR-NKTEDIEI 834
             D   A +V +  + R R +TLDG++ D  GT+SGG  S  S  L+ I + N+     +
Sbjct: 632 CRDAATAKKVTFHPQVRARSITLDGDIYDPEGTLSGGSRSHTSSLLIDIQKYNEAAKQMM 691

Query: 835 YSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNI-SQLTMEIESWN 893
              +E+ Q++ N+ E E     AS     ++ +L   K K    EN + S    +I   N
Sbjct: 692 VLEKELYQVQANISEHEN----ASRMTKSLQNELNLAKHKCQLAENALDSNPAAQIIKRN 747

Query: 894 SEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIETLKN 953
            EI  +EI+  E++R    T+ N +++   I  +Q   DEF +       K  +++ LK 
Sbjct: 748 GEIH-REIEASENDRDQQTTRVNALQME--ILRIQRDMDEFNT------DKGSKLDQLKA 798

Query: 954 EIMEI 958
           EI ++
Sbjct: 799 EIRDL 803

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1312 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1370
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1371 AQFIVISLRNNMF 1383
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1243

 Score =  128 bits (322), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 99/155 (63%), Gaps = 12/155 (7%)

Query: 1262 FMQGFGIISMTLKEMYQMIT---------MGGNAELELVDTLDPFSEGVTFSVMPPKKSW 1312
            F   F  +   + ++Y+ +T          GGNA L + +  +P+  G+ +   PP K +
Sbjct: 1081 FEACFKHVDKHIDQIYRALTKNPHDKSELAGGNASLTVENEDEPYLGGIKYFATPPLKRF 1140

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT-KNA 1371
            +++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  +A+YIK     NA
Sbjct: 1141 KDMEYLSGGEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNVERIAHYIKRNANPNA 1200

Query: 1372 QFIVISLRNNMFELAQQLVGIYK--RDNKTKSATI 1404
            QFIVISL+N MFE +Q LVGI++   DN ++  ++
Sbjct: 1201 QFIVISLKNAMFEKSQSLVGIFREQEDNSSRMVSL 1235

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 88/185 (47%), Gaps = 49/185 (26%)

Query: 148 LILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 207
           L L +FKSY     VG   + F++++GPNGSGKSN++D++ FV G R+N++R   L DLI
Sbjct: 7   LELHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLI 66

Query: 208 HK--------------------------------SEEYP--SLPSCSVEVHFKYVIDEPS 233
           ++                                SEE P  +  SC   V+ K  +DEP+
Sbjct: 67  YRGRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYVSC---VYQKDDLDEPT 123

Query: 234 GETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGE 293
                         TR    +  S Y +ND+  +Y +  + L+ E + +  K FL+ QG+
Sbjct: 124 K------------FTRTINTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGD 171

Query: 294 VENIA 298
           VE IA
Sbjct: 172 VERIA 176

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
           (SMC2) - SMC chromosomal ATPase family member [contig
           149] FULL
          Length = 1170

 Score =  127 bits (320), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 220/869 (25%), Positives = 380/869 (43%), Gaps = 123/869 (14%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 203
           +++LI+  FKSYA R V+  ++  F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 204 SDLIHKSEEYPSLPSCSVEVHFKYVI--DEPSGETRIDEEKPNLVVTRKAFRNNTSKYYV 261
            DLI+K  +   +   SV + F      + P G     E  P + VTR+     TSKY +
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFANSDKNNSPIG----FESYPKISVTRQIVLGGTSKYLI 117

Query: 262 NDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIG 321
           N        V  L +   +++++  FLI+QG++  +  MK                   G
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTEILSLIEEAA-------G 170

Query: 322 TAKYKPLIEKNLADMESLNDICIEKENRFQ--------IVDREKNSLENGKEEALLFLEN 373
           T  ++   EK    M        +KE + Q         V+ + N L N K   L F E 
Sbjct: 171 TKMFEDRREKAERTMN-------KKETKLQEIRSLLQEEVEPKLNKLRNEKRAFLDFQET 223

Query: 374 ERKLTVSKSKLYQYHILNSNMK--------LKNTLDKITNLNQKLEKESDKNASVKKELD 425
           +  L  + SK+    + +S ++         +N+  +I+ L   +++   +  +++++LD
Sbjct: 224 QSDLE-NTSKIVNAFVFSSLVQKRKNIENAFQNSESRISELTASVQQTKVELTNLEEDLD 282

Query: 426 KLRA------FGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKT 479
            +R         D   SKL+     E QL+ +   L     L  E I     KR+     
Sbjct: 283 TIRTQKRNEMRKDGALSKLEAL---ETQLINEVSRLKTSLSLTIENINQENGKRE----- 334

Query: 480 LSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLE 539
             S++RSI   +  L E   +  + EN   EL++  +    +L+  +  L   T GIS  
Sbjct: 335 --SLERSIRGIQTSLQEKSAISKNAENEYNELHDLVQNLSQQLQTKEELLSTLTTGISST 392

Query: 540 IAQ---LEKELEPWNAQLQEKKTQIQLAESQISLI-KEAEAKLAQEIDQFKQEIETRKQQ 595
            A       +L    A+L + + Q+Q  E +I+++ KE  A   + +D      E +KQ 
Sbjct: 393 GATNSGYSAQLSNTKARLNDARIQVQRFEMKINILKKELAANEPKIVDAKSLSEEAKKQV 452

Query: 596 ILQGSKELD-SLHSQ--------HKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKAL 646
            + G +  D  +H +         KS+KEE S+ + +  N       + N +   R+K  
Sbjct: 453 EVTGIQCSDLKMHLEKLGFNPDLFKSLKEEESSLKSKIYN-------LSNDMEGLRRKVA 505

Query: 647 DARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAIS---TACPRLE 703
           +   A S   +K    +          + G   +L  L   +E +  A +    A  RL 
Sbjct: 506 NIDFAYSKPSDKFDPTS----------VKGVAAQLFSLN--EENFSSATALQICAGGRLF 553

Query: 704 DIVVETVECGQQCIEYLRKNKLGYARFILLDKL--RKFNLDSIN-----TPESVPRLFDL 756
           ++VV       Q +E  R  K      I L+K+  R+ + D++N      P+SV    +L
Sbjct: 554 NVVVNNESTASQLLERGRLRK--RVTIIPLNKISARRLHQDTVNFAKQLAPDSVELALNL 611

Query: 757 IHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKK-RFRVVTLDGNLIDISGTMSGGGS 815
           I  +D + + A   + G +L+  D + A +V +  K R R +TL G++ D  GT+S GGS
Sbjct: 612 IGYED-EVAKAMEFIFGTSLICRDAETAKKVTFHPKVRARSITLQGDIYDPEGTLS-GGS 669

Query: 816 RVSRGLMQINRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKE 875
           R +   + I+  K        SE  A+L  ++ +R K +         ++ +L     K 
Sbjct: 670 RNNNSSILIDIQKYNAYSRNLSESEAKL-ADVTKRIKQYSEVLQKTKNLQNELNLATHKF 728

Query: 876 PAIENNIS-QLTMEIESWNSEIKIKEIQM-LESERAYSATQDNNVELRETIQHVQSLKDE 933
              E N++   ++++ S N EI+  EIQM LES R+ S             + ++ L+ E
Sbjct: 729 HLAERNLANNPSVQLMSRNKEIQ-DEIQMCLESMRSGS-------------EDIKKLEAE 774

Query: 934 FKSIQNQ----TKSKKHRIETLKNEIMEI 958
             S++      +K K  +++ LK EI  I
Sbjct: 775 VASVEKDMLEFSKDKGSKLDELKREISHI 803

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1312 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1370
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1371 AQFIVISLRNNMF 1383
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score =  127 bits (318), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 253/1042 (24%), Positives = 433/1042 (41%), Gaps = 221/1042 (21%)

Query: 148  LILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 207
            L +++FKSY G   VG    +F ++VGPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7    LEVKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRSSALVDLI 66

Query: 208  HKS--EEYPSL----PSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYV 261
            ++   EE  S     P  +    F YV  + SG  R       +  TR       S Y +
Sbjct: 67   YRGRMEEGGSAHENNPKSAYVTAF-YVKQDASGAER------RMEFTRVIHNTGDSTYKL 119

Query: 262  NDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIG 321
            + +   Y E   +L+ E + +  + FL+ QG+VE IA                    + G
Sbjct: 120  DGKTVGYKEYVDVLEGERILVKARNFLVFQGDVEQIASQSG-------VDLTKLFEQVSG 172

Query: 322  TAKYKPLIEKNLADMESLN---DICIEKENRFQIVDREKNSLENG--KEEALLFLENERK 376
            + +Y+   E+   D E  +   +  ++   + QI   +  S + G  KEE  + L  ER 
Sbjct: 173  SVQYQREYERLKDDYEKASAEYNESLKARRKMQI---DLKSFKEGVQKEEQYISLLAERV 229

Query: 377  LTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELES 436
                +  L+Q   L S                   K S   AS+K    KL        S
Sbjct: 230  KLQQQFMLWQLFHLQS-------------------KRSGLVASLKDSKAKL--------S 262

Query: 437  KLKNCNNEEKQLLGKKRELDGKN--VLNEEKIKNFEKKRDKA------------------ 476
            +LK   + E+ +LGK + L  K   +L   +    +K++DKA                  
Sbjct: 263  QLKRQLSNEEAILGKSKSLVAKEELLLARRRETLLQKQQDKARLNAQLLPVGSARQGTTR 322

Query: 477  -----EKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKI---KFS 528
                 EK + S+ R I   E+ + +LK       N LK + +     + +LEK    KF+
Sbjct: 323  RMVNIEKRIDSLQRDIERQESYVKQLK-------NQLKVVGKTKASFEAELEKSASGKFT 375

Query: 529  LKDKTNGISLEIAQLE-----KELEPWNAQLQEKK----TQIQLAESQISLIK-EAEAKL 578
            L ++      E+ ++       E E   A LQ KK     +I + E +I + K  AE  L
Sbjct: 376  LSEEQKKEYEELKEVYLSSGGSEFEEKLAILQNKKEELSEEIAVFEKRIGISKTRAEHDL 435

Query: 579  AQEIDQFKQEIETRKQQILQGSKELDSLHS----QHKSVKEEISTGEKECLNARIRLKEM 634
              +I++ + E+  R   +     + +++HS    + K ++ EI +   +      +L+E+
Sbjct: 436  KVDIERLEVEVSERTGNL----NDKNAIHSEKVREWKQIQSEIESANNKEYELSYKLREV 491

Query: 635  QNILNTQRQKALDARSALSNAENKSKV-LTALSRLQKSGRISGFHGRLGDLGVI-DEKYD 692
               L+      L A    +N E K +  +  L RL       G  G + DL     EKY 
Sbjct: 492  LAKLDD-----LSANQRETNKERKLRENVATLRRL-----FPGVRGLVHDLCRPKKEKYA 541

Query: 693  VAISTACPR-LEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVP 751
            V +ST   +  + ++V+++   QQCI YL+K++ G A FI         LD+I+T  S P
Sbjct: 542  VGVSTILGKNFDSVIVDSLSVAQQCISYLKKHRSGVASFI--------PLDTIDT--SSP 591

Query: 752  RL-----------FDLIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKK-RFRVVTL 799
             L            D I   +     A   V  ++++ + L  A  + + +  + ++VTL
Sbjct: 592  TLPAGDNTGCILTLDAIE-YESSLEKAMQYVCSDSIICDSLDIARNLKWNRNVKSKLVTL 650

Query: 800  DGNLIDISGTMSGGGSRVSRGLMQINRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASD 859
            +G LI  +G M+GG          I +N T     +  EE   L   L+ ++K     S 
Sbjct: 651  EGALIHRAGLMTGG----------ITKNNTNR---WDKEEYQSL---LLLKDK----IST 690

Query: 860  TIYQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLES-----------ER 908
             + ++   ++    K    EN +S L+ EI S  S++      M E+           E+
Sbjct: 691  ELSELTTGIRTGSIKSRDYENEVSLLSTEISSLRSQLNQLNRSMKEALTELNYHDDLIEK 750

Query: 909  AYSATQDNNVELRETIQ-------------HVQSLKDEFKSI---------QNQTKSKKH 946
             YS   D+  ++ E +                   KD  K I             + +KH
Sbjct: 751  EYSPKVDSLHKMVEEVDGQMADIAKDKANLQASVYKDFSKKIGFDIGEYEQHTGGRLRKH 810

Query: 947  --RIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKM 1004
               ++ L+ E+M I   +L+ ++ +++S I+R       Q+K R  +KK + E++     
Sbjct: 811  SRELQQLQKEVMNIEN-KLEFETERLESTIKR-------QQKAREDLKKVQGELDSLTSQ 862

Query: 1005 KLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDI 1064
            + +   +LE    +I      +E  Q+ L K   ++              + +ED +ND+
Sbjct: 863  ETDIQSNLEQVTNQIAEETKVLEEAQEKLKKKGNNI--------------KIIEDTINDL 908

Query: 1065 NEDIAIFKSFEMEMKNELEKLN 1086
            ++ I   K    E K ++EK+ 
Sbjct: 909  HDSIQTCKREITEWKEDIEKVG 930

 Score =  122 bits (306), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 97/157 (61%), Gaps = 10/157 (6%)

Query: 1258 RFDEFMQGFGIISMTLKEMYQMIT---------MGGNAELELVDTLDPFSEGVTFSVMPP 1308
            R + F+  F  +   +  +Y+ +T          GG+A L L D  +P+  G+ +   PP
Sbjct: 1055 RINTFLACFNHVRDNIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLGGIRYHATPP 1114

Query: 1309 KKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER- 1367
             K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YI+   
Sbjct: 1115 MKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYIRRHA 1174

Query: 1368 TKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATI 1404
            +   QFIVISL++N+F  ++ + G+++  ++  S  I
Sbjct: 1175 SPKMQFIVISLKSNLFSKSESMAGVFRNQHENSSMVI 1211

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score =  126 bits (317), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 98/155 (63%), Gaps = 12/155 (7%)

Query: 1262 FMQGFGIISMTLKEMYQMIT---------MGGNAELELVDTLDPFSEGVTFSVMPPKKSW 1312
            F + F  ++  +  +Y+ +T          GG+A L L D  +PF+ G+ +   PP K +
Sbjct: 1061 FEEAFEYVTEHIDPIYRELTKNPNSTSELAGGSASLTLEDEDEPFNAGIRYHATPPLKRF 1120

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNA 1371
            +++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  VA YI+     + 
Sbjct: 1121 KDMEYLSGGEKTVAALALLFTVNSYQPSPFFVLDEVDAALDTTNVERVATYIRRHGNPDL 1180

Query: 1372 QFIVISLRNNMFELAQQLVGIYKRD--NKTKSATI 1404
            QFIVISL+N MFE +  LVG+Y++   N +K  T+
Sbjct: 1181 QFIVISLKNTMFEKSDALVGVYRQQELNTSKIVTL 1215

 Score =  124 bits (310), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 185/723 (25%), Positives = 326/723 (45%), Gaps = 111/723 (15%)

Query: 148 LILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 207
           L L +FKSY G   VG  +++F++++GPNGSGKSN++D++ FV G R+  +R + L DLI
Sbjct: 7   LELHNFKSYKGTVKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSRHLRSNVLKDLI 66

Query: 208 HK---SEEYPSLPSCSVEVHFKYVIDEPS----------GETRIDEEKPNLVVTRKAFRN 254
           ++   SEE     S         V++ P+          G++ I+       ++R   + 
Sbjct: 67  YRGVASEEEGDGESD--------VVNNPTTAYVKAFYSKGDSTIE-------LSRSISKG 111

Query: 255 NTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXX 314
             + Y +N +  +Y      L+ E + +  K FL+ QG+V  IA   +            
Sbjct: 112 GDTTYRMNGKVVDYKRYASFLEDENILIRAKNFLVFQGDVVQIASQSA-------MELTQ 164

Query: 315 XXXXIIGTAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENG--KEEALLFLE 372
                 G+ +YK   +     +++L     E     + +  E  + + G  K E      
Sbjct: 165 FFEEFSGSIQYKKEYDMLKEKLQTLGQSTAESIKNRRRIHAEMRTYKEGINKNEEFEKQV 224

Query: 373 NERKLTVSKSKLYQ-YHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRA-F 430
           + R    +   L+Q YH+     +    L+     N +L K  DK A+ +K+L KLRA F
Sbjct: 225 SHRLELQNHYALWQLYHLEEEKAENNEKLEN-CKANVRLLK--DKIANEEKKLAKLRASF 281

Query: 431 GDE----------LESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTL 480
            +E          L  K+K     E QLL  K           ++I NFEK+ D  ++ +
Sbjct: 282 IEESASITKQKSSLTYKIKEKEEIESQLLPIKLSQRAAT----KRIGNFEKRIDALKRDV 337

Query: 481 SSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEI 540
                 +   E +L  + + +  +E+         E++K   +  K+ L D+   + L  
Sbjct: 338 ERQKSYVERFENQLKVVTKARETFED---------EIKKSAQDSNKYHLTDE--DLKLYA 386

Query: 541 AQLEKELEPWNAQLQEKKTQIQLAESQ---------ISLIKE----AEAKLAQEIDQFKQ 587
           A  EK L      ++ K     +A SQ         I L+K+    + ++++ E+   KQ
Sbjct: 387 ALNEKYLNSGGFAIEGK-----IANSQNDSKDVADDIGLVKKRKEISSSRISDELLVTKQ 441

Query: 588 EIETRKQQILQGSKELDSLHSQH----KSVKEEI-STGEKEC-LNARIR--LKEMQNILN 639
            +E +   +     E +  HS+     K ++ EI S+  KE  LN ++R  L ++ ++  
Sbjct: 442 SLELQMSDLSSSLNEKNQAHSEQASELKKLQSEIESSNNKEYDLNYKLREALIKIDDLSA 501

Query: 640 TQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVI-DEKYDVAISTA 698
           +QR+         +N E K +    +S L+K     G  G + DL     E+Y +A+ST 
Sbjct: 502 SQRE---------TNKERKLR--ENVSTLKKF--FPGIRGLVSDLCQPKKERYALAVSTI 548

Query: 699 CPR-LEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDL- 756
             R  + I+V+ +   Q+CI YL+K + G A FI LD + +    ++   ES   +  + 
Sbjct: 549 LGRNFDSIIVDNLAVAQECIAYLKKQRAGIASFIPLDTI-EVETSTLPASESSGCILAIN 607

Query: 757 IHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKK-RFRVVTLDGNLIDISGTMSGGGS 815
               DP++  A   V  ++++ N L+ A  + + +  R ++VTL+G LI  +G M+GG S
Sbjct: 608 AIEYDPEYERAMRYVCSDSIICNTLEIARDMKWKRNVRSKLVTLEGTLIHRAGLMTGGIS 667

Query: 816 RVS 818
           + S
Sbjct: 668 KDS 670

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1217

 Score =  125 bits (314), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 245/1028 (23%), Positives = 449/1028 (43%), Gaps = 197/1028 (19%)

Query: 148  LILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 207
            L L +FKSY G   VG  +++F +++GPNGSGKSN++D++ FV G +++ +R   L DLI
Sbjct: 7    LELYNFKSYRGTVRVGFGDSNFISIIGPNGSGKSNMMDAISFVLGVKSSHLRSQILKDLI 66

Query: 208  HKS----EEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVND 263
            ++     E+       +  V   Y+  + + E           ++R   RN  ++Y +N 
Sbjct: 67   YRGVEGEEDEEDGEGRTAYVKAFYLKSDSTVE-----------LSRSISRNGDTQYKMNG 115

Query: 264  QETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGTA 323
            +   Y +  + L++E + +  + FL+ QG+V  IA   +                I G+ 
Sbjct: 116  KNCGYKQYAEFLEEENILIKAQNFLVFQGDVVQIASQSA-------TDLTKLFEEISGSI 168

Query: 324  KYKPLIEKNLADMESLNDICIEK-ENRFQIVDREKNSLENGKEEALLFLENERKLTVSKS 382
            +YK   +     ++SLN    E  +NR +I    K+  E   +    + + E++  + + 
Sbjct: 169  QYKKEYDSLKGKVDSLNQSAAESIKNRRRIHGELKSYREGIDKNQEFYHQVEKRKELQRH 228

Query: 383  -KLYQ-YHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRA-FGDELESKLK 439
              L+Q YH+     +L+   DK+ NL   ++    K  S ++ L + RA F  E  S LK
Sbjct: 229  YALWQLYHLETQRHELE---DKLANLKNSIKTIRGKETSQEQILQRSRASFARESASILK 285

Query: 440  NCNNEEKQLLGKKRELDGKNVLNEEKI------KNFEKKRDKAEKTLSSMDRSISSS--- 490
                +  ++  K RE   K  +N++ +      ++  K+    +K +SS+ R I      
Sbjct: 286  ----QRSKMESKSRE---KEKINQQLLPIKLSQRSAAKRIANVQKRISSLQRDIDRQREY 338

Query: 491  ----EARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKF--SLKDK---TNGISLEI- 540
                E +L+ + + + D+E  +KE ++  +  K+  +  K   SL +K     G SLE  
Sbjct: 339  VERFENQLNVVTKAKSDFEKEIKESSKDHDKYKLNEDDTKLYASLNEKYLNQGGFSLESQ 398

Query: 541  --------AQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETR 592
                     +L  E+E    +    ++++     ++S+I E   KL  ++ +    +  R
Sbjct: 399  KQLTLNDKQELMDEMETLKKRNDISRSRVT---DELSVIAE---KLESQLSEISSTLNER 452

Query: 593  KQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIR--LKEMQNILNTQRQKALDARS 650
                    KEL  LHSQ +S     S+ ++  LN ++R  L +++ +  +QR+  +  R 
Sbjct: 453  NSTHSDKVKELQKLHSQIES-----SSNKEYDLNYKLREVLVKIEELSASQRE-TVKERK 506

Query: 651  ALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVI-DEKYDVAISTACPR-LEDIVVE 708
               N       +  L R        G  G + DL     +KY +AIST   +  + ++V+
Sbjct: 507  LREN-------IATLKRF-----FPGVRGLVCDLCQPKKDKYALAISTILGKNFDSVIVD 554

Query: 709  TVECGQQCIEYLRKNKLGYARFILLDKLR-KFNLDSINTPESVPRLFDLIHPKDPKFSSA 767
             V   Q+CI YL+K + G A FI LD +  +    +++  +      + I   + ++  A
Sbjct: 555  NVMVAQECIAYLKKQRAGIASFIPLDTIDVEIPTLTLSDSQGCTLAINAI-DYEQEYERA 613

Query: 768  FFSVLGNTLVANDLKQANRVAYGKK-RFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINR 826
               V  ++++ +D+  A  + + K  R ++VTL+G LI  +G M+GG S+        N 
Sbjct: 614  LQYVCSDSIICDDMNIAKDLKWNKGVRSKLVTLEGALIHKAGLMTGGISK--------NT 665

Query: 827  NKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIEN-NISQL 885
            +   D E Y S                     D + Q  E        E A+E  N S +
Sbjct: 666  SNRWDKEEYQS----------------LMTLKDKLLQQVE--------EAALEGKNASLM 701

Query: 886  TMEIES----WNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKS----- 936
              E+ES     N+EI     Q+  ++R     ++N VE R+   H + +K+E++      
Sbjct: 702  ARELESTLSLLNTEISELRTQLTLTQRTL---KENTVE-RDY--HEKLIKEEYEPELLNL 755

Query: 937  ---IQN------QTKSKKHRIETLKNEIME-----IG----------GAELKIQSSKVDS 972
               IQN      +  S+K   E L+NEI E     +G          G  ++ QS ++  
Sbjct: 756  EERIQNFNFALQELDSQK---EKLQNEIFEEFTNRVGFTVKDYESHSGEIMRQQSKELQQ 812

Query: 973  VIQRIDIVVSKQKKERSVIKKTENEINKSH--------------KMKLETSRDLENFNQE 1018
            + ++I  V +K + E+  +  TE    K+H              + + ET   +   +QE
Sbjct: 813  LQRQILNVENKLQFEKDRLSTTERRFGKAHEDMAKIEFELTQLERQEKETESRINQIDQE 872

Query: 1019 IQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDINEDIAIFKSFEMEM 1078
            +   K  +E  Q  L+  H  + S               ED L+++  ++   K  + E+
Sbjct: 873  LADQKKELEQFQKKLDAKHGDIDST--------------EDALHEVTANLQALKRHKDEL 918

Query: 1079 KNELEKLN 1086
            K ++EK++
Sbjct: 919  KEDVEKVD 926

 Score =  125 bits (314), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 102/162 (62%), Gaps = 12/162 (7%)

Query: 1262 FMQGFGIISMTLKEMYQMIT---------MGGNAELELVDTLDPFSEGVTFSVMPPKKSW 1312
            F + F   S  +  +Y+ +T          GG+A L L D  +PF+ G+ +   PP K +
Sbjct: 1056 FERAFEYASEHIDPIYRELTKNPGSTNELAGGSASLTLEDEDEPFNAGIRYHATPPFKRF 1115

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNA 1371
            +++  LSGGEKT+++LAL+F ++ ++P+P +V+DE+DAALD  NV  +A YI +   ++ 
Sbjct: 1116 KDMEYLSGGEKTVAALALLFTINSFQPSPFFVLDEVDAALDSTNVDRIAAYISRHGNRDL 1175

Query: 1372 QFIVISLRNNMFELAQQLVGIYK--RDNKTKSATIKNIDFVS 1411
            QFIVISL+N MFE +  LVG+Y+  ++N +K  T+   ++ S
Sbjct: 1176 QFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTLNLKNYAS 1217

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  125 bits (313), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 213/840 (25%), Positives = 382/840 (45%), Gaps = 137/840 (16%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 203
           +++LI+  FKSYA R V+  ++  F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 204 SDLIHKSEEYPSLPSCSVEVHFKYV--IDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYV 261
            DLI+K  +   +   SV + F      + P G        P + VTR+     TSKY +
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNTDKSNSPIGFAN----SPQISVTRQVVLGGTSKYLI 117

Query: 262 NDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIG 321
           N        V +L +   +++++  FLI+QG++  +  MK                   G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSEILSLIEEAA-------G 170

Query: 322 TAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENE------- 374
           T  ++   EK    M         +ENR  + +  +  LE  + E  +FLE +       
Sbjct: 171 TKMFEDRKEKAERTMSKKETKL--QENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQTDLE 228

Query: 375 --RKLTVSKSKLYQYHIL-NSNMKLKNTLD----KITNLNQKLEKESDKNASVKKELDKL 427
              ++ VS    Y Y+ L + +  ++ TL+     + NLN+ +EK   +  S+ ++++++
Sbjct: 229 KTERIVVS----YDYYNLKHKHTSIRETLENGEAHMKNLNEFIEKTIQEINSLNEDVEEI 284

Query: 428 RAFGDELESKLKNCNNEEKQLLGKKRELDGK--NVLNE-EKIKN-----FEKKRDKAEKT 479
           +        K K  N E     GK  +L+ K  ++LNE  ++K       E   D  EK 
Sbjct: 285 K------HQKEKELNKE-----GKISKLEKKENSLLNEISRLKTSLSIKVENLNDTNEK- 332

Query: 480 LSSMDRSISSSEARLSELK----QLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNG 535
           L S++  I++S  +L++ K    + + DY+   ++L+E+ ++ K K E++  +L   T G
Sbjct: 333 LKSVEADITTSSTKLNDKKIAYTKTEKDYKIVQQQLSEKRDLYKRK-EELVSTL---TTG 388

Query: 536 ISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISL-IKEAEAKLAQEIDQFKQEIETRKQ 594
           IS   A        +NAQL + KT++    + ISL IK++  ++    D  K+E+ T + 
Sbjct: 389 ISSTGAA----DGGYNAQLGKAKTEL----NDISLAIKKSNMRM----DLLKKELLTIEP 436

Query: 595 QILQGSKELDSLHSQHKSVKEEISTGEKECL------NARIR-LKEMQNILNTQRQKALD 647
           ++ + +K+ + L  +H    +EI    +  L       +RI+ L++ +N + +Q  +  +
Sbjct: 437 KLKEATKD-NELSIKHVKECQEICNKLQAQLVEFGFDPSRIKDLEQKENKMKSQYYQICN 495

Query: 648 ARSAL----SNAE-NKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAIST-ACPR 701
               L    +N E N +K         ++  + G  GRL  L   + +Y  A+ T A  R
Sbjct: 496 EAEHLKRRVANLEFNYTKPYPDF----ETSSVYGVVGRLFQLDNDNIRYSSALQTCAGGR 551

Query: 702 LEDIVVETVECGQQCIEYLRKNKLGYARFILLDKL-------RKFNLDSINTPESVPRLF 754
           L ++VV   +   Q +E  R  K      I LDK+       +   L     P  V    
Sbjct: 552 LFNVVVRDSQTATQLLEGGRLRK--RVTIIPLDKIYTRPITPQVLELAKSIAPGKVELAI 609

Query: 755 DLIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKK-RFRVVTLDGNLIDISGTMSGG 813
           +LI    P  + A   + GN+L+ +D + A ++ +  K R R +TL G++ D  GT+SGG
Sbjct: 610 NLIRFDKP-VTKAMEFIFGNSLICDDPETAKKITFHPKIRARSITLQGDVYDPEGTLSGG 668

Query: 814 GSRVSRGLM------------------QINRNKTEDIEIYSSEE----------VAQLEV 845
               S+ L+                   +N+   E  + Y++ +          ++Q ++
Sbjct: 669 SRNTSQSLLVDIQKYNQIQEKIGTIQADLNQVAEELRKQYATSQKTKTIQNDLNLSQHKL 728

Query: 846 NLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLE 905
           +L +R      +S  + + EE L+D+ +     EN I    M ++ W  EI   E  M E
Sbjct: 729 DLAKRNLEVNPSSQIMVRNEEILRDIGD----CENEIKNKQMILQRWQEEISTIEKDMKE 784

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1312 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1370
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1371 AQFIVISLRNNMFELAQQL 1389
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
            chromosome segregation protein
          Length = 1223

 Score =  124 bits (312), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 102/169 (60%), Gaps = 23/169 (13%)

Query: 1259 FDEFMQ-----------GFGIISMTLKEMYQMITM---------GGNAELELVDTLDPFS 1298
            FDEF++            F  I+  L  +Y  +T          GG+A + + D  +PF+
Sbjct: 1048 FDEFLKVKQKRKELFENAFEKINEHLDAIYSELTRNVNSTSILGGGSASMTIEDEDEPFN 1107

Query: 1299 EGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1358
             G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y P+P +++DE+DAALD  NV 
Sbjct: 1108 AGIRYHATPPMKRFKDMEYLSGGEKTVAALALLFAINSYNPSPFFILDEVDAALDISNVQ 1167

Query: 1359 IVANYIKER-TKNAQFIVISLRNNMFELAQQLVGIYK--RDNKTKSATI 1404
             +A YI+     + QFIVISL+N MFE +  LVG+++  ++N +K  T+
Sbjct: 1168 RIAAYIRRHGNPDLQFIVISLKNTMFEKSDALVGVFRQQQENSSKIVTL 1216

 Score =  110 bits (274), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 241/1006 (23%), Positives = 412/1006 (40%), Gaps = 201/1006 (19%)

Query: 148  LILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 207
            L L +FKSY G   V   +++F++++GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7    LELYNFKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLRSSALKDLI 66

Query: 208  HKSEEYPSLPSCSVEVHFKYVIDEPSGETRID-EEKPNLVVTRKAF-------------- 252
            ++                  +I   +  T  D +E  N     KAF              
Sbjct: 67   YRD-----------------IISRENTPTGADNDENGNRTAYVKAFYEYDGKVVELMRLI 109

Query: 253  -RNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXX 311
             R   + Y ++     Y E ++ L+ + + +  K FL+ QG+VE IA             
Sbjct: 110  SRLGDTSYKLDGNTVTYKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSPLG------- 162

Query: 312  XXXXXXXIIGTAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFL 371
                   + G+ +YK   E+ L D    + IC       +   R    L+  KE   +  
Sbjct: 163  LTKLIEEVSGSMQYKKEYEE-LKD--QYDKICQASTESIKKRRRIHAELKTYKEG--MSR 217

Query: 372  ENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFG 431
            + E +  V K K  Q ++  S  +L +  D+     QKLE ES  +  V +E  KL A  
Sbjct: 218  DEEYRKYVQKKKRVQTNL--SLWQLYHMEDERYQCLQKLE-ESQNDVDVIRE--KLEAEE 272

Query: 432  DELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSE 491
              LE   K   ++E  LL KK+            I++  K+++KAE  L  +    ++S 
Sbjct: 273  KNLEV-FKKALSKEAVLLTKKK----------NHIRSISKEKEKAESDLKVVKIPQNASI 321

Query: 492  ARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLK---DKTNGISLEIAQLEKELE 548
             RL  L + +VD       L +  E E+  LEK K  LK   D  N    EI    K   
Sbjct: 322  NRLKNLDK-RVD------SLQKDLEREEANLEKYKHQLKVVTDSKNAFEQEILSKSK--- 371

Query: 549  PWNAQLQEKKTQIQLAESQISLIKEAEAKLAQ----EIDQFKQEIETRKQQILQGSKEL- 603
                       +  L+E  + L  E + +       EI+     ++ +K++I    K + 
Sbjct: 372  --------NNNKFTLSEDDLKLYDELKGEYLNNGGIEIEDTLNLLDNKKEEITADLKIIN 423

Query: 604  DSLHSQHKSVKEEISTGEKECLNARIR-------------------LKEMQNILNTQRQK 644
            D +    + +++E+ T +KE  +A+IR                   L++ Q  +     K
Sbjct: 424  DKVEISKQRIEDELVT-KKEEQDAKIRDSTLLLNEKNDLHSHKLDELRKTQKDIEYWNNK 482

Query: 645  ALDARSALSNAENKSKVLTALSRLQKSGR------------ISGFHGRLGDLGVID-EKY 691
              D    L +   K   L A  R     R              G  G + +L     +KY
Sbjct: 483  EFDLNHKLRDTLVKLDDLNATQRESNKERKLRENVAMLKRFFPGVRGLVHELCKPKRDKY 542

Query: 692  DVAISTACPR-LEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESV 750
             +A+ST   +  + ++V+++   Q+CI +L+K + G   FI LD      +D+      V
Sbjct: 543  KLAVSTVLGKNFDSVIVDSLSVAQECISFLKKQRAGVISFIPLD-----TIDAATPRMPV 597

Query: 751  PR------LFDLIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGK-KRFRVVTLDGNL 803
            P         + +  KD     A + V  +T++ ++L  A  + + K    ++VTLDG L
Sbjct: 598  PESETYTLAINTVEYKDD-LVRAMYYVCSDTIICDNLDIARDLKWNKNANVKIVTLDGAL 656

Query: 804  IDISGTMSGGGSRVSRGLMQINRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQ 863
            I+ +G M+GG +  S        N+ +  E  S  ++    +  VE   N    S  I +
Sbjct: 657  INKTGLMTGGITSDS-------ANRWDKDEYQSLLDLKDKLIVDVEEAANKSRQSTLIAR 709

Query: 864  MEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQ-----DNNV 918
                                +L + + S  SEI     Q+ +++RA   T+      NN+
Sbjct: 710  --------------------ELEISLSSLTSEISYIRTQITQTKRAVEETETEINHHNNL 749

Query: 919  ELRETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNE----IMEIGGAELKIQSSKVDSVI 974
              RE I  V+ L+++   ++++ +    + E L+ +    + E  G  +K   S    +I
Sbjct: 750  IDREFIPQVKDLENKISGLEDEIRDWNTKREALQEKCFARLTEKVGFTMKDYESHTGEMI 809

Query: 975  QRIDIVVSKQKKERSVIKKTENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLN 1034
            +       KQ KE  +++K    +N  +K++ ET R                   +D L 
Sbjct: 810  R-------KQTKELQILQK--QILNLENKVEFETGR---------------CNATKDRLQ 845

Query: 1035 KVHESVTSVQHTKEGLIEESR-------TLEDKLNDINEDIAIFKS 1073
             V E+  SVQH    L+++ +       TLE +L+  NE++   K+
Sbjct: 846  NVQETKNSVQHELNELVDQEKSIKLSIETLEGELDGKNEELKSIKA 891

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
           Ashbya gossypii AGL023W
          Length = 1222

 Score =  123 bits (308), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 181/728 (24%), Positives = 320/728 (43%), Gaps = 117/728 (16%)

Query: 145 IDQLI---LQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQD 201
           + QLI   L +FKSY G   VG  N  F ++VGPNGSGKSN++D++ FV G R+N +R +
Sbjct: 1   MGQLIGLELNNFKSYKGTHNVGFGNKHFISIVGPNGSGKSNMMDAISFVLGIRSNHLRSN 60

Query: 202 RLSDLIH------KSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNN 255
            L DLI+      +S+E+ + P  +    F    D     T+I+         R      
Sbjct: 61  ALVDLIYRGRMDDRSDEHVASPKSAYVKAFYLKDDNGEQGTKIE-------FMRIIQNTG 113

Query: 256 TSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXX 315
            S Y ++ +  ++    + L+ E + +  + FL+ QG+VE IA                 
Sbjct: 114 DSVYRIDGKTVSFKRYVEYLEGESILVKARNFLVFQGDVEQIASQSG-------IELTKL 166

Query: 316 XXXIIGTAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENER 375
              + G+ +Y+   E                        R K   +   EE    L+++R
Sbjct: 167 FEQVSGSVQYQREYE------------------------RLKEEYQKATEEYGDSLKSKR 202

Query: 376 KLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQ-----KLEKESDKNASVKKELDKLRAF 430
           K+ +      +   ++     KN L + T LN+     +L    D+ + +   L   ++ 
Sbjct: 203 KMQIDLKSFKEG--VHKEQHYKNLLSERTKLNRQYVLWQLYHLEDRRSGLISSLKDSKSK 260

Query: 431 GDELESKLKNCNNEEKQLLGKKRELDGKNVL----NEEKIKNFEKKRDKAEKTL------ 480
             +L+SKL N    E+ +L K +    K+ +     +EK+   +++R K    L      
Sbjct: 261 LAQLKSKLTN----EEHILHKSKSQAAKDEIVITRKKEKLSQLQQERSKLNSELLPVGSS 316

Query: 481 -SSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNG-ISL 538
             S  + I+  E R+  LK+     E+ +++   Q +V     + ++  +K  ++G  +L
Sbjct: 317 RQSASKRINHIEKRIDSLKRDITRQESYVQQFQNQLKVVTKAKDSLEIDIKASSSGKFNL 376

Query: 539 EIAQL-------EKELEPWNAQLQEKKTQIQ-----LAESQISLIKE----AEAKLAQEI 582
              QL       E  L    + L+EK T +Q     L E +ISL +     ++++++ E+
Sbjct: 377 SKEQLKEYESLKETYLCSGGSALEEKMTLLQNKREELLE-EISLYERRANISKSRISVEL 435

Query: 583 DQFKQEIETRKQQILQGSKELDSLHS----QHKSVKEEISTGEKECLNARIRLKEMQNIL 638
           +  ++++E    ++ +     ++LHS    + K V+  I +   +      +LKE+   L
Sbjct: 436 NVEREKLELELSEVTRVLNSKNALHSAKVKEWKEVQSAIESANNKEYELNYKLKEVLVKL 495

Query: 639 NTQRQKALDARSALSNAENKSKV-LTALSRLQKSGRISGFHGRLGDLGVI-DEKYDVAIS 696
           +      L A    SN E K +  +  L RL       G  G + DL     +KY +A+S
Sbjct: 496 DD-----LTADQRESNKERKLRENVATLKRL-----FPGVKGLVHDLCRPKKDKYALAVS 545

Query: 697 TACPR-LEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPE-SVPRLF 754
           +   +  + IVV++V   QQCI YL+K++ G A FI LD +       INTP   V  L 
Sbjct: 546 SMLGKNFDSIVVDSVSVAQQCISYLKKHRSGAASFIPLDTI------DINTPTLPVRNLK 599

Query: 755 DLIHP-----KDPKFSSAFFSVLGNTLVANDLKQANRVAYGKK-RFRVVTLDGNLIDISG 808
             I        D +   A   V  ++++ + L  A  + + +  + ++VT+ G LI  +G
Sbjct: 600 GCILTVNAIEYDSELEKAMQYVCSDSIICDTLDIAKNLKWDRGIKSKLVTIQGALIHRAG 659

Query: 809 TMSGGGSR 816
            M+GG  R
Sbjct: 660 LMTGGVGR 667

 Score =  122 bits (307), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 95/157 (60%), Gaps = 10/157 (6%)

Query: 1258 RFDEFMQGFGIISMTLKEMYQMIT---------MGGNAELELVDTLDPFSEGVTFSVMPP 1308
            R   F+  F  ++  +  +Y+ +T          GG+A L L D  +P+  G+ +   PP
Sbjct: 1055 RVKTFLSCFQHVTDHIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLAGIRYHATPP 1114

Query: 1309 KKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER- 1367
             K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YIK   
Sbjct: 1115 MKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYIKRHA 1174

Query: 1368 TKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATI 1404
            +   QFIVISL++N+F  +Q + G+++      S  I
Sbjct: 1175 SPKFQFIVISLKSNLFGKSQSMAGVFRNQQANSSMVI 1211

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score =  120 bits (302), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 188/723 (26%), Positives = 319/723 (44%), Gaps = 93/723 (12%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRAN-KMRQDRL 203
           +++LI+  FKSYA R V+  ++  F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRASNL 62

Query: 204 SDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVND 263
            DLI+K  +   +   SV + F    D+ S      E  P + VTR+     TSKY +N 
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNT-DKSSSPIGF-ESYPKISVTRQIILGGTSKYLING 119

Query: 264 QETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGTA 323
                  V  L +   +++++  FLI+QG++  +  MK                   GT 
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTEILSLIEEAA-------GTR 172

Query: 324 KY---KPLIEKNLADMES-LNDI--CIEKENRFQIVDREKNSLENGKEEALLFLENERKL 377
            +   +   EK +A  E+ L +I   +E+E     ++ +   L N K   L F E +  L
Sbjct: 173 MFEDRREKAEKTMAKKETKLQEIRTLLEEE-----IEPKLEKLRNQKRAFLEFQETQTDL 227

Query: 378 --TVSKSKLYQYHIL---NSNMK--LKNTLDKITNLNQKLEKESDKNASVKKELDKLRAF 430
             T+     Y+Y+ +   NS +K  L+N+  ++  LN  ++K  ++ +++ ++L  ++  
Sbjct: 228 EKTLRILNAYEYYDMATKNSTIKETLQNSTARVEELNNFIQKTKNEISNLDEDLKTIKIQ 287

Query: 431 GDEL---ESKLKNCNNEEKQLLGKKRELD---GKNV--LNEEKIKNFEKKRDKAEKTLSS 482
             E    + KL     +E  L  +   L    G +V  +NEE  K            L  
Sbjct: 288 KQEQVQKDGKLSQLEKQENDLANEISRLKTALGISVENINEESYK------------LKK 335

Query: 483 MDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQ 542
           +  ++   E  LSE   +    E+   +LNE  +  K + +  +  L   T GIS     
Sbjct: 336 LHENVQKFERDLSEKSVIYTSTESEFNDLNEGVKRLKGQFKAKEELLSTLTTGIS----S 391

Query: 543 LEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKE 602
                  +N+QL   KT  +L ++QI  IK +  K    ID  K+E    + +I    +E
Sbjct: 392 TGGTDSGYNSQLSAAKT--KLNDAQIC-IKRSTMK----IDMLKKESAINEPKIAHAERE 444

Query: 603 LDSLHSQHKSVKEEISTGEKECLNARIRLKEM---QNILNTQRQKALDARS---ALSNAE 656
                   ++++ EI   E+ C N + +L ++     ++   +QK    R+    LSN  
Sbjct: 445 ------NEQNIR-EIKGYEQVCENLKAQLNDLGFNPMMIKDLKQKEFKLRNESYQLSNDT 497

Query: 657 NKSKVLTALSRLQKSGRISGF-----HGRLGDLGVID-EKYDVAIS---TACPRLEDIVV 707
              +  TA      S   + F      G    L  ++ E +D A +    A  RL ++VV
Sbjct: 498 EHLRRKTANLEFTYSTPSANFDPKSVKGVAAQLFTLEKENFDSATALQVCAGGRLFNVVV 557

Query: 708 ETVECGQQCIEYLRKNKLGYARFILLDKL--RKFNLDSIN-----TPESVPRLFDLIHPK 760
           +      Q +E  R  K      I L+K+  R  N +++       P +V    +LI  +
Sbjct: 558 DNEVTASQLLERGRLRK--RVTIIPLNKIASRTLNENALKLAKSVAPGNVELALNLIGYE 615

Query: 761 DPKFSSAFFSVLGNTLVANDLKQANRVAYGKK-RFRVVTLDGNLIDISGTMSGGGSRVSR 819
           D + S A   + G +L+  D + A RV +  + R R +TLDG++ D  GT+SGG      
Sbjct: 616 D-EVSRAMEFIFGTSLICKDAETAKRVTFHPQIRARSITLDGDIYDPEGTLSGGSRNTKN 674

Query: 820 GLM 822
            L+
Sbjct: 675 SLL 677

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1312 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1370
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1371 AQFIVISLRNNMF 1383
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
            {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
            YFR031C SMC2 Component of the condensin complex essential
            SMC chromosomal ATPase family member that forms a complex
            with Smc4p to form the active ATPase Smc2p/Smc4p complex
            binds DNA possibly in the cleft formed by the coiled-coil
            of the folded dimer
          Length = 1170

 Score =  119 bits (298), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 237/1004 (23%), Positives = 432/1004 (43%), Gaps = 152/1004 (15%)

Query: 145  IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 203
            I++LI+  FKSYA R V+  ++  F+A+ G NGSGKSNV+D++ FV G  + + +R   L
Sbjct: 3    IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNVLDAICFVLGIASMSTVRASSL 62

Query: 204  SDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVND 263
             DLI+K  +   +   SV + F  +  +P       E  P L VTR+     TSKY +N 
Sbjct: 63   QDLIYKRGQ-AGVTKASVTIVFSNL--DPKCSPIGFENSPKLSVTRQIILGGTSKYLING 119

Query: 264  QETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGTA 323
                   V +L +   +++++  FLI+QG++  +  MK                   GT 
Sbjct: 120  HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSEILSLIEEAA-------GTK 172

Query: 324  KY---KPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLT-- 378
             +   K   E+ +   E        KENR  + +  +  LE  + E  +FLE +   T  
Sbjct: 173  MFEDRKGKAERTMGKKE-----LKLKENRTLLQEEIEPQLEKLRNEKRIFLEFQEIQTDL 227

Query: 379  --VSKSKL-YQYH-ILNSNMKLKNTLD----KITNLNQKLEKESDKNASVKKELDKLRAF 430
              + +  L Y+YH ++     +K TLD    ++  L+  + K  ++   + ++L+++   
Sbjct: 228  EKIQRIVLAYEYHSLVGKQSSIKETLDTGESRMAELHGLISKTGEEVMHLTEDLNRINYE 287

Query: 431  GD-ELES--KLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSI 487
               EL+S  KL     +E  L+     L     +  E I       ++  K L S   +I
Sbjct: 288  KQKELDSDGKLGKLEKQESTLMNNLSRLRASFDICVENI-------NETAKNLESTKANI 340

Query: 488  SSSEARLSE----LKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQL 543
             +++ +L E     K ++ +Y +  K+  E  E    K E +  +L+   + +       
Sbjct: 341  KTNKGKLEEKSEAWKNMEAEYRHLNKKGKELKESHSKKSELLS-TLQTGISSVGTTGGGY 399

Query: 544  EKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKEL 603
             ++L      LQE +  +Q +  +I         L +E+   K ++E  +    +G  ++
Sbjct: 400  TEQLAATKGNLQEAEIVVQKSRLKIE-------HLNKELHANKPKLEKARMDNEEGLNQI 452

Query: 604  DSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKALDARSALSNAENKSKVL- 662
                 +HKS+++  +    E LN   R     +++   RQK    R  L N   +++ L 
Sbjct: 453  ----KKHKSIQDTFT----EELN---RYGYDPSVVKELRQKEYSMRQELHNVGRETEYLR 501

Query: 663  ----------TALSRLQKSGRISGFHGRLGDLGVIDEKYDVAIS---TACPRLEDIVVET 709
                      T  S       + G   +L  L   +  YD A++    A  RL +++V+ 
Sbjct: 502  RSVANIEFNYTMPSEKFDPNSVKGVAAQLFTLS--ENNYDSALALQVCAGGRLFNVIVDD 559

Query: 710  VECGQQCIEY--LRKNKLGYARFILLDKL--RKFNLDSIN-----TPESVPRLFDLIHPK 760
                 Q +E   LRK        I L+K+  R  N +S+       P  V    +L+  +
Sbjct: 560  QNTASQLLERGKLRKR----VTIIPLNKIATRVINSESLKLAKQLAPGKVQLALNLVGYE 615

Query: 761  DPKFSSAFFSVLGNTLVANDLKQANRVAYGKK-RFRVVTLDGNLIDISGTMSGGGSRVSR 819
            + + S A   + GN+LV ND + A R+ +  + R R +T  G++ D  GT+S GGSR ++
Sbjct: 616  E-EVSKAMEYIFGNSLVCNDAETAKRLTFHPQIRTRSITQQGDVYDPEGTLS-GGSRNNK 673

Query: 820  GLMQINRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIE 879
              + +      DI+ Y+S              K  +V  D +  +  +   LKE+E A  
Sbjct: 674  STLLV------DIQKYNSA------------AKRMKVLEDELLVISNK---LKEQESA-- 710

Query: 880  NNISQLTMEIESWNSEIKIKEIQMLESERAYSATQ------DNNVELRETIQHVQSLKDE 933
               S  T EI++  + +  K      +     ATQ      D   ++RE  + ++  +  
Sbjct: 711  ---SAKTKEIQNKLNLVSHKLSIFQRTLNENPATQIIKRNDDLTRQIRECEEEIEQKQSY 767

Query: 934  FKSIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKK 993
               +Q++ +  +  +E   N+     G +L+    ++DS+ + I               K
Sbjct: 768  MSQLQDEIRKIQDDMEEFNND----KGTKLEKLKKEIDSLTKEIG--------------K 809

Query: 994  TENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEE 1053
             ++  +K + +        +N   E + L + I   +D+L  ++ S+ + Q+ K+ LI E
Sbjct: 810  LDSITDKKYDL-------YQNLQLETEQLTSEISSDEDALEHMNTSLDNFQNQKKSLIAE 862

Query: 1054 SRTLEDKLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIK 1097
                E  L D++ ++   K   +++  EL++LN L  H K E K
Sbjct: 863  LEHAEHTLADVHSEVDEEKKRLVDIDEELKELNGL-IHAKAEKK 905

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1312 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1370
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1371 AQFIVISLRNNMFELAQQL 1389
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1170

 Score =  114 bits (286), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 225/976 (23%), Positives = 424/976 (43%), Gaps = 156/976 (15%)

Query: 145  IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 203
            +++LI+  FKSYA R V+  ++  F+A+ G NGSGKSN++D++ FV G  + + +R   +
Sbjct: 3    VEELIIDGFKSYATRTVISGWDAQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNM 62

Query: 204  SDLIHKSEEYPSLPSCSVEVHFKYV--IDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYV 261
             DLI+K  +   +   SV + F      + P G      +   + VTR+     TSKY +
Sbjct: 63   QDLIYKRGQ-AGVTKASVTIVFDNSDKSNSPIGFN----DSLKISVTRQIVLGGTSKYLI 117

Query: 262  NDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIG 321
            N        V +L +   +++++  FLI+QG++  +  M+                   G
Sbjct: 118  NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMRPSEILSLIEEAA-------G 170

Query: 322  TAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLTVSK 381
            T  ++   EK    M S  +  +E ENR  + +  +  L   + E  +FLE      V++
Sbjct: 171  TKMFEDRREKAERTM-SKKETKLE-ENRTLLAEEIEPKLNKLRGEKRIFLE----FQVTQ 224

Query: 382  SKL---------YQYHILNSNMKLKNTLDKITNLNQKLE-------KESDKNASVKKELD 425
            + L         + YH  N + +  +  DK+++  +++E       K +D+  S+K++L+
Sbjct: 225  TDLEKISRVVTAFDYH--NMSTRRDSARDKVSSNERRMEELKTLISKTTDEIISLKEDLE 282

Query: 426  KLRA-FGDELESK--LKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSS 482
            +++    DEL+    L     +E   L +   ++    +  + ++  +KK  K + TL S
Sbjct: 283  QIKTQKKDELDKNGVLPKLEKQEGDFLNQISRINATKQICSQNLEENKKKIQKLQNTLES 342

Query: 483  MDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQ 542
            + R +   + +L   ++++  Y+     LN+  E  K + E +        + +S+ I+ 
Sbjct: 343  LSREL---QEKLDRYREIETAYKQDESTLNQLKEEHKSRSELL--------STLSIGISS 391

Query: 543  LEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKE 602
              +    + AQL   K Q    E  I   +       + I+  ++E+     ++ Q  KE
Sbjct: 392  TGEAETGYTAQLSSVKEQYNETEVNIQTHR-------KRIEFIEKELAYNGPKLQQARKE 444

Query: 603  LDSLHSQHKSVKEEISTGEKECLNARIR---LKEMQNILNTQRQKALDARSALSNAENKS 659
             +   + +K  +   ++ EKE          LK+++   +  +Q+     + + + + K+
Sbjct: 445  NEQAVANYKHSEMACASLEKELTTFGYDPEFLKQLRKEESDLKQQIYQMNNDIDHLKRKT 504

Query: 660  KVLTALSRLQKSGRI--SGFHGRLGDLGVIDEK--YDVAISTACP--RLEDIVVETVECG 713
              L     +   G+   +   G    L  +DE+  Y       C   RL ++VV+     
Sbjct: 505  ANLDFHYEM-PGGKFDPNSVKGIAAQLFSLDEQNFYSATALQVCAGGRLFNVVVDNENTA 563

Query: 714  QQCIEYLRKNKLGYARFILLDKL--RKFNLDSINTPESV-PRLFDL---IHPKDPKFSSA 767
             Q +E  R  K   A  I L+K+  R  N + +N  +SV P   +L   +   + +   A
Sbjct: 564  AQLLERGRLRK--RATIIPLNKIAARTLNDNIVNMAKSVAPGRVELALNLIGYEEEVRRA 621

Query: 768  FFSVLGNTLVANDLKQANRVAYGKK-RFRVVTLDGNLIDISGTMSGGG-SRVSRGLMQIN 825
               + G++LV  D + A  V +  K R R +TLDG++ D  GT+SGG  +  S  L+ I 
Sbjct: 622  MEFIFGSSLVCKDAEAAKMVTFNPKIRTRSITLDGDVYDPEGTLSGGSRNNTSSLLIDIQ 681

Query: 826  R-----------------------------NKTEDIEIYSSEEVAQLEVNLVEREKNFQV 856
            R                             NKT++++     E+AQ ++ L ER      
Sbjct: 682  RYNNNCNLVKELETKLNDIAKKIAIQFEISNKTKNLQ--KELELAQHKLKLSERNLQSNT 739

Query: 857  ASDTIYQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLESER-AYSATQD 915
            A+  I + EE           +E+ I+Q   EI+   S+IK  + Q+ + E+ A   + D
Sbjct: 740  AAQLIRKNEE-----------LESEIAQCKEEIKDKTSQIKQLKKQIAKIEKDADEFSHD 788

Query: 916  NNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQ 975
               +L E  + V+S+  +    + + +++    +  + EI ++GG               
Sbjct: 789  KGSKLDELRREVESMSVQISEEEQRCETQYDAYQNFQLEIEQLGG--------------- 833

Query: 976  RIDIVVSKQKKERS--VIKKTENEINKSHKMKLETSRDLENFNQEIQTLKTTIE------ 1027
              DI  SK   E++   +KK + E+++ H M L   RDL   NQ +Q  +  +E      
Sbjct: 834  --DIDSSKDTLEQAELTVKKLQTEVSE-HDMNL---RDL---NQALQDKQVELEEERNRL 884

Query: 1028 -GLQDSLNKVHESVTS 1042
             G+ D L ++   + S
Sbjct: 885  MGIDDELKEIEALIKS 900

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1312 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1370
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1371 AQFIVISLRNNMF 1383
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score =  108 bits (269), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 177/724 (24%), Positives = 307/724 (42%), Gaps = 113/724 (15%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 203
           +++LI+  FKSYA R V+  ++  F+A+ G NGSGKSN++D++ FV G  +  + R   L
Sbjct: 3   VEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRASNL 62

Query: 204 SDLIHKSEEYPSLPSCSVEVHFKYV--IDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYV 261
            DLI+K  +   +   SV + F      + P G          + VTR+     TSKY +
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNSDKTNSPIGFNN----SSKISVTRQIILGGTSKYLI 117

Query: 262 NDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIG 321
           N        V +L +   +++++  FLI+QG++  +  MK                   G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPNEILSLIEEAA-------G 170

Query: 322 TAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLTVSK 381
           T  ++   EK    M        +KE + Q     +  LE   E  L  L NE+++    
Sbjct: 171 TKMFENRREKAERTM-------AKKETKLQ---ESRTLLEEEIEPKLEKLRNEKRM---- 216

Query: 382 SKLYQYHILNSN----MKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESK 437
               ++    ++    MK+ +  D    +N        ++ASVK  L+   A   EL   
Sbjct: 217 --FLEFQTTQADFEKTMKVVHAFDYKNMIN--------RHASVKDVLESSEARMAEL--- 263

Query: 438 LKNCNNEEKQLLGKKRELDGKNVLNE--EKIKNFEKKRDKAEKTLSSMDRSISSSEARLS 495
                   K L+ +  E  G   LNE  E++K  ++K    + TLS +++  S     +S
Sbjct: 264 --------KGLILRTAEEIGS--LNEDLEQVKIQKEKELDKDATLSRLEKEESELLNEVS 313

Query: 496 ELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQ 555
            +K       +++KE N+Q E  K  +E+ K +LK+K+          EKE +  NA L 
Sbjct: 314 RIKTSHSICNDNIKENNKQVEKLKSDIEQFKLTLKEKSETFE----STEKEYQEINASLA 369

Query: 556 EKK----------------------------TQIQLAESQISLIKEAEAKLAQEIDQFKQ 587
           + K                             Q+ +A+++++  + +  KL+  ID   +
Sbjct: 370 KIKETYSKKEELLSTLLTGITSTGDTDGGYSAQLTIAKNKLNDTEVSIKKLSMRIDILNK 429

Query: 588 EIETRKQQILQGSKELDSLHS---QHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQK 644
           E+   + ++ Q   E + +     +HK V  ++     +     +R KE++   N+ RQ+
Sbjct: 430 ELVNNQPKLQQAKIENEKIRGNVEKHKHVCLDLEQQLSKSGFDPLRTKELKTRENSLRQE 489

Query: 645 ALDARSALSNAENKSKVL----TALSRLQKSGRISGFHGRLGDLGVIDEKYDVAIS---T 697
                +   N + +   L    T  S    +  + G   +L  L    + +D A +    
Sbjct: 490 IHRVETQNENLKRRVAGLDFNYTNPSENFDARSVKGVAAQLFTLN--KDHFDAASALQVC 547

Query: 698 ACPRLEDIVVETVECGQQCIEYLRKNKLGYARFILLDKL--RKFNLDSIN-----TPESV 750
           A  RL ++VV+  +     +E  R  K      I L+K+  R  N  ++       P  V
Sbjct: 548 AGGRLYNVVVDNEKTASLLLEKGRLRK--RVTIIPLNKIAARTLNARTLQMAKDIAPGKV 605

Query: 751 PRLFDLIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKK-RFRVVTLDGNLIDISGT 809
               +LI   D + S A   + G +LV  D   A +V +  + R R +TLDG++ D  GT
Sbjct: 606 ELALNLI-GYDDEVSRAMEFIFGGSLVCQDANTAKKVTFHPQIRTRSITLDGDVYDPEGT 664

Query: 810 MSGG 813
           +SGG
Sbjct: 665 LSGG 668

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1312 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1370
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLVELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1371 AQFIVISLRNNMFELAQQL 1389
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1224

 Score =  106 bits (264), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 232/1002 (23%), Positives = 424/1002 (42%), Gaps = 195/1002 (19%)

Query: 143  LCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 202
            + I  +++Q FK+Y     V   +  F+ ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1    MYIKSVVIQGFKTYKNTTSVEGLSPRFNVIIGGNGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 203  LSDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKP----NLVVTRKAFRNNTSK 258
               LIH+     S+ S  VE+ F     +PSG+  I    P    ++V  R+       +
Sbjct: 61   RQGLIHQG--TGSVMSAYVEIIFH----DPSGQMMITSGIPMTEEHIVRVRRTIGLKKDE 114

Query: 259  YYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXX 318
            Y VN +  +  +++++ +  G    +   ++ QG +  +   K +               
Sbjct: 115  YSVNGKTCHKSDISRMFESVGFSAVNPYNIVPQGRIVAVTNAKDR-------ERLALLEE 167

Query: 319  IIGTAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLT 378
            ++G   ++  + ++   ME+ N                                  R  T
Sbjct: 168  VVGAKSFEIKLRESAKKMEATN----------------------------------RDRT 193

Query: 379  VSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFG------- 431
               S+L +         L+  LD++    Q+LEK        K E D+ R F        
Sbjct: 194  RIDSELAE---------LRTRLDELNEERQELEKYQ------KLERDR-RIFQFVLYDRE 237

Query: 432  -DELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTL---SSMDRSI 487
             +E+ S++++  +E   +L    E   +    EE I+N  K     E  L    SMD  +
Sbjct: 238  LNEVTSQIESLEDEYNHVLQSSEEFLQELYKREELIENVTKNISNIETELRVKESMD--L 295

Query: 488  SSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKEL 547
               ++RL E+ + + D E  L+E   Q E  K +    + +LK     I  +  QLE+ L
Sbjct: 296  QQEKSRLQEISKRKADLEVHLEEAKRQAEAHKKQTSVDQNNLKTVEEEIEKKSLQLER-L 354

Query: 548  EPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQE---IDQFKQEIETRKQQILQGSKELD 604
             P   QL   K++ Q  ESQ+S  + ++ ++  +     QFK ++E  + + L+   E+ 
Sbjct: 355  IPRFEQL---KSESQEFESQLSNYQRSQREIVSKRGIYAQFKSKVE--RDEWLKN--EIA 407

Query: 605  SLHSQHKSVKEEIS--TGEKEC--------------LNARIR-------LKEMQNILNTQ 641
            SL +QH+ + E+++  T EKE               LN  +R       L+++Q+ L++ 
Sbjct: 408  SLKAQHQDLAEQLAALTREKEQTGSEVEVFNEEITELNDSVRGPGIQAELQDLQSHLDSL 467

Query: 642  RQKAL---DARSALSNAENKSKVLT------------ALSRLQKSGRISGF--------- 677
            +Q  L   D R  L  AE K   ++             LS     G  SG          
Sbjct: 468  KQSYLGKIDERKELWRAEQKFLTVSDALNDGVKRSERNLSETMDRGLASGLRAVREISER 527

Query: 678  --------HGRLGDLGVIDEKYD-VAISTACPRLEDIVVETVECGQQCIEYLRKNKLGYA 728
                    HG LG+L  ++EKY   A +     L  +VV+T E     +E L   K G  
Sbjct: 528  LKLPADSVHGPLGELIKVNEKYKACAEAVGGNALLHVVVDTDETASILMEELYNTKAGRV 587

Query: 729  RFILLDKLRKFNLDSINTP-----ESVPRLFDLIHPKDPKFSSAFFSVLGNTLVANDLKQ 783
             FI L+++   N   +  P     E  P ++ + + K  +F  A   V G T+V  D+  
Sbjct: 588  TFIPLNRIADSN--PVTFPDNSQAECTPLIWKMKYEK--RFEKAVRHVFGRTIVVRDIGT 643

Query: 784  ANRVAYGKKRFRV--VTLDGNLIDISGTMSGGGSRVSRGLMQINRNKTEDIEIYSSEEVA 841
             +++A   K F +  VTLDG+  D  G ++GG     +      RN+ + +     +E++
Sbjct: 644  GSKLA---KSFNLDAVTLDGDRTDKRGLITGGYHDYHK------RNRLDCL-----KEMS 689

Query: 842  QLEVNLVEREKNFQVAS------DT-IYQMEEQLKDLKEKEPAIENNISQLTMEIESWNS 894
              +  L+E  KN   A       DT I Q+ +++K    ++ AI +NI  +  ++    +
Sbjct: 690  AAKRQLLEATKNLDAARGQITAIDTEIDQINDEIKTQSSRKEAILSNIENMRAKLNKKTA 749

Query: 895  EIKIKEIQMLESERAYSATQDNNVELRE--TIQHVQSLKDEF-KSIQNQ----TKSKKHR 947
            E  +K+ ++L+S     A  + +++L E  T +    L   F K + ++     KS   +
Sbjct: 750  ERALKK-EILDSITTKHARMETSLKLNEEKTERFETDLNKPFEKGLSDEEEQTLKSLADK 808

Query: 948  IETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINK-SHKMKL 1006
            +  + +E + +    L   + K+D +   + + +  QKKE       E+ I++ S   +L
Sbjct: 809  MRAV-SEPLSVTADALNELTLKIDLLKAELGVKLVPQKKE------IEDRISQASGSKRL 861

Query: 1007 ETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKE 1048
             +S +L   + E++ L +    LQ SL  + +++ S+   KE
Sbjct: 862  ASSEELSQISTELEKLASREHELQTSLQGISDNIASLNEEKE 903

 Score = 79.7 bits (195), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 66/109 (60%), Gaps = 3/109 (2%)

Query: 1292 DTLDPFSEGVTFSVMPPKKSWRN--ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1349
            D+++    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1092 DSIETMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1151

Query: 1350 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNK 1398
            AALD +  + VAN IKE + +AQFI  + R++M ++A     + + DNK
Sbjct: 1152 AALDKQYRTSVANVIKELSVHAQFICTTFRSDMLQVADSFYRV-RFDNK 1199

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
           Component of the condensin complex essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase Smc2p/Smc4p complex
           binds DNA possibly in the cleft formed by the
           coiled-coil of the folded dimer
          Length = 1170

 Score =  105 bits (261), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 163/706 (23%), Positives = 301/706 (42%), Gaps = 83/706 (11%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 203
           +++LI+  FKSYA R V+  ++  F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 204 SDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVND 263
            DLI+K  +   +   SV + F    D+ +      E  P + VTR+     TSKY +N 
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFTN--DDKANSPIGFESYPKISVTRQIVLGGTSKYLING 119

Query: 264 QETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGTA 323
                  V  L +   +++++  FLI+QG++  +  MK                      
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPSEILSLIEEAAGTKMFEDRRE 179

Query: 324 KYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKL--TVSK 381
           K +  + K    ++ +  + IE+      ++ + N L N K   L F E +     T   
Sbjct: 180 KAERTMNKKETKLQEIRTLLIEE------IEPKLNKLRNEKRAFLEFQETQSDFEKTSRI 233

Query: 382 SKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNC 441
              + Y  L  + K         N  +  +    +   +++ + K R     LE  L   
Sbjct: 234 VNAFTYSTLAQSRK---------NFEETFKSNESRIEQLEEAIQKTRQGMTNLEEDLDVA 284

Query: 442 NNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQ 501
             +++  +GK  +L     L E ++ N +  R KA  T+++   +++    R   L++  
Sbjct: 285 RTQKRNEMGKNGKLGQLEAL-ENQLNN-DLSRLKASLTITT--DNLNEENVRRESLERSI 340

Query: 502 VDYENSLKE---LNEQTEVEKMKLEKIKFSLKDK-----------TNGISLEIAQLEKEL 547
            DYE+SL++    ++ TE E + L  +  +L+ +           T GIS   A      
Sbjct: 341 CDYESSLEKNTTHSKNTEDEYLSLNNLVSNLEKQLQTKEELLSTLTTGISSTGAT----T 396

Query: 548 EPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKELDSLH 607
             +N QL   K +   A+ Q+        +   +ID  ++E+   + ++ +         
Sbjct: 397 SGYNLQLSSAKARFNDAQVQVQ-------RFGMKIDLLRKELSANEPKLAKA-------K 442

Query: 608 SQHKSVKEEISTGEKEC--LNARIR--------LKEMQNILNTQRQKALDARSALSNAEN 657
           S  +  K+EI     +C  LNA +          K+++   +T RQ      S + + + 
Sbjct: 443 SICEEAKKEIEAHRMQCSKLNAHLEKLGFNPDLFKQLKEEESTLRQSIYKLSSEMESLKR 502

Query: 658 K-SKVLTALSRLQKSGRISGFHGRLGDLGVIDEK-YDVAIS---TACPRLEDIVVETVEC 712
           + + +    S+  ++   S   G    L  +DEK Y  A +    A  RL ++VV+    
Sbjct: 503 RVANIEFTYSKPSENFNPSSVKGVAAQLFSLDEKNYSSATALQVCAGGRLFNVVVDNEGT 562

Query: 713 GQQCIEYLRKNKLGYARFILLDKL--RKFNLDSIN-----TPESVPRLFDLIHPKDPKFS 765
             Q +E  R  K      I L+K+  R  + +++       P +V    +LI  ++ + S
Sbjct: 563 ASQLLERGRLRK--RVTIIPLNKISARSLHQNAVKAAKELAPGNVELALNLIGYEE-EVS 619

Query: 766 SAFFSVLGNTLVANDLKQANRVAYGKK-RFRVVTLDGNLIDISGTM 810
            A   + G +L+  D + A +V +  + R R +TL G++ D  GT+
Sbjct: 620 KAMEFIFGTSLICQDAETAKKVTFHPRVRARSITLQGDIYDPEGTL 665

 Score = 68.2 bits (165), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1312 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1370
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1371 AQFIVISLRNNMF 1383
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa]
           {ON} YJL074C (REAL)
          Length = 1229

 Score = 99.8 bits (247), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 173/742 (23%), Positives = 323/742 (43%), Gaps = 138/742 (18%)

Query: 143 LCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 202
           + I ++I++ FK+Y    ++  F+   + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 203 LSDLIHKSEEYPSLPSCSVEVHFK---YVIDEPSGE-TRIDEEKPNLVVTRKAFRNNTSK 258
              LIH+     S+ S SVE+ F    + +  PSG  +R D+E    V  R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 259 YYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXX 318
           Y +ND+    G++ ++L+  G  +++   ++ QG++  +   K K               
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDK-------ERLQLLED 168

Query: 319 IIGTAKYKPLIEKNLADMESLNDICIEKENRFQI------VDREKNSLENGKEEALLFLE 372
           ++G   ++  ++ +L  ME        ++ +FQI      ++ +   +E  ++E   + E
Sbjct: 169 VVGAKSFEVKLKASLKKMEET------EQKKFQINKEMDELNSKLTEMEQERKELEKYNE 222

Query: 373 NERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGD 432
            ERK      K+YQY + +   +L + ++++  L+         +    +ELDK     +
Sbjct: 223 LERK-----RKIYQYTLYDR--ELNDVINQMERLDGDYNNTVYSSEQYIQELDKREDMIE 275

Query: 433 ELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEA 492
           ++  KL N           +  L  KN  + ++ K  E          S   ++++    
Sbjct: 276 QVSKKLSNI----------EASLKIKNTTDLQQAKLRE----------SETSQNLTDVNV 315

Query: 493 RLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSL---KDKTNGISLEIAQLEKELEP 549
           ++ E+ +LQ++  NS     EQ  ++   LE+IK  +   K K + I     +L KE   
Sbjct: 316 KIKEV-ELQIE-SNS-----EQRSLDSTTLEEIKSIIRQRKKKLSKILPRYQELTKEEAM 368

Query: 550 WN---AQLQEKKTQIQLAESQISLIK---EAEAKLAQEIDQFKQEIETRKQQILQGSKEL 603
           +    A LQ+K+  + L + + +  K   E +A +  EI++ K  ++   +Q   G+K  
Sbjct: 369 YKLQLASLQQKQRDLILKKGEYARFKSKEERDAWIYSEIEELKSSVQNLNEQ---GNK-- 423

Query: 604 DSLHSQHKSVKEEIST--GEKECL-------NARIRLKEMQNILNTQRQK---ALDARSA 651
             L ++  S+KE+ S   GE E L       + + +L++  + L   +QK   +LD R  
Sbjct: 424 --LQTERASLKEQYSKIDGEIEELIDSVNGPDIKGQLEDFDSELINLKQKLNGSLDTRKE 481

Query: 652 LSNAE----------------NKSKVLTALSRLQKSGRIS-------------GFHGRLG 682
           L   E                N+  V   +SR   +G I+                G LG
Sbjct: 482 LWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGTLG 541

Query: 683 DLGVIDEKYDVAISTACPR------LEDIVVETVECGQQCIEYLRKNKLGYARFILLDKL 736
           +L  +++KY      AC        L  +VV+T E     +  L + K G   FI L++L
Sbjct: 542 ELIKVNDKY-----KACAEVIGGNSLFHVVVDTEETATLIMNELYRMKGGRVTFIPLNRL 596

Query: 737 R-----KFNLDSINTPESVPRLFDLIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGK 791
                 KF  ++    +  P +  + +   P+F  A   V G T+V  DL Q  ++A  K
Sbjct: 597 SLDSDVKFPSNTTTQIQFTPLIKKIKYQ--PRFEKAVKHVFGRTIVVKDLGQGLKLA-KK 653

Query: 792 KRFRVVTLDGNLIDISGTMSGG 813
            +   +TLDG+  D  G ++GG
Sbjct: 654 HKLNAITLDGDRADKRGVLTGG 675

 Score = 77.0 bits (188), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 63/110 (57%), Gaps = 3/110 (2%)

Query: 1295 DPFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1352
            D    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAAL
Sbjct: 1100 DIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAAL 1159

Query: 1353 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSA 1402
            D +  + VA  IKE +KNAQFI  + R +M ++A +   + K +NK  + 
Sbjct: 1160 DKQYRTAVATLIKELSKNAQFICTTFRTDMLQVADKFFRV-KYENKISTV 1208

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
           SMC3Subunit of the multiprotein cohesin complex required
           for sister chromatid cohesion in mitotic cells; also
           required, with Rec8p, for cohesion and recombination
           during meiosis; phylogenetically conserved SMC
           chromosomal ATPase family member
          Length = 1230

 Score = 99.4 bits (246), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 169/716 (23%), Positives = 320/716 (44%), Gaps = 86/716 (12%)

Query: 143 LCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 202
           + I ++I++ FK+Y    ++  F+   + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 203 LSDLIHKSEEYPSLPSCSVEVHFK---YVIDEPSGE-TRIDEEKPNLVVTRKAFRNNTSK 258
              LIH+     S+ S SVE+ F    + +  PSG  +R D+E    V  R+        
Sbjct: 61  RQGLIHQG-SGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 259 YYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXX 318
           Y +ND+    G++ ++L+  G  +++   ++ QG++  +   K K               
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDK-------ERLQLLED 168

Query: 319 IIGTAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLT 378
           ++G   ++  ++ +L  ME      I+       ++ + + +E  ++E   + E ER   
Sbjct: 169 VVGAKSFEVKLKASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERNRK 228

Query: 379 VSKSKLYQY---HILNSNMKL----KNTLDKITNLNQKLEKESDKNASVKKELDKLRAFG 431
           + +  LY      ++N   +L     NT+       Q+L+K  D    V K+L  + A  
Sbjct: 229 IYQFTLYDRELNEVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEA-- 286

Query: 432 DELESKLKNCNN------EEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDR 485
                K+KN  +       E ++  K   ++ K    +++I++ E++R+    TL  +  
Sbjct: 287 ---SLKIKNATDLQQAKLRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKS 343

Query: 486 SISSSEARLS-------ELKQLQVDYENSLKELNE-QTEVEKMKLEKIKFSLKD-KTNGI 536
            I   + +LS       EL + +  Y+  L  L + Q ++   K E  +F  KD +   I
Sbjct: 344 IIEQRKQKLSKILPRYQELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKSKDERDTWI 403

Query: 537 SLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEI---ETRK 593
             EI +L+  ++  N    E ++Q+Q+   + SL K+  A + +EI++    I   +T+ 
Sbjct: 404 HSEIEELKSSIQNLN----ELESQLQM--DRTSLRKQYSA-IDEEIEELIDSINGPDTKG 456

Query: 594 QQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRL----KEMQNILNT------QRQ 643
           Q        L+   S+   +K+++S    E L+ R  L    +++Q +L T      Q Q
Sbjct: 457 Q--------LEDFDSELIHLKQKLS----ESLDTRKELWRKEQKLQTVLETLLSDVNQNQ 504

Query: 644 KALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAIST-ACPRL 702
           + ++   + S A     V     +L+ S       G LG+L  +++KY           L
Sbjct: 505 RNVNETMSRSLANGIINVKEITEKLKISP--ESVFGTLGELIKVNDKYKTCAEVIGGNSL 562

Query: 703 EDIVVETVECGQQCIEYLRKNKLGYARFILLDKLR-----KFNLDSINTPESVPRLFDLI 757
             IVV+T E     +  L + K G   FI L++L      KF  ++    +  P +  + 
Sbjct: 563 FHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLDSDVKFPSNTTTQIQFTPLIKKIK 622

Query: 758 HPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGG 813
           +  +P+F  A   V G T+V  DL Q  ++A  K +   +TLDG+  D  G ++GG
Sbjct: 623 Y--EPRFEKAVKHVFGKTIVVKDLGQGLKLA-KKHKLNAITLDGDRADKRGVLTGG 675

 Score = 75.5 bits (184), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 62/105 (59%), Gaps = 3/105 (2%)

Query: 1300 GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1357
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1358 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSA 1402
            + VA  +KE +KNAQFI  + R +M ++A +   + K +NK  + 
Sbjct: 1166 TAVATLLKELSKNAQFICTTFRTDMLQVADKFFRV-KYENKISTV 1209

>Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 89/160 (55%), Gaps = 8/160 (5%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 203
           +++LI+  FKSYA R V+  ++  F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 204 SDLIHKSEEYPSLPSCSVEVHFKYV--IDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYV 261
            DLI+K  +   +   SV + F     ++ P G T      P + VTR+     TSKY +
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFNNTDKLNSPIGFTN----SPQISVTRQVVLGGTSKYLI 117

Query: 262 NDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMK 301
           N        V +L +   +++++  FLI+QG++  +  MK
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMK 157

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1312 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1370
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1371 AQFIVISLRNNMFELAQQL 1389
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar to
           Ashbya gossypii AGR236W
          Length = 1170

 Score = 95.1 bits (235), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 86/160 (53%), Gaps = 8/160 (5%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 203
           +++LI+  FKSYA R V+  ++  F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 204 SDLIHKSEEYPSLPSCSVEVHFKY--VIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYV 261
            DLI+K  +   +   SV + F    +   P G  R     P + VTR+     TSKY +
Sbjct: 63  QDLIYKRGQ-AGVIKASVTIVFDNSDIKSSPIGFERY----PKISVTRQIALGGTSKYLI 117

Query: 262 NDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMK 301
           N        V  L +   +++++  FLI+QG++  +  MK
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGQITKVLNMK 157

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 62/94 (65%), Gaps = 1/94 (1%)

Query: 1312 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1370
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLNHTQNIGHLIKTRFKG 1136

Query: 1371 AQFIVISLRNNMFELAQQLVGIYKRDNKTKSATI 1404
            +QFIV+SL+  MF  A ++     +D  +  + I
Sbjct: 1137 SQFIVVSLKEGMFNNANRVFKTRFQDGTSAVSVI 1170

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
           chromosome segregation protein
          Length = 1170

 Score = 95.1 bits (235), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 88/160 (55%), Gaps = 8/160 (5%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 203
           +++LI+  FKSYA R V+  ++  F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 204 SDLIHKSEEYPSLPSCSVEVHFKYV--IDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYV 261
            DLI+K  +   +   SV + F      + P G +    E P + VTR+     TSKY +
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNTDKSNTPIGFS----EYPKISVTRQIVLGGTSKYLI 117

Query: 262 NDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMK 301
           N        V +L +   +++++  FLI+QG++  I  MK
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMK 157

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1312 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1370
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1371 AQFIVISLRNNMF 1383
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
           YFR031C
          Length = 1170

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/162 (33%), Positives = 87/162 (53%), Gaps = 8/162 (4%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 203
           I++LI+  FKSYA R V+  ++  F+A+ G NGSGKSN++D++ FV G  A   +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISAMTTVRASSL 62

Query: 204 SDLIHKSEEYPSLPSCSVEVHFKYV--IDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYV 261
            DLI+K  +   +   SV V F      + P G T        + VTR+     +SKY +
Sbjct: 63  QDLIYKRGQ-AGVTKASVTVVFDNSDKSNSPIGFTN----SAKISVTRQVMLGGSSKYLI 117

Query: 262 NDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSK 303
           N        V +L +   +++++  FLI+QG++  +  MK K
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPK 159

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 58/86 (67%)

Query: 1298 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1357
            +EG+ F V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  + 
Sbjct: 1064 TEGLEFKVRLGSIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHT 1123

Query: 1358 SIVANYIKERTKNAQFIVISLRNNMF 1383
              + + IK R K +QFIV+SL+  MF
Sbjct: 1124 QNIGHLIKTRFKGSQFIVVSLKEGMF 1149

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]
           {ON} Anc_1.295 YJL074C
          Length = 1229

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 160/725 (22%), Positives = 307/725 (42%), Gaps = 106/725 (14%)

Query: 143 LCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 202
           + I +++++ FK+Y    ++  F+   + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 203 LSDLIHKSEEYPSLPSCSVEVHF---KYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKY 259
              LIH+     ++ S SVE+ F    + I  PSG   +   + + V  R+        Y
Sbjct: 61  RQGLIHQGSG-GAVMSASVEIVFHDPNHKIILPSG---VVPRENDEVYIRRTVGLKKDDY 116

Query: 260 YVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXI 319
            +ND+    G+V ++L+  G  +++   ++ QG++  +   K K               +
Sbjct: 117 QLNDRNVTKGDVVRMLESTGFSMNNPYNIVPQGKIIALTNAKDK-------ERLNLLEDV 169

Query: 320 IGTAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLTV 379
           +G   ++  ++ +L  M+       E E +   +D E N L +  +E    +  ERK   
Sbjct: 170 VGAKSFELKLKASLKKMD-------ETEQKRNQIDMEMNELNSKLKE----MNQERK--- 215

Query: 380 SKSKLYQYHILNSNMK----------LKNTLDKITNLNQKLEKESDKNASVKKELDKLRA 429
              +L +++ L+ N K          L + + +I NL+       D +    KELDK   
Sbjct: 216 ---ELEKFNSLDKNRKVFQFTLYDRELNDIITQIENLDGDYNSTVDSSEKYIKELDKREN 272

Query: 430 FGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISS 489
              EL  KL   ++  K  +    +L      N E + N           L+++D  I  
Sbjct: 273 IISELTKKLTEIDSSLK--IKTTNDLQIAKANNSEILNN-----------LTNLDVQIKD 319

Query: 490 SEARL-SELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELE 548
            + +L ++ +Q   D  N L+ +N++ E  ++KL KI    +  TN         E   +
Sbjct: 320 LKLQLETQNEQTNSDKSN-LELINKEIESRRLKLSKISPRFQQLTNE--------ESRFK 370

Query: 549 PWNAQLQEKKTQIQLAESQISLIKEAEAK------LAQEIDQFKQEI-ETRKQQILQGSK 601
             +  L+E++  + L + + S    A+ +        +E++Q +Q + +T+ +  ++  +
Sbjct: 371 LQSNTLKERQRDLLLKKGRYSRFHTAQERNEWIENEIKELNQLQQSLNDTKTKNKIEKDE 430

Query: 602 ELDSLHSQHKSVKEEISTGEKECLNARIR-LKEMQNILNTQRQKALDARSALSNAENKSK 660
             + +++  + ++E   + +   +NA +  L+   + +  Q   ++D R  L   E K +
Sbjct: 431 VAERINTIDEEIQELNDSIQGPSINAELEDLESNIDDIKQQYNSSIDQRKELWRNEQKLE 490

Query: 661 VL--TALSRLQKSGRISG---------------------------FHGRLGDLGVIDEKY 691
            +  T L  ++ S R  G                             G LG+L  ++ KY
Sbjct: 491 TVLQTILDNVKDSERAVGETMDRSLANGLKSVKEIAEKLKLPEDSVFGTLGELVSVNSKY 550

Query: 692 DVAIST-ACPRLEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESV 750
                      L  ++V+T E   + ++ L + K G   FI L+K+  F+      PE  
Sbjct: 551 KTCAEVIGGNSLFHVIVDTEETASKIMKELYRMKGGRVTFIPLNKVY-FDNSITFPPEDQ 609

Query: 751 PRLFDLIH--PKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISG 808
                LI     D KF  A   V G T+V  DL    ++A  K +   +TLDG+  D  G
Sbjct: 610 SSYTPLIKKIKYDEKFDKAVKHVFGKTIVVKDLSTGLKLA-KKYKLSAITLDGDRADKRG 668

Query: 809 TMSGG 813
            ++GG
Sbjct: 669 VLTGG 673

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 68/117 (58%), Gaps = 5/117 (4%)

Query: 1294 LDPFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1351
            ++P   GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1099 IEPIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1158

Query: 1352 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNID 1408
            LD +  + VA  I++ + NAQFI  + R +M E+A     + K +NK   +T+  ID
Sbjct: 1159 LDKQYRTSVAKLIEKLSANAQFICTTFRTDMLEVADTFFRV-KYENKI--STVIEID 1212

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
           (REAL)
          Length = 1230

 Score = 93.6 bits (231), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 169/721 (23%), Positives = 314/721 (43%), Gaps = 96/721 (13%)

Query: 143 LCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 202
           + I +++++ FK+Y    ++  F+   + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 203 LSDLIHKSEEYPSLPSCSVEVHFK---YVIDEPSGE-TRIDEEKPNLVVTRKAFRNNTSK 258
              LIH+     S+ S SVE+ F    + +  PSG  +R D+E    V  R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 259 YYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXX 318
           Y +ND+    G++ ++L+  G  + +   ++ QG++  +   K K               
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMTNPYNIVPQGKIVALTNAKDK-------ERLQLLED 168

Query: 319 IIGTAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLT 378
           ++G   ++  ++ +L  ME      I+       ++ + + +E  +EE   + E ER   
Sbjct: 169 VVGAKSFEVKLKASLKKMEETEQKKIQISKEMDELNSKLSEMEQEREELEKYNELERNRK 228

Query: 379 VSKSKLYQYH---ILNSNMKL----KNTLDKITNLNQKLEKESDKNASVKKELDKLRAF- 430
           + +  LY      ++N   +L     NT+       Q+L+K  D    V K L  + A  
Sbjct: 229 IYQFTLYDRELNDVINQMERLDGDYNNTVHSSEQYIQELDKREDMIGQVSKNLSNIEASL 288

Query: 431 --------------GDELESKLKNCNNEEKQLL------GKKRELDGKNVLNEEKIKNFE 470
                           E+   L N N + K +       G++R LDG  +   +++K+  
Sbjct: 289 KIKNTTDLPQAKLRESEISQNLTNINVKIKDVQLQIESNGEQRNLDGATL---KEVKSII 345

Query: 471 KKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNE-QTEVEKMKLEKIKFSL 529
           K+R +           +S    R  EL + +  Y+  L  L + Q ++   K E  +F  
Sbjct: 346 KQRQQ----------KLSKILPRYQELTKEEAMYKLHLASLQQKQRDLIFKKGEYARFKS 395

Query: 530 KDKTNG-ISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQE 588
           K++ N  I  EI +LE  ++  N    E  +++Q+  +    +KE  +KL +EI+     
Sbjct: 396 KEERNAWIYSEIEELESSMQNLN----ELGSKLQMDRTS---LKEQYSKLDEEIEDLADS 448

Query: 589 IETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRL----KEMQNILNT---- 640
           I       ++G  +L+   S+  ++K+ ++    E L+ R  L    +++Q IL T    
Sbjct: 449 INGPD---IKG--QLEDFDSELINLKQRLN----ESLDTRKELWRKEQKLQTILETLLSD 499

Query: 641 --QRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYD-VAIST 697
             Q Q+ ++   + S A     V     +L+ S       G LG+L  +++KY   A   
Sbjct: 500 VNQNQRNVNETMSRSLANGIINVKEITEKLKISP--ESVFGTLGELIKVNDKYKACAEVV 557

Query: 698 ACPRLEDIVVETVECGQQCIEYLRKNKLGYARFILLDKL-----RKFNLDSINTPESVPR 752
               L  IVV+T E     +  L + K G   FI L++L      KF  ++    +  P 
Sbjct: 558 GGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLFLDSDVKFPSNTTTQIQFTPL 617

Query: 753 LFDLIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSG 812
           +  + +   P+F  A   V G T+V  +L Q  ++A  K +   +TLDG+  D  G ++G
Sbjct: 618 IKKIKYQ--PRFEKAVKHVFGKTIVVKELGQGLKLA-KKHKLNAITLDGDRADKRGLLTG 674

Query: 813 G 813
           G
Sbjct: 675 G 675

 Score = 72.0 bits (175), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 61/105 (58%), Gaps = 3/105 (2%)

Query: 1300 GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1357
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1358 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSA 1402
            + VA  IKE + +AQFI  + R +M ++A +   + K +NK  + 
Sbjct: 1166 TAVATLIKELSNDAQFICTTFRTDMLQVADKFFRV-KYENKISTV 1209

>Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON}
           (46233..49748) [3516 nt, 1172 aa]
          Length = 1171

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 86/160 (53%), Gaps = 8/160 (5%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 203
           +++LI+  FKSYA R V+  ++  F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 204 SDLIHKSEEYPSLPSCSVEVHFKYV--IDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYV 261
            DLI+K  +   +   SV + F      + P G     E  P + VTR+     TSKY +
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNSDKSNAPIG----FESSPTISVTRQVALGGTSKYLI 117

Query: 262 NDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMK 301
           N        V  L +   +++++  FLI+QG++  +  MK
Sbjct: 118 NGHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMK 157

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1312 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1370
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1371 AQFIVISLRNNMF 1383
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
           YFR031C
          Length = 1171

 Score = 92.4 bits (228), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 86/162 (53%), Gaps = 8/162 (4%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 203
           +++LI+  FKSYA R V+  ++  F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGITSMTTVRASNL 62

Query: 204 SDLIHKSEEYPSLPSCSVEVHFKYV--IDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYV 261
            DLI+K  +   +   SV + F      + P G          + VTR+     TSKY +
Sbjct: 63  QDLIYKRGQ-AGITKASVTIVFDNTDKTNSPIGFNN----SAKISVTRQVVLGGTSKYLI 117

Query: 262 NDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSK 303
           N        V +L +   +++++  FLI+QG++  +  MK K
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPK 159

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1312 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1370
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1078 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1137

Query: 1371 AQFIVISLRNNMFELAQQL 1389
            +QFIV+SL+  MF  A ++
Sbjct: 1138 SQFIVVSLKEGMFSNANRV 1156

>SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa]
           {ON} similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074C SMC3 Subunit of the multiprotein cohesin complex
           required for sister chromatid cohesion in mitotic cells
           also required with Rec8p for cohesion and recombination
           during meiosis phylogenetically conserved SMC
           chromosomal ATPase family member
          Length = 1229

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 193/809 (23%), Positives = 346/809 (42%), Gaps = 100/809 (12%)

Query: 143 LCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 202
           + I ++ +Q FK+Y    ++  F+   + V+G NGSGKSN   ++ FV     N ++++ 
Sbjct: 1   MYIKRVTIQGFKTYKNTTLIDNFSPHHNVVIGSNGSGKSNFFAAIRFVLSDDYNNLKREE 60

Query: 203 LSDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGE---TRIDEEKPNLVVTRKAFRNNTSKY 259
              LIH+     S+ S  VE+    V D   G           P+ VV R+       +Y
Sbjct: 61  RQGLIHQGS--GSVMSAYVEI----VFDNSDGRLLNAAASPSSPDEVVIRRTIGLKKDEY 114

Query: 260 YVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXI 319
            +N +  +  E+  LL+  G    +  +++ QG +  +   K                 +
Sbjct: 115 SLNSKSCSKIEIKNLLESAGFSTANPYYIVPQGRIVALTNAKD-------YERLQLLKEV 167

Query: 320 IGTAKYKPLIEKNLADMESLNDICIEKENRFQI------VDREKNSLENGKEEALLFLEN 373
            G   +    EK L D  SLN +     NR +I      +D +   L   +EE   +   
Sbjct: 168 TGANSF----EKKLRD--SLNKMDATNRNRKKIDSELRELDEKLQELNEEREELEKYNAL 221

Query: 374 ERKLTVSKSKLYQY-------HILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELD- 425
           ER   V +  LY         HI   + +  NT+D      Q+++K     ++V K L  
Sbjct: 222 ERDRKVFQFTLYDRELNDVTNHIEKLDSEYNNTVDSSEQYVQEMDKREVLISNVTKNLVN 281

Query: 426 -----KLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTL 480
                K++   D  +SK    + EE     KK +LD K    + +I++  ++    E  L
Sbjct: 282 IDAELKIKKSTDLEQSKANQLDVEE-----KKADLDVKCEELQRQIRSTSEQAKTDESNL 336

Query: 481 SSMDRSISSSEA-------RLSELKQLQVDYENSLKELNE-QTEVEKMKLEKIKFSLKDK 532
           +S+   IS  E        R  EL + +  ++  L+ L + Q ++   +    +F  +++
Sbjct: 337 ASVLNDISRKETQIKRISPRFEELTREEHQFKTDLELLQQKQRDLLAKRGRYAQFKTQEE 396

Query: 533 TNG-ISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIET 591
            NG I  EIA L++E +   +  QE      L++ +  L    + +LA E+D+  +E+  
Sbjct: 397 RNGWIQSEIADLKQEAQILESTYQE------LSQERSDL----QEQLA-ELDEQAKELND 445

Query: 592 RKQQILQG---SKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKALDA 648
                +QG   + EL+ L+S+   +K+  +T   E        +++Q IL T       +
Sbjct: 446 S----IQGPGITAELEDLNSEISQLKQLYTTKIDERKELWRSEQKLQTILETLMDDVKRS 501

Query: 649 RSALSNAENKSKV--LTALSRLQKSGRI--SGFHGRLGDLGVIDEKYDVAISTACPR-LE 703
             +++   ++S    L A+  + +  ++  +  +G LG+L  ++EKY     T     L 
Sbjct: 502 ERSVNETMDRSLANGLKAVREISERLKLPENAVYGPLGELIKVNEKYKTCAETVGGNSLF 561

Query: 704 DIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPK--- 760
            +VV+T +     ++ L   K G   F+ L++L   N  ++  P +       +  K   
Sbjct: 562 HVVVDTEDTAGLLMQELYNVKGGRVTFMPLNRLHADN--NVTYPSNEQSNCTALIKKIKY 619

Query: 761 DPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGG------G 814
           D KF  A   V G T+V  DL    ++A   K    +TLDG+  D  G ++GG       
Sbjct: 620 DEKFERAVKHVFGKTIVVRDLTLGTKLARQYK-LNAITLDGDRADKRGVLTGGYHDHHKK 678

Query: 815 SRVSRGLMQINRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEK 874
           +R+   L  +   KTE    YS+  V+Q    L   +K   V  D + Q+  ++K    K
Sbjct: 679 TRLD-SLKDLKHAKTE----YST--VSQ---KLNSLKKQLHVVDDEVDQLNNKIKQATTK 728

Query: 875 EPAIENNISQLTMEIESWNSEIKIKEIQM 903
           + +I  +I  L   + +  +EI ++E  M
Sbjct: 729 KESIMVDIEGLRSRLNNRKNEIYLREDSM 757

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 58/94 (61%), Gaps = 2/94 (2%)

Query: 1295 DPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1352
            D    GV+ SV     +    ++  LSGG+KT+ ++AL+ A+ K  P P Y+ DEIDAAL
Sbjct: 1098 DIVYTGVSISVSFNSRQDEQLHVEQLSGGQKTVCAIALILAIQKVDPAPFYLFDEIDAAL 1157

Query: 1353 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1386
            D +  + VAN IKE + NAQFI  + R++M  +A
Sbjct: 1158 DKQYRTSVANTIKELSANAQFICTTFRSDMLRVA 1191

>KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 87.8 bits (216), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 86/162 (53%), Gaps = 8/162 (4%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 203
           +++LI+  FKSYA R V+  ++  F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQNL 62

Query: 204 SDLIHKSEEYPSLPSCSVEVHFKY--VIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYV 261
            DLI+K  +   +   SV + F      + P G     E    + +TR+      SKY +
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFNNSDTSNSPIG----FESHAKISITRQIILGGVSKYLI 117

Query: 262 NDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSK 303
           N        V +L +   +++++  FLI+QG++  +  MK +
Sbjct: 118 NGHRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQ 159

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 55/75 (73%), Gaps = 1/75 (1%)

Query: 1310 KSWR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1368
            K W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 KIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1369 KNAQFIVISLRNNMF 1383
            K +QFIV+SL+  MF
Sbjct: 1135 KGSQFIVVSLKEGMF 1149

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 87.4 bits (215), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 86/161 (53%), Gaps = 10/161 (6%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 203
           + +LI+  FKSYA R V+  ++  F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VAELIIDGFKSYATRTVISEWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 204 SDLIHKSEEYPSLPSCSVEVHFKYV--IDEPSG-ETRIDEEKPNLVVTRKAFRNNTSKYY 260
            DLI+K  +   +   SV + F        P G ET +      + VTR+     TSKY 
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNSDKSKAPIGFETSL-----TISVTRQIVLGGTSKYL 116

Query: 261 VNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMK 301
           +N        V  L +   +++++  FLI+QG++  +  MK
Sbjct: 117 INGHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMK 157

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 58/81 (71%), Gaps = 1/81 (1%)

Query: 1310 KSWR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1368
            K W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 KLWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1369 KNAQFIVISLRNNMFELAQQL 1389
            K +QFIV+SL+  MF  A ++
Sbjct: 1135 KGSQFIVVSLKEGMFNNANRV 1155

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1227

 Score = 87.0 bits (214), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 169/725 (23%), Positives = 325/725 (44%), Gaps = 105/725 (14%)

Query: 143 LCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 202
           + I +++++ FK+Y  + V+  F+   + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 203 LSDLIHKSEEYPSLPSCSVEVHF-----KYVIDEPSGETRIDEEKPNLVVTRKAFRNNTS 257
              LIH+     S+ S SVE+ F     K ++  PSG   +  E  + +  R+       
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPEHKMIL--PSG--VVPRENNDEICIRRTVGLKKD 115

Query: 258 KYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXX 317
            Y +ND+    G+V ++L+  G  + +   ++ QG++ ++   K K              
Sbjct: 116 DYQLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDK-------ERLQLLE 168

Query: 318 XIIGTAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKL 377
            ++G   ++  ++ +L  ME       E E +   + +E + L +  +E    +E ERK 
Sbjct: 169 DVVGAKSFEVKLKASLKKME-------ETEQKRARIAKEMDELNSKLKE----MEQERK- 216

Query: 378 TVSKSKLYQYHILNSNMKL------KNTLDKITNLNQKLEKESDKNASVK----KELDK- 426
                +L +Y+ L  N K+         L+ I N  ++L+ + +  A+      KELDK 
Sbjct: 217 -----ELEKYNALEKNRKVFQFTLYDRELNDIINQVERLDDDYNVTANSSEQYIKELDKR 271

Query: 427 ------LRAFGDELESKLK-NCNNEEKQLLGKKRELDGKNVLNEEKIKNF-------EKK 472
                 +     E++S LK     +  Q   +  EL  +    + +IK+        E++
Sbjct: 272 EEIISNISKNLSEIDSTLKIKTTTDLPQAKSRHSELTNQLTNLQVQIKDLKLQIKAQERQ 331

Query: 473 RDKAEKTLSSMDRSISSSEARLS-------ELKQLQVDYE---NSLKELNEQTEVEKMKL 522
            +  +KTL  ++  I   E +LS       EL + ++ ++   N L++      ++K + 
Sbjct: 332 ANSDQKTLDIINDEIQKREQKLSSISPKFQELSKEELKFKLQYNKLQQRQRDLLLKKGRY 391

Query: 523 EKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEI 582
            +   S++++   I  EI + +K L+     L + K +I +   +I+        L ++I
Sbjct: 392 ARFA-SIEERNEWIQNEIEESDKTLQG----LVDIKNKILIERDEIN---SKVRSLDEDI 443

Query: 583 DQFKQEIE----TRKQQILQGSKELDSLHSQHKSV---KEEISTGEKECLNARIRLKEMQ 635
           D     IE    T + +++Q   EL+ L S++ +    ++E+   E++       L E  
Sbjct: 444 DNLNDSIEGPNVTGELEVIQD--ELEKLKSEYAASIDKRKELWRNEQKIETVLQNLLENV 501

Query: 636 NILNTQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAI 695
            +L     + +D RS  +  ++  ++ T L   + S  + G  G L +   ++EKY +  
Sbjct: 502 KVLERNVNETMD-RSLANGIKSVKEIATKLKLPEDS--VFGTLGELIN---VNEKYKICA 555

Query: 696 STACPR-LEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDS-INTPESVPRL 753
                  L  IVV+T E     ++ L K K G   FI L+++    LD+ I  P +    
Sbjct: 556 EVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPLNRIY---LDANIQYPPNDQTS 612

Query: 754 FDLIHPK---DPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRV--VTLDGNLIDISG 808
           F  +  K   D +F  A   + G T+V  DL    R++   K+F++  +TLDG+  D  G
Sbjct: 613 FTPLINKIKYDQRFDKAVRHIFGKTIVVKDLTTGLRIS---KKFKLNSITLDGDRADKRG 669

Query: 809 TMSGG 813
            ++GG
Sbjct: 670 VLTGG 674

 Score = 79.0 bits (193), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 68/116 (58%), Gaps = 3/116 (2%)

Query: 1289 ELVDTLDPFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1346
            E+++  +    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ D
Sbjct: 1092 EVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFD 1151

Query: 1347 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSA 1402
            EIDAALD +  + VAN IK+ + NAQFI  + R +M ++A +   + K +NK  + 
Sbjct: 1152 EIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRV-KYENKISTV 1206

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1227

 Score = 84.3 bits (207), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 66/109 (60%), Gaps = 3/109 (2%)

Query: 1296 PFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1353
            P   GV+ SV    K+    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD
Sbjct: 1099 PMYTGVSISVSFNSKNDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1158

Query: 1354 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSA 1402
             +  + VAN +KE +KNAQFI  + R +M ++A +   + K +NK  S 
Sbjct: 1159 KQYRTAVANTLKELSKNAQFICTTFRTDMLQVADKFFRV-KYENKISSV 1206

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 81/168 (48%), Gaps = 11/168 (6%)

Query: 143 LCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 202
           + I ++I++ FK+Y    ++  F+   + ++G NGSGKSN+  ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHHNIIIGSNGSGKSNLFAAIRFVLSDDYSNLKREE 60

Query: 203 LSDLIHK-SEEYPSLPSCSVEVHFKYVIDEP------SGETRIDEEKPNLVVTRKAFRNN 255
              LIH+ +    S+ SCSVE+ F     +P      +    I     N V  R+     
Sbjct: 61  RQGLIHQGTSGGSSVMSCSVEIVFH----DPDNRMILASNASIVPRPNNEVFIRRTVGLK 116

Query: 256 TSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSK 303
              Y +ND+     ++ ++L+  G  + +   ++ QG++  +   K K
Sbjct: 117 KDDYQINDRNVTKSDIVRILETAGFSMSNPYNIVPQGKIIALTNAKDK 164

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 73/118 (61%), Gaps = 5/118 (4%)

Query: 1293 TLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1350
            +++    GV+ SV     K   +++  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDA
Sbjct: 1096 SVEAMYSGVSISVSFNSKKNEQQHVEQLSGGQKTVCAVALILAIQMVEPAPFYLFDEIDA 1155

Query: 1351 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNID 1408
            ALD +  + VA+ IKE ++NAQFI  + R++M E+A +    Y+   + K +T+  +D
Sbjct: 1156 ALDKQYRTAVASTIKELSENAQFICTTFRSDMLEVADKF---YRVKYENKISTVIEVD 1210

 Score = 63.5 bits (153), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 79/164 (48%), Gaps = 8/164 (4%)

Query: 143 LCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 202
           + I +++++ FK+Y    ++  F+   + V+G NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIRRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSNDYANLKREE 60

Query: 203 LSDLIHKSEEYPSLPSCSVEVHF---KYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKY 259
              LIH+     S+ S SVE+ F    + I  PSG   I   + + V  R+        Y
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFHDPSHRIILPSG---IPPRENDEVFVRRTVGLKKDDY 115

Query: 260 YVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSK 303
            +ND+     +V ++L+  G  + +   ++ QG +  +   K +
Sbjct: 116 QLNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIVALTNAKDR 159

 Score = 46.2 bits (108), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 110/463 (23%), Positives = 188/463 (40%), Gaps = 86/463 (18%)

Query: 679  GRLGDLGVIDEKYD-VAISTACPRLEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLR 737
            G LG+L  +++KY   A       L  IVV+T E     I+ L + K G   F+ L+++ 
Sbjct: 537  GTLGELIKVNDKYKKCAEVVGGNSLFHIVVDTDETASLIIQELYRMKGGRVTFLPLNRV- 595

Query: 738  KFNLDSINTPE----SVPRLFDLIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKKR 793
             ++  +I  P     S   L   I   D +F  A   V G T+V  DL    R+A   KR
Sbjct: 596  -YSDPNITYPPNEQASCTPLIKKIR-YDARFEKAVKQVFGKTIVVRDLSTGARLA---KR 650

Query: 794  FRV--VTLDGNLIDISGTMSGG-----------------------GSRVSRGLMQINRNK 828
            FR+  +TLDG+  D  G ++GG                        S VS   +++ R K
Sbjct: 651  FRLNAITLDGDRADKKGALTGGYHDQHKKTRLDLLKKLKDSRSQYKSLVSE--LELMRQK 708

Query: 829  TEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTME 888
             +DI+  S + V     +L  + +      D+      +L + K ++  +E ++  L ++
Sbjct: 709  IQDIDA-SIDTVNGTTRSLSNKRETILTNMDS---WRAKLNNKKTEKIFLEESMQALIVK 764

Query: 889  IESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQ-HVQSLKDEFKSIQNQTKSKKHR 947
             E   + I++ E ++  S      +QD + EL    Q  +++LK     IQN+       
Sbjct: 765  AEKTETNIRVSEEKI--STYLEELSQDFDNELSRAKQAELENLKSSILDIQNKLYMTSEA 822

Query: 948  IETLKNEIMEIGGA----------ELKIQSSK--------VDSVIQRIDIVVSKQKKERS 989
            +E L N I  +             ELK + ++        + S +Q + IV +    +  
Sbjct: 823  LEGLTNNIDSLNATLNSKLIPQQKELKAKLAETGDSFIAGLKSEVQSMLIVKTTLDNQLE 882

Query: 990  V----IKKTENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQH 1045
            +    +   + EI    + K  + + LE  N +  +L   +E  Q    K     T++  
Sbjct: 883  ISNEELSGIQEEIKNMSERKKNSEKSLEKANSQQASLLKKLETFQKDAEKSMVKKTTLAA 942

Query: 1046 TKE---------GLIEE----------SRTLEDKLNDINEDIA 1069
             +E         GL+ E          S  L  +LN +NEDI+
Sbjct: 943  RREELQQKIREVGLLAEEALNSFNNLSSGELLQRLNSVNEDIS 985

>Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {ON}
            YJL074C (SMC3) - SMC chromosomal ATPase family member
            [contig 224] FULL
          Length = 1247

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 67/116 (57%), Gaps = 2/116 (1%)

Query: 1291 VDTLDPFSEGVTFSVMPPKKSWRN--ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1348
             DTLD    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEI
Sbjct: 1114 ADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEI 1173

Query: 1349 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATI 1404
            DAALD +  + VAN IKE + +AQFI  + R +M ++A     +   +  ++ AT+
Sbjct: 1174 DAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVADSFYRVKFENKISEIATV 1229

 Score = 62.4 bits (150), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 77/161 (47%), Gaps = 2/161 (1%)

Query: 143 LCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 202
           + I  +++Q FK+Y     V  F+  F+ V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 25  MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84

Query: 203 LSDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVN 262
              LIH+     S+ S  VE+ F    D+    + I   + ++V  R+       +Y VN
Sbjct: 85  RQGLIHQG--TGSIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKDEYSVN 142

Query: 263 DQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSK 303
            +  +  +++++ +  G    +   ++ QG +  +   K K
Sbjct: 143 GKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDK 183

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 172/717 (23%), Positives = 327/717 (45%), Gaps = 95/717 (13%)

Query: 143 LCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 202
           + I ++I++ FK+Y  +  +  F+   + VVG NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 203 LSDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVN 262
              LI++     S+ S  VE+ F          T +  +   ++  R+       +Y +N
Sbjct: 61  RRSLIYQG--TSSVMSGYVEIVFHGA----ENRTLLGAQDGGVIHIRRTVGLKKDEYMIN 114

Query: 263 DQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGT 322
           ++  +  +V +LL+  G    +   ++ QG + ++   +++               +IG 
Sbjct: 115 NKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNR-------ERLQLLEEVIGA 167

Query: 323 AKYKPLIEKNLADMESL----NDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLT 378
             ++  ++++L  ME+       I IE E     V+ + N L+  ++E   +   +RK  
Sbjct: 168 KSFERKLKESLQKMETTEKNREKIRIELEE----VEAKLNELDEERKELEKYNSLDRKRK 223

Query: 379 VSKSKLYQYHILNSNMKLKNTLD-KITN---LNQKLEKESDKNASVKKELDK-LRAFGDE 433
           + +  LY    LN    +   LD + TN   L+++  +E +K  S+ + L K L   G E
Sbjct: 224 MCQFALYDRE-LNEVTSMVEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSLNQLGSE 282

Query: 434 LESK----LKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISS 489
           L+ K    L+   + E +L    + L   NV  EE I      ++ A K     ++S S+
Sbjct: 283 LKMKESTDLQQAKDSELEL---AKHLADLNVKYEELI-----SQNNALK-----EQSASN 329

Query: 490 SEARLSELKQLQVDYENSLKELN---EQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKE 546
           SE+ L+   Q+ V  E  L  L+   EQ  +E+  ++    +L+ +   +   +A+  K 
Sbjct: 330 SESLLAIRSQIAVK-EQQLARLSPRFEQLTIEEAAMKAEFKALQQRQRDL---LAKRGK- 384

Query: 547 LEPWNAQLQEKKTQIQLAESQISLIKE-------AEAKLAQEIDQFKQEIETRKQQI--L 597
                +Q + K  +    + ++S++KE       A   +++E D  + ++ T   QI  L
Sbjct: 385 ----YSQFRNKAERDAWIDQELSILKEELQCSSIALTSISEERDSLRIKLTTLDDQIMEL 440

Query: 598 QGSKELDSLHSQHKSVKEEISTGEKECL---NARIRL----KEMQNILNTQRQKALDARS 650
             S     ++++ + V++E++  +K  L   + R +L    +++Q++L +       A  
Sbjct: 441 NDSAHGPGINAELEDVQQELTVLKKAHLFKIDERKQLWRSEQKIQSVLESLVDDVKRAEG 500

Query: 651 ALSNAENKSKVLTALSRLQK-SGRIS----GFHGRLGDLGVIDEKYD-VAISTACPRLED 704
            LS   ++S + T L  + + + R++       G LG+L  I EKY   A       L  
Sbjct: 501 TLSETMDRS-LATGLKNVSEIAQRLNLPEGSVFGPLGELIKISEKYKACAEVVGGTSLFH 559

Query: 705 IVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDS-INTP-----ESVPRLFDLIH 758
           +VV+T       ++ L  +K G   FI L+++   ++DS I  P        P +  + +
Sbjct: 560 VVVDTENTAALLMQELYNSKGGRVTFIPLNRV---HVDSNIVYPSNDEHHCTPLIKKIKY 616

Query: 759 PKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRV--VTLDGNLIDISGTMSGG 813
             DPKF  A   V G T+V  DL Q  ++A   K+FR+  +TLDG+  D  G ++GG
Sbjct: 617 --DPKFERAIKHVFGKTIVVKDLNQGTKLA---KQFRLNAITLDGDKADSRGVLTGG 668

 Score = 72.0 bits (175), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 62/112 (55%), Gaps = 5/112 (4%)

Query: 1295 DPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1352
            D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAAL
Sbjct: 1101 DSIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAAL 1160

Query: 1353 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATI 1404
            D +  + VA  +K+ +  AQFI  + R +M  +A +    Y+ + + K +T+
Sbjct: 1161 DKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVADRF---YRVNFENKISTV 1209

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1174

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1312 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1370
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1081 WKESLVELSGGQRSLVALSLILALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1140

Query: 1371 AQFIVISLRNNMFELAQQL 1389
            AQFIV+SL+  MF  A ++
Sbjct: 1141 AQFIVVSLKEGMFTNANRV 1159

 Score = 52.8 bits (125), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 82/310 (26%), Positives = 139/310 (44%), Gaps = 68/310 (21%)

Query: 697 TACPRLEDIVVETVECGQQCIEYLRKNKLGYARFILLDKL--RKFNLDSIN-----TPES 749
            A  RL ++VV+      Q +E  R  K      I L+K+  R+ N +++N      P  
Sbjct: 551 CAGGRLYNVVVDNETTASQLLEKGRLRK--RVTIIPLNKIASRRLNENTVNFAKQLAPGK 608

Query: 750 VPRLFDLIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKK-RFRVVTLDGNLIDISG 808
           V    +LI   D + S A   + G +L+  D + A +V + +  R R +TL+G++ D  G
Sbjct: 609 VDLALNLIGYSD-ELSRAMEFIFGTSLICKDSETAKKVTFHQNIRQRSITLEGDVYDPEG 667

Query: 809 TMSGGGSRVSRG--LMQI-NRNKT-------------------EDIEIYSSEEVAQLEVN 846
           T+S GGSR ++   L+ I + NKT                   E  +IYS+ +V Q ++N
Sbjct: 668 TLS-GGSRNNKNSLLLDIQHYNKTCNEIKILEENLRDIKIKLNEQEKIYSASKVIQNDLN 726

Query: 847 LVERE-----------------KNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEI 889
           L E +                 K  +  S  I   E  +   + K  +I+N+I Q+  +I
Sbjct: 727 LAEHKLAMAQRSVDSNQSTQLIKRNEAISLEIKSCENSITQEQNKLESIQNSIIQIEKDI 786

Query: 890 ESWNSE--IKIKEIQML-------------ESERAYSATQDNNVELRETIQHVQSLKDEF 934
             +N++   K+KE+Q               E E  Y + Q++ +E+ +    +Q L++  
Sbjct: 787 NEFNNDKGSKLKELQQEIKALSKKLSVKENEVENIYDSYQNDQLEIEQLSSDIQDLEE-- 844

Query: 935 KSIQNQTKSK 944
           KSI+N  K K
Sbjct: 845 KSIKNLKKLK 854

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1225

 Score = 80.1 bits (196), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 67/117 (57%), Gaps = 5/117 (4%)

Query: 1294 LDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1351
            L+    GV+ SV     K     +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1095 LESVYTGVSISVSFSSKKNEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1154

Query: 1352 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNID 1408
            LD +  + VAN IK+ +KNAQFI  + R +M  +A +    Y+   + K +TI  I+
Sbjct: 1155 LDKQYRTSVANAIKKLSKNAQFICTTFRTDMLAVADRF---YRVKYENKISTIIEIN 1208

 Score = 59.3 bits (142), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 76/171 (44%), Gaps = 22/171 (12%)

Query: 143 LCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 202
           + I +++++ FK+Y    ++  F+   + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 203 LSDLIHKSEEYPSLPSCSVEVHF----------KYVIDEPSGETRIDEEKPNLVVTRKAF 252
              LIH+     S+ S SVE+ F            VI  P+ E          V  R+  
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFHDPDHRIILSSGVIPRPNDE----------VFVRRTV 108

Query: 253 RNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSK 303
                 Y +ND+     ++ ++L+  G  +     ++ QG +  +   K K
Sbjct: 109 GLKKDDYQINDRNVTKSDLVRMLESAGFSMGSPYNIVPQGRIIALTNAKDK 159

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1223

 Score = 79.0 bits (193), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 66/111 (59%), Gaps = 5/111 (4%)

Query: 1300 GVTFSVMPPKKSWR--NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1357
            GV+ SV    K  R  ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  
Sbjct: 1099 GVSISVSFNSKKTRQLHVEQLSGGQKTVCAVALILAIQMVDPAPFYLFDEIDAALDKQYR 1158

Query: 1358 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNID 1408
            + VA  IK  + NAQFI  + R +M ++A +   + K +NK   +T+  +D
Sbjct: 1159 TAVAGIIKALSANAQFICTTFRTDMLQVADKFFRV-KYENKI--STVVEVD 1206

 Score = 57.4 bits (137), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 88/184 (47%), Gaps = 11/184 (5%)

Query: 634 MQNILNTQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDV 693
           +  + N++R  +     +L+N     + +T   RL + GR+    G LG+L  ++EKY +
Sbjct: 496 LDTVKNSERSVSETMAKSLANGIASVREITEKLRLPE-GRV---FGTLGELIKVNEKYKM 551

Query: 694 AISTACPR-LEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPR 752
                    L  IVV+T E     I+ L + + G   F+ L+++  +N  +I  P +   
Sbjct: 552 CAEVVGGNSLFHIVVDTDETASLMIQELYRMRGGRVTFMPLNRI--YNDPNITYPPNAQS 609

Query: 753 LFDLIHPK---DPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGT 809
               +  K   D +F S   +V G T+V  DL   +++A   K    +TLDG+  D SG 
Sbjct: 610 SCTPLIKKIKFDAQFESVVKNVFGKTIVVRDLAAGSKIAKHYK-LDAITLDGDRADKSGL 668

Query: 810 MSGG 813
           ++GG
Sbjct: 669 LTGG 672

 Score = 33.5 bits (75), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 60/263 (22%), Positives = 127/263 (48%), Gaps = 30/263 (11%)

Query: 387 YHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEK 446
           YH  +   +L+ +L  + N   + +K SD+   +++++    A  D +  +++  +N+ +
Sbjct: 673 YHEHHKKTRLE-SLKDLKNARTQYKKTSDELEQIRQKIHTADAEIDSMNGQIRVASNKRE 731

Query: 447 QLL----GKKRELDGK---NVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQ 499
            +L    G + +L+ K    +  EE  K+ E KR+KAE ++  +   I S    L+   +
Sbjct: 732 TILTNVDGFRTKLNNKLSEKLFLEESAKSLELKREKAETSIKVVQAKIDSYTLDLTSEFE 791

Query: 500 LQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEI----AQLEKELEPWNAQLQ 555
            Q+  +   KELN+  E+   K++K   +  +   GI+ +I    A+L  +L P  ++LQ
Sbjct: 792 TQISAQKQ-KELND-LEITLQKVQKNLNTTTEALQGITTKIDSLTAELNSKLLPQKSELQ 849

Query: 556 EKKTQ--------------IQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSK 601
             K Q              + +++ Q  L K+ E+   +E+D+ + E+E  K +  +   
Sbjct: 850 ASKHQDGDVLVADLKSDLELMISDKQ-GLEKQFESS-GKEVDELQTELEGLKAEKGKNES 907

Query: 602 ELDSLHSQHKSVKEEISTGEKEC 624
            L+  +SQ   + +++ T +K+ 
Sbjct: 908 LLEKANSQQAQLLKKLETFQKDA 930

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
            complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 76.6 bits (187), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 62/106 (58%), Gaps = 3/106 (2%)

Query: 1300 GVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1357
            G++ SV     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  
Sbjct: 1087 GISISVSFNSKKNEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYR 1146

Query: 1358 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSAT 1403
            + VA+ IK  + NAQFI  + R +M ++A +   + K +NK  +  
Sbjct: 1147 AAVADVIKSLSGNAQFICTTFRTDMLQVADKFFRV-KYENKISTVV 1191

 Score = 66.6 bits (161), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 83/164 (50%), Gaps = 8/164 (4%)

Query: 143 LCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 202
           + I +++++ FK+Y    V+  F+ +++ V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIHRIVIKGFKTYRNETVIDFFSPNYNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 203 LSDLIHKSEEYPSLPSCSVEVHFK---YVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKY 259
              LIH+     S+ S SVE+ F+   + +  PSG   +   + + +  R+        Y
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFRDPGHRMILPSG---VVPRENDEIFIRRTVGLKKDDY 115

Query: 260 YVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSK 303
            VND+     +V ++L+  G  + +   ++ QG +  +   K K
Sbjct: 116 QVNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIIAVTNAKDK 159

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1216

 Score = 75.5 bits (184), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 64/111 (57%), Gaps = 3/111 (2%)

Query: 1300 GVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1357
            GV+ SV     +    ++  LSGG+KT+ ++A++ A+    P P Y+ DEIDAALD +  
Sbjct: 1092 GVSISVSFNSKRDEQLHVEQLSGGQKTVCAIAMILAIQMVDPAPFYLFDEIDAALDKQYR 1151

Query: 1358 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNID 1408
            + VA+ IK  + NAQFI  + R +M ++A +   + K +NK  +    N D
Sbjct: 1152 TAVADVIKSLSSNAQFICTTFRTDMLQVADKFFRV-KYENKISTVVEINRD 1201

 Score = 63.2 bits (152), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 80/166 (48%), Gaps = 12/166 (7%)

Query: 143 LCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 202
           + I ++I++ FK+Y    ++  F+  ++ ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIQKVIIKGFKTYRNETIIDDFSPHYNIIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 203 LSDLIHKSEEYPSLPSCSVEVHF-----KYVIDEPSGETRIDEEKPNLVVTRKAFRNNTS 257
              LIH+     S+ S SVE+ F       ++  PSG   +     + V  R+       
Sbjct: 61  RQGLIHQGS--GSVMSASVEIQFYDPGNSMIL--PSG---VAVNPDSTVSIRRTVGLKKD 113

Query: 258 KYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSK 303
            Y +ND+     ++ ++++  G  + +   ++ QG +  +   K K
Sbjct: 114 DYQINDRNVTKSDIVRMMESTGFSMSNPYNIVPQGRIVALTNAKDK 159

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 71/142 (50%), Gaps = 13/142 (9%)

Query: 679 GRLGDLGVIDEKYD-VAISTACPRLEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLR 737
           G LG+L  + EKY   A       L +IVV+T E     ++ L + K G   F+ L+++R
Sbjct: 537 GTLGELIKVSEKYKRCAEVIGGNSLFNIVVDTDETASLIMDELYRMKGGRVTFMPLNRIR 596

Query: 738 KFNLDSINT--PESVPRLFDLIHPK--DPKFSSAFFSVLGNTLVANDLKQANRVAYGKKR 793
              +DS  T  P        LI     D ++  A   V G T+V  DL + +++A   KR
Sbjct: 597 ---MDSNFTYPPNDQASCTPLIKKIKFDVRYEKAVMHVFGKTIVVKDLGEGSKLA---KR 650

Query: 794 FRV--VTLDGNLIDISGTMSGG 813
           F++  +TLDG+  D  G ++GG
Sbjct: 651 FKMNAITLDGDRADKRGELTGG 672

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074c SMC3 required for structural maintenance of
            chromosomes
          Length = 1219

 Score = 75.1 bits (183), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 63/109 (57%), Gaps = 4/109 (3%)

Query: 1296 PFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1353
            P+ EGV+ SV    K      +  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDAALD
Sbjct: 1092 PY-EGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALD 1150

Query: 1354 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSA 1402
             +    VA  I + + NAQFI  + R++M + A +   + K +NK  S 
Sbjct: 1151 KQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRV-KYENKQSSV 1198

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 83/172 (48%), Gaps = 22/172 (12%)

Query: 143 LCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 202
           + I ++I++ FK+Y    ++G F+   + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 203 LSDLIHKSEEYPSLPSCSVEVHF---KYVIDEPSG--------ETRIDEEKPNLVVTRKA 251
              LIH+     S+ S SVE+ F   ++ I  P+G        E RI          R+ 
Sbjct: 61  RQGLIHQG-AGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRI----------RRT 109

Query: 252 FRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSK 303
                  Y VND+    G++ ++L+  G  + +   ++ QG + ++   K K
Sbjct: 110 VGLKKDDYQVNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDK 161

>Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar to
            Ashbya gossypii AAL182W
          Length = 1232

 Score = 74.7 bits (182), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 61/104 (58%), Gaps = 3/104 (2%)

Query: 1300 GVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1359
            GV+F+    K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + 
Sbjct: 1105 GVSFN--SKKDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTA 1162

Query: 1360 VANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSAT 1403
            VA  IKE +  AQFI  + R++M  +A +   + K +NK  +  
Sbjct: 1163 VAATIKELSSEAQFICTTFRSDMIGIADKFYRV-KYENKISTVV 1205

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 163/728 (22%), Positives = 309/728 (42%), Gaps = 116/728 (15%)

Query: 143 LCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 202
           + I ++I+  FK+Y  +  +  F+   + VVG NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIRKVIISGFKTYKNKTEIDNFSAHHNVVVGLNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 203 LSDLIHKSEEYPSLPSCSVEVHFKYV-------IDEPSGETRIDEEKPNLVVTRKAFRNN 255
              LI++     S+ S  VE+ F          I + +G  RI          R+     
Sbjct: 61  RRSLIYQGT--SSVMSGYVEIVFHDAENRTLLGIPDSNGAIRI----------RRTVGLK 108

Query: 256 TSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXX 315
             +Y +N++ ++  +V +LL+  G    +   ++ QG + ++   K +            
Sbjct: 109 KDEYMINNKNSSRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAKDR-------ERLQL 161

Query: 316 XXXIIGTAKYKPLIEKNLADMESL----NDICIEKENRFQIVDREKNSLENGKEEALLFL 371
              ++G   ++  ++++L  M++       I IE     Q V+ + N L   +EE   + 
Sbjct: 162 LEEVVGAKSFERKLKESLQRMDATEKNREKIRIE----LQEVEDKLNELNEEREELETYN 217

Query: 372 ENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASVK----KELDKL 427
           E +R       K++Q+ + +        L++ITNL +KL+ E +    +     +ELDK 
Sbjct: 218 ELDR-----SRKMFQFTLYDRE------LNEITNLIEKLDGEYNNTLVLSEQYIEELDKR 266

Query: 428 RAFGDELESKLKNCNNE----EKQLLGKKRELDGK--------NVLNEE---KIKNFEKK 472
               + L  KL   N+E    E   L + ++ D +        +V NE+   + +  +++
Sbjct: 267 EILIESLNKKLNQTNSELKIKESTELQQAKDADAEVSKRLADLHVKNEDLKLQCQTIQQQ 326

Query: 473 RDKAEKTLSSMDRSISSS-------EARLSELKQLQVDYENSLKELNE-QTEVEKMKLEK 524
                + LSS++  I +        E R  EL + + + + +   L + Q ++   + + 
Sbjct: 327 SVTDSEMLSSINAQIEAKELQLKKFEPRFDELTKAESEMKANFISLQQRQRDLLSKRGKY 386

Query: 525 IKFSLKD-KTNGISLEIAQLEKELEPWNA---QLQEKKTQI-----QLAESQISLIKEAE 575
            KF  KD + + ++ EI  LE+ L    A    L+E++ +I      L E  + L+   +
Sbjct: 387 AKFKNKDERDSWLNQEILVLEEALASSKASRESLEEERAKIAADIAALDEQIVELMDYVQ 446

Query: 576 AK-LAQEIDQFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEM 634
              +  E++  + E+ + K+  L    E   L    + ++    T  +E   +   L E+
Sbjct: 447 GPGITAELEDLQNEVISMKKTYLSKIDERKGLWRTEQKLQSVFETLVEEVKRSEGNLNEI 506

Query: 635 QNILNTQRQKALDARSALSNAENKSKVLTALSRLQ-KSGRISGFHGRLGDLGVIDEKY-D 692
            +     R  A+  R+          V   + RL    G + G  G   +L  + EKY  
Sbjct: 507 MD-----RNLAIGLRN----------VTEIVQRLNLPEGSVFGPLG---ELIKVSEKYKT 548

Query: 693 VAISTACPRLEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPE---- 748
            A       L  +VV+T       ++ L  +K G   F+ L+++  +   +I  P     
Sbjct: 549 CAEVVGGNSLFHVVVDTENTASLIMQELYNSKGGRVTFMPLNRI--YVDPNIQYPSNEEY 606

Query: 749 -SVPRLFDLIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRV--VTLDGNLID 805
              P +  +    D KF  A   V G T+V  DL Q +++A   K+F +  VTLDG+  D
Sbjct: 607 NCTPLIKKIKF--DGKFEKAVKHVFGKTIVVKDLLQGSKLA---KQFNLNSVTLDGDKAD 661

Query: 806 ISGTMSGG 813
             G ++GG
Sbjct: 662 NKGVLTGG 669

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 3/105 (2%)

Query: 1300 GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1357
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1358 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSA 1402
            + VA  IKE + NAQFI  + R +M ++A +   + K +NK  + 
Sbjct: 1166 TAVATMIKELSTNAQFICTTFRTDMLQVADKFFRV-KYENKISTV 1209

 Score = 66.2 bits (160), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 85/165 (51%), Gaps = 9/165 (5%)

Query: 143 LCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 202
           + I +++++ FK+Y    ++  F+   + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 203 LSDLIHKSEEYPSLPSCSVEVHFK---YVIDEPSGE-TRIDEEKPNLVVTRKAFRNNTSK 258
              LIH+     S+ S SVE+ F    + +  PSG  +R D+E    V  R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 259 YYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSK 303
           Y +ND+    G++ ++L+  G  +++   ++ QG++  +   K K
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDK 160

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 115/494 (23%), Positives = 210/494 (42%), Gaps = 137/494 (27%)

Query: 679  GRLGDLGVIDEKYDVAISTACPR------LEDIVVETVECGQQCIEYLRKNKLGYARFIL 732
            G LG+L  +++KY      AC        L  IVV+T E     +  L + K G   FI 
Sbjct: 538  GTLGELIKVNDKY-----KACAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIP 592

Query: 733  LDKLR-----KFNLDSINTPESVPRLFDLIHPKDPKFSSAFFSVLGNTLVANDLKQANRV 787
            L+KL      KF  +S    +  P +  + +   P+F  A   V G T+V  DL Q  ++
Sbjct: 593  LNKLSLDADVKFPSNSTTQIQFTPLIKKIKYQ--PRFEKAVKHVFGKTIVVKDLGQGLKL 650

Query: 788  AYGKKRFRVVTLDGNLIDISGTMSGG------GSRV--------SRGL-------MQINR 826
            A  K +   +TLDG+  D  G ++GG       +R+        SR         +Q+ R
Sbjct: 651  A-KKHKLNAITLDGDRADKRGVLTGGYLDQHKRTRLDSLKNLNESRNQHKSIGDELQVVR 709

Query: 827  NKTEDIE-------------------IYSSEEVAQLEVNLVEREKNF--QVASDTIYQME 865
            N+  DI+                   + ++ E+ +  +N  + E+    + ++  + ++E
Sbjct: 710  NELNDIDAQIDQLNGNIRKVSNDRESVLTNIEIFRTSLNTKKNERLILEESSNAIVLKLE 769

Query: 866  EQLKDLK---EKEPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNV---E 919
            +Q  +LK   EK    EN++      ++ ++SE+  +E + LES      T++ NV   +
Sbjct: 770  KQKTNLKFAQEKMDTYENDL------LQDFDSELSKEEKEKLES-----LTKEINVLHNK 818

Query: 920  LRETIQHVQSLKDEFKSIQNQTKSKK-HRIETLKNEIMEIGGA----------ELKIQSS 968
            L  T   ++ +     S+  + +SK   +   LK ++ E+G A          EL ++  
Sbjct: 819  LDVTSDALEGITTTIDSLNAELESKLIPQQNDLKIKMAEVGDAFILGLQDELKELDLEKE 878

Query: 969  KVD----------SVIQR-IDIVVSKQKKERSVIKKTENEINKSHKMKLETSRDLENFNQ 1017
             V+            IQR I+ +V+++   + +++K  N+     ++ L   + L+NF +
Sbjct: 879  SVEKQYENATLELGTIQREIETLVAEETNNKKLLEKANNQ----QRLLL---KKLDNFQK 931

Query: 1018 EIQ-------TLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLED----------- 1059
             ++       TL T  E LQ  + ++            GL+ E   + D           
Sbjct: 932  SVEKTMIKKTTLVTRREELQQRIREI------------GLLPEDALVNDFSDITSDQLLQ 979

Query: 1060 KLNDINEDIAIFKS 1073
            KLND+N +I+  K+
Sbjct: 980  KLNDMNTEISSLKN 993

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 75/140 (53%), Gaps = 5/140 (3%)

Query: 1266 FGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVTFSVMPPKKS--WRNITNLSGGEK 1323
            F  +S    ++++ +   G  EL +      +S GV+  V    K+     I  LSGG+K
Sbjct: 967  FNQVSENFSDIFEQLVPRGTGELVIGRQGQEYS-GVSIQVSFNSKNDEQLQIEQLSGGQK 1025

Query: 1324 TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA-QFIVISLRNNM 1382
            T+ ++AL+ A+ +  P P Y+ DEIDAALD      V+  IK  ++N  QFI+ + R++M
Sbjct: 1026 TVCAIALILAIQQVDPAPFYLFDEIDAALDKEYRKSVSQVIKRLSQNGTQFILTTFRSDM 1085

Query: 1383 FELAQQLVGIYKRDNKTKSA 1402
             E+A  ++ + K  NK  S 
Sbjct: 1086 IEIA-DMIYMVKYHNKVSSV 1104

 Score = 67.0 bits (162), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 199/865 (23%), Positives = 384/865 (44%), Gaps = 126/865 (14%)

Query: 218  SCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKK 277
            S SVEV F    ++ S  T +  +  N V  R+        Y +ND+    G++ ++L+ 
Sbjct: 2    SASVEVIFDNNDEQMSLPTGVKPKPNNEVSIRRTIGLKKDDYQINDRNITRGDMIRMLES 61

Query: 278  EGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXXXXXXIIGTAKYKPLIEKNLADME 337
             G  + +   ++ QG++  +   K K               ++G   ++  ++ +L  M+
Sbjct: 62   VGFSMSNPYNIVPQGKIIALTNAKDKERLLLLEE-------VVGAKSFENKLQASLLKMD 114

Query: 338  SLNDICIEKENRFQIVDREKNSLENG---KEEALLFLENERKLTVSKSKLYQYH------ 388
                    ++ RFQI ++E   LEN     E+  + LE    L  +K K+ Q++      
Sbjct: 115  ET------EQKRFQI-NKEMKELENKLNEMEQEKIELEKYNNLEKNK-KVIQFNLYDREL 166

Query: 389  --ILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEK 446
              I+N   KL    + I   ++K  +E DK   +   +++L+   + +E +LK  N  E 
Sbjct: 167  NDIINQIEKLDIEYNSILISSEKYLQELDKRELI---IEQLKMKLNHIEDELKIKNQSEF 223

Query: 447  QLLGKKRELDGKNVLNEE-KIKNFEKK--RDKAE-----KTLSSMDRSISSSEARLSELK 498
            + L   ++   + + N + KIK FE K   +K++     + L  +D  I+  +  L+E+K
Sbjct: 224  EELNNTKDAISQKITNYQIKIKEFENKIKTNKSQLKINNQNLKLLDELINEKQLELNEIK 283

Query: 499  QLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKK 558
                 YE  L  +N+  + E  KL+  +  L  K N  S + A +E+  E    ++    
Sbjct: 284  P---QYE-ELNNVNQDLKFEINKLKDQEKILIIKNNKYS-QFANIEERNEWIQEEINNLN 338

Query: 559  TQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKELDSLHSQHKSVKEEIS 618
              +    +    +++ E  L +E D+  Q+I+     I + +  +D +  + K + E + 
Sbjct: 339  LNLTTLNNTCKGLEDEEMDLTREFDEINQKIQDLNTSINESTITIDEIEHEIKDLNE-MY 397

Query: 619  TGEKECLNARIRLKEMQNILNTQRQKALDARSALSNAENK------SKVLTALSRLQKSG 672
            T E   ++ R  L   +N L+T  +  LD+ + +  + N+      S+ ++ +  +    
Sbjct: 398  TKE---IDKRKELWREENKLDTVLETNLDSINRIERSINENIDYSLSQGISNVKEIVNKL 454

Query: 673  RI--SGFHGRLGDLGVIDEKYDVAIST-ACPRLEDIVVETVECGQQCIEYLRKNKLGYAR 729
             I  +  +G LG+L  + EKY   +   A   L +I+V+T E   Q +  L + + G   
Sbjct: 455  NIPETSIYGTLGELIKVSEKYKRCVEIIAGNSLFNIIVDTDETASQIMNELIRMQNGRVT 514

Query: 730  FILLDKLRKFNLDSINTPESVPRLFDLIHPK---DPKFSSAFFSVLGNTLVANDLKQANR 786
            FI L+++   N  +IN P +       +  K   D KF     +V G T+V  DL+  NR
Sbjct: 515  FIPLNRIE--NGVNINYPSNEESNCTALIKKIKYDKKFEKVIRNVFGKTIVVKDLQLGNR 572

Query: 787  VAYGKKRFRV--VTLDGNLIDISGTMSGGGSRVSR-----GLMQINRNKTEDIEIY--SS 837
            +    K F++  +TLDG+ ID  G +SGG   ++R      L ++ R++     +Y  + 
Sbjct: 573  LC---KEFKLQAITLDGDRIDSKGVVSGGYFNINRRSRLDNLKELQRSRN----VYKNTM 625

Query: 838  EEVAQL--EVNLVERE--------------------KN------FQVASDTIYQMEEQLK 869
            +E+AQ+  E++ ++ E                    KN         +   +Y +EE + 
Sbjct: 626  KELAQIKDEISQIDDEIDKINAEIREVSGKRERVMIKNEDGRLKLNQSKTQLYNLEETMV 685

Query: 870  DLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNV-----ELRETI 924
            ++K K   +E N+           +E K+KE + LE  + +    D  +     ELR+  
Sbjct: 686  NVKNKREQMEKNV---------LLNEAKLKEYE-LEMNKEFVNGNDGELGDGDDELRDIS 735

Query: 925  QHVQSLKDEFKSIQNQT-KSKKHRIETLKNE-----IMEIGGAELKIQSSKVDSVIQRID 978
              ++S K+E    QN++  + + +++ LK E     I +    ELKI     + + + + 
Sbjct: 736  LQLKS-KEEKMLQQNESLMALQIQMDELKAELESKLIRQRDEVELKILQCDNEGMEEELK 794

Query: 979  IVVSKQKKERSVIKKTENEINKSHK 1003
             +  ++  E   ++  EN+I+K +K
Sbjct: 795  NLQYQEMDETKAMETIENDIDKMYK 819

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 70.5 bits (171), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 1315 ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1374
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1117 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1176

Query: 1375 VISLRNNMFELAQQLVGIYKRDNKTKSAT 1403
              + R +M  +A     + K +NK  + T
Sbjct: 1177 CTTFRTDMINVADTFFRV-KFENKVSTVT 1204

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 75/168 (44%), Gaps = 27/168 (16%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLS 204
           I  +I+  FK+Y  R VV  F+   + VVG NGSGKSN   ++ FV     + ++++   
Sbjct: 4   IKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKREDRK 63

Query: 205 DLIHKSEEYPSLPSCSVEVHFKYVIDEP-----------SGETRIDEEKPNLVVTRKAFR 253
             I++      + S  VE+ F    D+P           +GE RI          R+   
Sbjct: 64  GFIYQG--AGQVMSAFVEIIF----DDPENLMLAPLRNDTGEVRI----------RRTVG 107

Query: 254 NNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMK 301
               +Y +ND+ +   +V ++L+  G    +   ++ QG + ++   K
Sbjct: 108 LKKDEYMINDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAK 155

>KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034W SMC5 Structural maintenance of chromosomes (SMC)
           protein interacts with Rhc18p and Nse1p to form a large
           complex S. pombe homolog forms a heterodimer with S.
           pombe Rad18p that is involved in DNA repair
          Length = 1094

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 73/160 (45%), Gaps = 12/160 (7%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 203
           I  L L++F +YA  +     + S + ++GPNGSGKS  + ++      +   + R  ++
Sbjct: 47  IVTLRLENFVTYALTEF--HMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSTKI 104

Query: 204 SDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNN-TSKYYVN 262
            D I   E+        +EV  K    +P  E R         VTR   RN   S+Y++N
Sbjct: 105 EDYIKNGED-----RSVIEVTLK---RDPEAEDRYVASDGTTKVTRVLHRNRKASEYFLN 156

Query: 263 DQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKS 302
            Q      V +L+ +  + LD+    + Q  VE  A++KS
Sbjct: 157 GQSVTESAVKRLVSELNIQLDNLCQFLSQERVEEFARLKS 196

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1319 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1375
            SGGE+ +S++  + AL      P  V+DEI+  +D RN  IV   + E      N+Q+I+
Sbjct: 989  SGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL 1048

Query: 1376 IS 1377
            ++
Sbjct: 1049 VT 1050

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1099

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 108/453 (23%), Positives = 195/453 (43%), Gaps = 63/453 (13%)

Query: 120 LKNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSG 179
           L + RL+L K+     N        I ++ L++F +YA  +     + S + ++GPNGSG
Sbjct: 28  LPSKRLKLSKV-----NYTDFQPGSIIKIRLKNFVTYALTEF--HLSPSLNMIIGPNGSG 80

Query: 180 KSNVIDSMLFVFGFRANKM-RQDRLSDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRI 238
           KS  + ++      R   + R  R+ D I   E+      C +E+  K    +  G   +
Sbjct: 81  KSTFVCAICLGLAGRPEYIGRSKRVEDFIKNGED-----ECEIEITLKNN-SKIQGIANV 134

Query: 239 DEEKPNLVVTRKAFRNNT-SKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENI 297
                 + +TR   R+   S Y++ND+  + G V  ++ +  + LD+    + Q  VE  
Sbjct: 135 LSSDDVIKITRVLIRHRKKSDYFINDRPASEGVVKSMILQLNIQLDNLCQFLSQERVEEF 194

Query: 298 AQMKSKAXXXXXXXXXXXXXXIIGTAKYKPLIEKNLADMESLNDICIEKENRFQIVDREK 357
           A++KS                I    + K L  + LA+ + ++     K+ R Q +  EK
Sbjct: 195 ARLKSD-KLLFETIRSIDTDLITVLEELKELQGEELAEEKEVSF----KQQRLQELTAEK 249

Query: 358 NSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKN 417
             LE        F   + +L + K KL  Y      +K+K+  +KI   ++K  +++ +N
Sbjct: 250 ERLETSVRVLEEFQRKKDQLEIHK-KLLPY------VKIKDHKEKI-RASKKCYEDAKRN 301

Query: 418 -----------ASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKI 466
                      +  K++L+  RA  D LESK    NN+E++     RE       N+ K 
Sbjct: 302 LKALLQDKKPFSHAKRQLE--RATEDALESK----NNKEREY----RE-------NQVKF 344

Query: 467 KNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIK 526
           K+     +K  + +      I+    R ++LKQ        ++EL  Q E ++  L  +K
Sbjct: 345 KSIPVSLEKIREEIQKNSAQINYYRGRSAKLKQ-------GIEELESQLENQREDLNGLK 397

Query: 527 FSLKDKTNGISLEIAQLEKELEPWNAQLQEKKT 559
              + + + I  E  +L  EL+ +  Q ++ KT
Sbjct: 398 EPEQGEFDSIDTERTKLSDELQGYTEQYRDLKT 430

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 11/78 (14%)

Query: 1319 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1375
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 994  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDTRNERIVHKAMVENACAENTSQYFL 1053

Query: 1376 ISLRNNMFELAQQLVGIY 1393
            I+         + L G+Y
Sbjct: 1054 IT--------PKLLTGLY 1063

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1088

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 80/163 (49%), Gaps = 14/163 (8%)

Query: 144 CIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 202
            I ++ L++F +Y   +     + S + ++GPNGSGKS  + ++      +   + R  R
Sbjct: 35  AIVKMRLENFVTYTLTEF--DLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIKRSKR 92

Query: 203 LSDLIHKSEEYPSLPSCSVEVHFKYVIDEPS--GETRIDEEKPNLVVTRKAFRNNT-SKY 259
           + D I   E+       S+E+  K   + P   G   +D E   + +TR+  ++ + S+Y
Sbjct: 93  VEDFIKNGED-----RGSIEITLK---NSPKVEGMPGVDSEADTIKITRELIKSKSKSRY 144

Query: 260 YVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKS 302
            +ND+  +  +V  L+ K  + LD+    + Q  VE  A++KS
Sbjct: 145 MINDRVVSEEDVRLLVSKLNIQLDNLCQFLSQERVEEFARLKS 187

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 1319 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1373
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN      S+V N   E T  +Q+
Sbjct: 981  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDSRNERIVHKSMVENACAENT--SQY 1038

Query: 1374 IVIS 1377
             +I+
Sbjct: 1039 FLIT 1042

>TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1106

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 3/85 (3%)

Query: 1296 PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1355
            P  + + +++ P     RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  
Sbjct: 987  PAKQLMIYTLTPNDNRPRNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQV 1046

Query: 1356 NVSIVANYIKERTKN---AQFIVIS 1377
            N  +    I E+ KN    Q I+I+
Sbjct: 1047 NRKMGTRLILEKLKNNSRTQTIIIT 1071

>Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL034W
           (REAL)
          Length = 1093

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 76/168 (45%), Gaps = 24/168 (14%)

Query: 144 CIDQLILQDFKSYAGRQVVGPFN--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQ 200
           CI ++ LQDF +Y     +  FN   S + ++GPNGSGKS  + ++      +   + R 
Sbjct: 41  CITKIRLQDFVTYT----LTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRS 96

Query: 201 DRLSDLIHKSEEYPSLPSC---SVEVHFKYVI---DEPSGETRIDEEKPNLVVTRKAFRN 254
            ++ D I   ++   +      S +VH    I   DE    TRI        +TR   R 
Sbjct: 97  KKVEDFIKNGQDVSRIEITLKNSPKVHDIENINAHDETIKITRI--------ITRSKRR- 147

Query: 255 NTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKS 302
             S Y +ND + +   V  L+ +  + LD+    + Q  VE  A++KS
Sbjct: 148 --SDYLINDGQVSENTVKTLVTQLNIQLDNLCQFLSQERVEEFARLKS 193

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 11/78 (14%)

Query: 1319 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1375
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1376 ISLRNNMFELAQQLVGIY 1393
            I+         + L G+Y
Sbjct: 1047 IT--------PKLLTGLY 1056

>ACR068W Chr3 (480141..485558) [5418 bp, 1805 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YHR023W (MYO1)
          Length = 1805

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 71/322 (22%), Positives = 159/322 (49%), Gaps = 34/322 (10%)

Query: 396  LKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNC-------NNEEKQL 448
            ++  L K T   Q  E+  D   + KK  ++LR+  +E   KLK+        NNEE Q 
Sbjct: 841  IRTALSKETEKLQNFERLYD---TAKKREEELRSAYEE-AVKLKDTLQSETTINNEEYQK 896

Query: 449  LGKK-RELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENS 507
            L K+ ++L      +  KIK  E+++   +K + SM R + SS  +   +K  + D E+ 
Sbjct: 897  LQKELQQLKESREQSNTKIKELEREKSNLQKQIDSMKRQVDSSTKQAMAMKADKSDLESQ 956

Query: 508  LKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQ 567
            L++L  + + ++ ++++++  + +    + L++ Q+E+     N +L++  ++ +L + Q
Sbjct: 957  LRKLKLELKSKEKRVKELEQKVDNSGEDLKLKLQQVERAAATNNKRLEQLTSENKLMKDQ 1016

Query: 568  ISLIK----EAEAKLA---QEIDQFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTG 620
            +   K    E++ +L+    E+ +  + IE  ++Q+   ++E D+L ++H+ V  +++  
Sbjct: 1017 MEKSKKEQHESQRQLSSRGSELIRLNERIEAEREQVSDLTRERDNLVAEHEQVVNQLAIA 1076

Query: 621  EKECLNARIRLK----EMQNILNTQRQKALDARSALSNAENKSKVL-------TALSRLQ 669
              E    + +++    E +N+     + +  +++ ++  EN+ + L        A++R  
Sbjct: 1077 RSEIAEYKKKIEALKAEAENMKENYAESSPASQALVATVENRMRGLEDELTKERAMNRFL 1136

Query: 670  KSGRISGFHGRLGDLGVIDEKY 691
                +S FH      GV D +Y
Sbjct: 1137 NEKLLSAFHNG----GVHDAQY 1154

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
           (REAL)
          Length = 1092

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 73/162 (45%), Gaps = 24/162 (14%)

Query: 150 LQDFKSYAGRQVVGPFN--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDL 206
           LQDF +Y     +  FN   S + ++GPNGSGKS  + ++      +   + R  ++ D 
Sbjct: 47  LQDFVTYT----LTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKKVEDF 102

Query: 207 IHKSEEYPSLPSC---SVEVH---FKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYY 260
           I   ++   +      S ++H   F    DE    TRI        +TR   R   S Y 
Sbjct: 103 IKNGQDTSRIEITLKNSPKIHDIEFINTHDETIKVTRI--------ITRSKRR---SDYL 151

Query: 261 VNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKS 302
           +ND++ +   V  L+ +  + LD+    + Q  VE  A++KS
Sbjct: 152 INDEQVSENVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKS 193

 Score = 40.8 bits (94), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1319 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1375
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1376 IS 1377
            I+
Sbjct: 1047 IT 1048

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}
           SMC5Component of the SMC5-SMC6 complex; this complex
           plays a key role in the removal of X-shaped DNA
           structures that arise between sister chromatids during
           DNA replication and repair; binds single-stranded DNA
           and has ATPase activity; S. pombe homolog forms a
           heterodimer with S. pombe Rad18p that is involved in DNA
           repair
          Length = 1093

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 72/159 (45%), Gaps = 18/159 (11%)

Query: 150 LQDFKSYAGRQVVGPFN--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDL 206
           LQDF +Y     +  FN   S + ++GPNGSGKS  + ++      +   + R  ++ D 
Sbjct: 47  LQDFVTYT----LTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKKVEDF 102

Query: 207 IHKSEEYPSLPSCSVEVHFKY---VIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVND 263
           I   ++        +E+  K    V D    + R +  K   ++TR   R   S Y +ND
Sbjct: 103 IKNGQDV-----SKIEITLKNSPNVTDIEYIDARDETIKITRIITRSKRR---SDYLIND 154

Query: 264 QETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKS 302
            + +   V  L+ +  + LD+    + Q  VE  A++KS
Sbjct: 155 YQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKS 193

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1319 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1375
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1376 IS 1377
            I+
Sbjct: 1047 IT 1048

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1095

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 77/167 (46%), Gaps = 16/167 (9%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 203
           I ++ LQ+F +Y  R      + S + ++GPNGSGKS  + ++      +   + R  R+
Sbjct: 38  IVKIKLQNFVTY--RLTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIGRAKRV 95

Query: 204 SDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEE-----KPNLVVTRKAFRNNT-- 256
            D I   E+     +  +E+  K   D    ++ ++ +     K  L VTR   R+    
Sbjct: 96  DDFIKNGED-----TSRIEIFLKNYEDPTELQSSLNLKFNLAGKDLLKVTRLIQRDGNKC 150

Query: 257 -SKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKS 302
            S Y++ND+      +  L+K   + LD+    + Q  VE  A++KS
Sbjct: 151 KSDYFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEFARLKS 197

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1319 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1375
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTSQYFL 1049

Query: 1376 IS 1377
            I+
Sbjct: 1050 IT 1051

>ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1109

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 1303 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1362
            F + P  +  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I   
Sbjct: 997  FILTPNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRQIGTK 1056

Query: 1363 YIKERTKN---AQFIVIS 1377
             I  + K+    Q I+I+
Sbjct: 1057 LILNKLKDIARTQTIIIT 1074

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
           (REAL)
          Length = 1093

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 71/159 (44%), Gaps = 18/159 (11%)

Query: 150 LQDFKSYAGRQVVGPFN--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDL 206
           LQDF +Y     +  FN   S + ++GPNGSGKS  + ++      +   + R  R+ D 
Sbjct: 47  LQDFVTYT----LTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKRVEDF 102

Query: 207 IHKSEEYPSLPSCSVEVHFK---YVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVND 263
           I   ++        +E+  K    V D  +     +  K   ++TR   R   S Y +ND
Sbjct: 103 IKNGQDV-----SRIEITLKNSPKVNDIENVNAHDETIKITRIITRSKRR---SDYLIND 154

Query: 264 QETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKS 302
            E +   V  L+ +  + LD+    + Q  VE  A++KS
Sbjct: 155 CEVSESVVKALVAQLNIQLDNLCQFLSQERVEEFARLKS 193

 Score = 40.8 bits (94), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1319 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1375
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1376 IS 1377
            I+
Sbjct: 1047 IT 1048

>KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1108

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 77/160 (48%), Gaps = 20/160 (12%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLS 204
           + +L L +F +Y+  +    F+ S + VVGPNGSGKS ++ ++      R   + + + S
Sbjct: 57  VVRLRLHNFVTYSLAEF--EFSPSLNMVVGPNGSGKSTLVCALCLGLAGRTEYLGRMKRS 114

Query: 205 DLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNN--TSKYYVN 262
           D   K+       S  ++V   ++  E  G T        L V+R   RN+   S YYV+
Sbjct: 115 DSFIKN----GADSARIDV---WLAGEDPGTT--------LKVSRVLTRNHKKASLYYVD 159

Query: 263 DQETNYGEVTKLLK-KEGVDLDHKRFLILQGEVENIAQMK 301
             ET+   V +L+  +  + LD+    + Q  V+  A+++
Sbjct: 160 GVETSEQRVRQLVATQHNIQLDNLCQFLSQERVQEFARLR 199

 Score = 41.2 bits (95), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%)

Query: 1319 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1360
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV
Sbjct: 1003 SGGERAVSTVLYIIALQEFTSAPFRVVDEINQGMDQRNERIV 1044

>Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {ON}
            YOL034W - Protein required for cell viability [contig 47]
            FULL
          Length = 1117

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 37/62 (59%), Gaps = 3/62 (4%)

Query: 1319 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1375
            SGGE+ +S++  + AL ++   P  ++DEI+  +D RN  IV   + E     K +Q+I+
Sbjct: 1012 SGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVENACAEKTSQYIL 1071

Query: 1376 IS 1377
            ++
Sbjct: 1072 VT 1073

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 72/158 (45%), Gaps = 9/158 (5%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLS 204
           I +L L++F +Y+  +     + S + ++GPNGSGKS  + ++      +   + + +  
Sbjct: 69  IVKLRLENFVTYSLTEF--HLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRGKRV 126

Query: 205 DLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQ 264
           D   K+ E   L    +EV  K           +D       V+R  +    S+YY+ND+
Sbjct: 127 DSFIKNGENRGL----IEVTLKRDPGRTGSFVAVD---GTTKVSRVLWVGKKSEYYLNDE 179

Query: 265 ETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKS 302
             +   V  L+ +  + LD+    + Q  VE  A++KS
Sbjct: 180 PVSELTVKNLMGELNIQLDNLCQFLSQERVEEFARLKS 217

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1080

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 81/185 (43%), Gaps = 32/185 (17%)

Query: 124 RLELQKIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVGPFN--TSFSAVVGPNGSGKS 181
           R++    YD  + Q  +    I +L LQ+  +Y+    +  FN   S + +VGPNGSGKS
Sbjct: 20  RMKPSPTYDYSKFQPGN----IVKLRLQNVMTYS----ITEFNLSPSLNMLVGPNGSGKS 71

Query: 182 NVIDSMLFVFGFRANKM-RQDRLSDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDE 240
             + ++      +   + R  ++ + I   E    +                  +T +  
Sbjct: 72  TFVCAVCLGLAGKPEYIGRSKKIDNFIKNGENTAQI------------------DTFLRG 113

Query: 241 EKPNLVV--TRKAFRNNT-SKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENI 297
             PN V+  TR   RN   S+YY++D  +    V KL  +  + LD+    + Q  VE+ 
Sbjct: 114 HMPNEVIKITRIMTRNKKKSEYYIDDSPSTETAVRKLASELNIQLDNLCQFLSQEHVEDF 173

Query: 298 AQMKS 302
           A++KS
Sbjct: 174 AKLKS 178

 Score = 40.4 bits (93), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1319 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1375
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 975  SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDQRNERIVHRAMVENACAENTSQYFL 1034

Query: 1376 IS 1377
            I+
Sbjct: 1035 IT 1036

>Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON}
            complement(25219..32859) [7641 nt, 2547 aa]
          Length = 2546

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 111/243 (45%), Gaps = 11/243 (4%)

Query: 861  IYQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVEL 920
            +  + EQLK+L+ ++     N  +L   I + N+++K K+ +++E E     T++N   L
Sbjct: 1027 VIDLNEQLKELETQKETTSKNADELNKSIANLNTQLKQKDSKLIELEELVEVTKNN---L 1083

Query: 921  RETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIV 980
             ++   V +L  +   +  + KS K  +E L+NEI EI  +    Q        +  D +
Sbjct: 1084 NDSESQVSNLIAKISELDEENKSVKLEVEKLENEITEIKNSHKSAQ--------KETDTL 1135

Query: 981  VSKQKKERSVIKKTENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESV 1040
             +K  +   +++ ++ EI         T  D EN     +     IE L+ + + + E  
Sbjct: 1136 QTKLDETELLLQSSKEEILSLKNEYSSTLSDKENLENSEKKSSEKIEELEKNFSNLQEQF 1195

Query: 1041 TSVQHTKEGLIEESRTLEDKLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYE 1100
             ++    + L EE    E+K  D+NE +  +      + +E +KLN +    +K I +  
Sbjct: 1196 ENITAENKSLKEECSGTEEKFKDVNEKLDQYGETISSLSDEKDKLNGIIDDKEKIISNLN 1255

Query: 1101 EKL 1103
            EKL
Sbjct: 1256 EKL 1258

 Score = 38.9 bits (89), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 61/253 (24%), Positives = 126/253 (49%), Gaps = 27/253 (10%)

Query: 792  KRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRNKTEDIEIYSSEEVAQLEVNLVERE 851
            K  +V TL+ +L  +  T+       S   +QI  +   D  I   +++ +L+V + + E
Sbjct: 2040 KEAQVETLELDLNKLKETLDKELESSSE--LQIAHDNLRDENIIQKQKITELKVKIDDSE 2097

Query: 852  KNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIK--EIQMLESERA 909
            K+ QV  D + +MEE + DL+       N++S  T++IE  N ++  K  EI+ L  + A
Sbjct: 2098 KDSQVIIDNMKEMEENIMDLR-------NDLSSKTIQIEKVNEDLSSKNSEIEQLNKKLA 2150

Query: 910  YSATQDNNV--ELRETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGGAELKIQS 967
                + +++  EL  + +  +S K++ K + ++    K ++E LKNE ++   ++L+I +
Sbjct: 2151 EKCAEYDSIKSELVASSKLSESEKNDMKQLSDEINELKEQLE-LKNENLKKVTSDLQIAN 2209

Query: 968  SKVD----------SVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETSRDLENFNQ 1017
            +  D          + I+ I+  +   +K+  +    E E N +   K +  + L+NF++
Sbjct: 2210 NTSDKYNDELKVANNTIREIESKIPNLQKQLDL---KEIEYNDTLSSKKDLDKKLDNFSK 2266

Query: 1018 EIQTLKTTIEGLQ 1030
            E + L   ++ L+
Sbjct: 2267 ESEILSKEVKSLK 2279

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4.237
          Length = 1096

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1370
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 992  RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLA 1051

Query: 1371 -AQFIVIS 1377
              Q I+I+
Sbjct: 1052 RTQTIIIT 1059

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1119

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1370
            R I NLSGGEK+ + +AL+ A  K   + +  +DE D  +D  N  I    + ++ KN  
Sbjct: 1019 RTIDNLSGGEKSFAQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTGLLVKKLKNQT 1078

Query: 1371 -AQFIVIS 1377
              Q I+I+
Sbjct: 1079 RTQTIIIT 1086

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 1305 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1364
            + P    +R ++  SGGEK+ S +AL+ A  +   + +  +DE D  +D  N  I +  I
Sbjct: 1007 LTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALDEFDVFMDQVNRKIGSKLI 1066

Query: 1365 KERTK---NAQFIVIS 1377
             ++ K   N Q I+I+
Sbjct: 1067 VKKLKDIPNTQTIIIT 1082

>Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR383W
            (REAL)
          Length = 1120

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1370
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1020 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1079

Query: 1371 -AQFIVIS 1377
              Q I+I+
Sbjct: 1080 RTQTIIIT 1087

>Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR383W
            (REAL)
          Length = 1115

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1370
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1015 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1074

Query: 1371 -AQFIVIS 1377
              Q I+I+
Sbjct: 1075 RTQTIIIT 1082

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4.237
            YLR383W
          Length = 1108

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1370
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 1008 RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLL 1067

Query: 1371 -AQFIVIS 1377
              Q I+I+
Sbjct: 1068 RTQTIIIT 1075

>YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; homologous to S. pombe rad18
          Length = 1114

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1370
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1371 -AQFIVIS 1377
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1370
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1371 -AQFIVIS 1377
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar to
            Ashbya gossypii AEL337
          Length = 1097

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 66/131 (50%), Gaps = 21/131 (16%)

Query: 1258 RFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVTFSVMPPKKSWRNITN 1317
            R DE ++    IS   ++++  + +G   E+ LV   D +SE      +  K  +R++  
Sbjct: 933  RLDEIVEN---ISTRFRKLF--LNVGSAGEVCLVKP-DLYSEWK----IEIKVKFRDVAE 982

Query: 1318 L--------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-- 1367
            L        SGGE+ +S++  + +L ++   P  V+DEI+  +D RN  IV   + E   
Sbjct: 983  LKKLDSHIQSGGERAVSTVLYMISLQEFTNAPFRVVDEINQGMDARNERIVHKAMVENAC 1042

Query: 1368 TKN-AQFIVIS 1377
             KN +Q+ +I+
Sbjct: 1043 AKNTSQYFLIT 1053

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_7.101
            YOL034W
          Length = 1119

 Score = 41.2 bits (95), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1319 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1375
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1014 SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1073

Query: 1376 IS 1377
            I+
Sbjct: 1074 IT 1075

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 72/179 (40%), Gaps = 41/179 (22%)

Query: 150 LQDFKSYAGRQVVGPFN--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDL 206
           L++F +Y     +  FN   S + ++GPNGSGKS  + +       +   + R  R+ D 
Sbjct: 57  LENFVTYK----LTEFNLSPSLNMIIGPNGSGKSTFVCAACLGLAGKPEYIGRSKRVDDY 112

Query: 207 IHKSEEYPSLPSCSVEVHFKYV----------------------IDEPSGETRIDEEKPN 244
           I   E+        +E+  K V                      +D   G+  +      
Sbjct: 113 IKNGED-----RSKIEIFLKNVESMDKLKNFNNNNNKNNNNGAQVDLKCGQLDL------ 161

Query: 245 LVVTRKAFRNNT-SKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKS 302
           +  TR   R+   S YY+ND+  +   V  L+K   + LD+    + Q  VE  A++KS
Sbjct: 162 IKFTRIIHRDKKKSDYYINDKPVSELTVKNLVKALSIQLDNLCQFLSQERVEEFARLKS 220

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] {ON}
            similar to uniprot|Q08204 YOL034W Saccharomyces
            cerevisiae YOL034W SMC5 Structural maintenance of
            chromosomes (SMC) protein, interacts with Rhc18p and
            Nse1p to form a large complex
          Length = 1119

 Score = 41.2 bits (95), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 55/128 (42%), Gaps = 20/128 (15%)

Query: 1269 ISMTLKEMYQMITMGGNAELELVDTLDPFSEGVTFSVMPPKKSWRNITNL--------SG 1320
            IS     ++  +   G  EL+  D+ + +        +  K  +R+ + L        SG
Sbjct: 963  ISKKFSHLFAYVGSAGQVELKKPDSFNDW-------CIEIKVKFRDNSELQQLNPHVQSG 1015

Query: 1321 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA-----NYIKERTKNAQFIV 1375
            GE+ +S++  + AL ++  +P  V+DEI+  +D  N  IV      N   E T     I 
Sbjct: 1016 GERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNERIVHRIMVENACAENTSQYFLIT 1075

Query: 1376 ISLRNNMF 1383
              L  N+F
Sbjct: 1076 PKLLTNLF 1083

 Score = 33.9 bits (76), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 88/400 (22%), Positives = 168/400 (42%), Gaps = 83/400 (20%)

Query: 147 QLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDL 206
           +L L +F +YA  +     + S + ++GPNGSGKS  + ++      +   + + +    
Sbjct: 62  KLKLTNFVTYALTEF--HLSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRSK---- 115

Query: 207 IHKSEEYP-----------SLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRK-AFRN 254
             K EEY            +L + S  +H        S    I+ +   + V R  +   
Sbjct: 116 --KVEEYIKNGTDEGVIEITLKNSSALLH--------SDFNMINTDDDVVHVKRVLSMEK 165

Query: 255 NTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAXXXXXXXXXX 314
             SKYY+N++      V  +++   + LD+    + Q  VE  A++K             
Sbjct: 166 KKSKYYINNKVVTEEVVKSMVRVLNIQLDNLCQFLSQERVEEFARLKPDTLLNETIRSIE 225

Query: 315 XXXXIIGTAKYKPLIEKNLADMESL----NDICIE---KENRFQIVDREKNSLENGKEEA 367
                        L+EK L++++SL    N++ I+   KEN+ + +   + +LE+     
Sbjct: 226 AG-----------LLEK-LSELKSLQAEGNELQIDLGAKENKLKELTSSRAALESQAHAL 273

Query: 368 LLFLENERKLTVSKSKLYQYHILNSNMK----LKNTLDKITNLNQKLEKES--------- 414
            L+ E  R+L + + KL  Y  L  + +    LK+  + + N  + +E ES         
Sbjct: 274 ELYEEKARELDIHQ-KLLNYTYLKEHKEKIRGLKDKRNALRNEVKTMENESKPFNLLGVR 332

Query: 415 ---DKNASVKKELDKLR--------AFGDELES------KLKNCNNEEKQLLGKKRELDG 457
              D+N + K ++D L         +F    E+       L  C ++   L  + + L  
Sbjct: 333 LTADEN-NCKSDIDDLSRRRYSAKTSFNSSTENIQKTSKYLSECESKVNFLTTRNKSLKE 391

Query: 458 KNVLNEEKIKNFEKKRDKA----EKTLSSMDRSISSSEAR 493
              +NEEKIK  E++R+K      + +  +D ++S++ A+
Sbjct: 392 DIKVNEEKIKALEEERNKVVLPDPEKIHEVDENLSTASAK 431

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 41.2 bits (95), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1370
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KN  
Sbjct: 1014 RDVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTALIVKKLKNES 1073

Query: 1371 -AQFIVIS 1377
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
            complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 40.8 bits (94), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 1319 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1375
            SGGEK +S+   + +L  +   P  V+DEI+  +D RN  I+   + E       +Q+I+
Sbjct: 995  SGGEKAVSTALYIISLQNFTKAPFRVVDEINQGMDSRNEKIIHRIMVENACEDNTSQYIL 1054

Query: 1376 IS 1377
            ++
Sbjct: 1055 VT 1056

 Score = 36.2 bits (82), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 74/159 (46%), Gaps = 10/159 (6%)

Query: 145 IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRAN-KMRQDRL 203
           I ++ +++F +Y    V      SF+ ++GPNGSGKS V+ ++      + +   R D +
Sbjct: 51  IIKIKMKNFMTYG--LVEYQLCPSFNMIIGPNGSGKSTVVCALGLGLASKLDITGRGDIV 108

Query: 204 SDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRK-AFRNNTSKYYVN 262
           +  I   +      S  +E+  KY  D       ++  +  + + R+ +     S Y +N
Sbjct: 109 TQYIQNGK-----TSGKIEITLKYS-DRIKNVKGVNPNRETVTIKREISIDAKKSNYKIN 162

Query: 263 DQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMK 301
           +   N  +V  ++ K  + LD+    + Q  +++ A++K
Sbjct: 163 NTVVNEKDVRDIVSKLNIQLDNLCQYLPQERLKDFARLK 201

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
            YOL034W
          Length = 1103

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 15/80 (18%)

Query: 1319 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1373
            SGGE+ +S++  + AL +Y   P  ++DEI+  +D  N      S+V N   E T  +Q+
Sbjct: 998  SGGERAVSTVLYMIALQQYTTAPFRIVDEINQGMDSHNERIVHKSMVINACAENT--SQY 1055

Query: 1374 IVISLRNNMFELAQQLVGIY 1393
             +I+         + L G+Y
Sbjct: 1056 FLIT--------PKLLTGLY 1067

 Score = 40.0 bits (92), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 74/363 (20%), Positives = 159/363 (43%), Gaps = 86/363 (23%)

Query: 819  RGLMQINRNKTEDIE----IYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEK 874
            +GL+++   K  ++E    + S ++V ++  +L   ++      D+ YQ    + D++  
Sbjct: 113  KGLVEVTLKKPAEVEHSPIVKSHDQVIKITRHLSRSKR------DSDYQ----INDIEVP 162

Query: 875  EPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYS------------ATQDNNVELRE 922
            E  +++ ISQL +++++          Q L  ER  S              +  +++L E
Sbjct: 163  ESLVKSIISQLNIQLDNL--------CQFLSQERVASFAGQSPEKLLEETARSIDIKLCE 214

Query: 923  TIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEI--------------------------- 955
             +  ++ L+DE +  QN+  S + RI++LKN+                            
Sbjct: 215  VLSLLKELQDEERDHQNKVNSTQKRIDSLKNDCERLRITVSTFRAYQKKLKEIDEYKKLL 274

Query: 956  --MEIGGAELKIQSSKVD---------SVIQRIDIVVSKQKKERSVIKKTENEINKSHKM 1004
              +++ G E K++  + +         +++Q    +   QKK  S +K+  N+++ S K 
Sbjct: 275  PYVQLKGLEEKLRQYRAEYEQAKTNLKTLLQEKRKLFETQKKFESTLKEANNKVH-SIKA 333

Query: 1005 KLE-TSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLND 1063
            K E  SRD     ++++T++T I   +  + +  E +  +++    + E+ + LEDK   
Sbjct: 334  KFEKLSRDSTRLTKDLKTMRTDIASKKQDIQRYREKIGGLRN---NVAEKKKELEDKRVQ 390

Query: 1064 INEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLK---------IRDVTQI 1114
            +        S   ++K + E+L +    + + ++  E K+ +LK         IR  T+ 
Sbjct: 391  LTSIEIPDNSLLDDLKTQHEELLARETRINRSLREVEGKMSNLKYERDNVQSRIRRQTEA 450

Query: 1115 LHD 1117
            LHD
Sbjct: 451  LHD 453

 Score = 33.1 bits (74), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 7/69 (10%)

Query: 147 QLILQDFKSYAGRQVVGPFN--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 203
           +L +++F +Y     V  F+   S + ++GPNGSGKS  + ++      +   + R  +L
Sbjct: 48  KLRMENFVTYK----VAEFDLSPSLNMIIGPNGSGKSTFVCAVCIGLAGKPRFIGRSSKL 103

Query: 204 SDLIHKSEE 212
            D I   EE
Sbjct: 104 EDFIKNGEE 112

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1117

 Score = 40.4 bits (93), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1319 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1375
            SGGEK +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1012 SGGEKAVSTVFYMIALQEFTIAPFRVVDEINQGMDPRNEKIVHQSMVENACADNTSQYFL 1071

Query: 1376 IS 1377
            I+
Sbjct: 1072 IT 1073

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 70/157 (44%), Gaps = 14/157 (8%)

Query: 150 LQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR-LSDLIH 208
           L +F +Y   +     + S + ++GPNGSGKS  + ++      +   + + R + D I 
Sbjct: 71  LHNFVTYEFTEF--DLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSRNVDDYIK 128

Query: 209 KSEEYPSLPSCSVEVHFKY--VIDEPSGETRIDEEKPNLVVTRKAFRN-NTSKYYVNDQE 265
             EE+       +E+  K    I +  G   + E    + +TR   R+   S+Y +ND  
Sbjct: 129 NDEEH-----GEIEITLKNSEAIHDVEG---VLEGSDTITITRILTRSKKKSEYKINDSL 180

Query: 266 TNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKS 302
                V +L+    + LD+    + Q  VE  A++KS
Sbjct: 181 VTEATVKELVSLLNIQLDNLCQFLSQERVEEFARLKS 217

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1089

 Score = 40.4 bits (93), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 1319 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI-----VANYIKERTKNAQF 1373
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  I     V N   E T     
Sbjct: 984  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIIHKAMVENACAENTSQYFL 1043

Query: 1374 IVISLRNNM 1382
            I   L  N+
Sbjct: 1044 ITPKLLTNL 1052

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 79/189 (41%), Gaps = 19/189 (10%)

Query: 116 QISPLKNSRLELQ-KIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVGPFNTSFSAVVG 174
           QIS  K +R  L+    D +Q Q       I ++ L +F +Y+  +     + S + ++G
Sbjct: 18  QISTSKPARKRLKITAIDTEQFQPG----SIIKIKLWNFVTYSLAEFT--LSPSLNMIIG 71

Query: 175 PNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLIHKSEEYPSLPSCSVEVHFKYVIDEPS 233
           PNGSGKS  + ++      +   + R  +L D I   E+        VEV  K V   P 
Sbjct: 72  PNGSGKSTFVCAVCLGLAGKPEYIGRSSKLEDYIKNGED-----QSVVEVTLKNV---PE 123

Query: 234 GETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGE 293
            +   D       + R   +    +Y +N        +   +KK  + LD+    + Q  
Sbjct: 124 SDFNTDTILIKTTINRGKKK---PEYAINGSTVTETYIRAFVKKLNIQLDNLCQFLSQER 180

Query: 294 VENIAQMKS 302
           VE  A++KS
Sbjct: 181 VEEFARLKS 189

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
            YLR188W
          Length = 707

 Score = 40.0 bits (92), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 5/63 (7%)

Query: 1316 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1375
            T LSGG+K   +LA  F L   +PT L V+DE  +ALD R+ SIVA  +K+R     F  
Sbjct: 600  TQLSGGQKQRVALARAFLL---EPT-LLVLDEATSALDPRSESIVAQTLKQRCAKG-FTT 654

Query: 1376 ISL 1378
            IS+
Sbjct: 655  ISI 657

>KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1098

 Score = 39.7 bits (91), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-----KER 1367
            RN+  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I  N I     K+ 
Sbjct: 997  RNVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDV 1056

Query: 1368 TKNAQFIVIS 1377
              + Q I+I+
Sbjct: 1057 KSDTQTIIIT 1066

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
            YLR383W
          Length = 1098

 Score = 39.3 bits (90), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 1310 KSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1369
            K  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N       I ++ K
Sbjct: 995  KEPRNVDTLSGGEKSFSQIALLLATWKPMRSRIIALDEYDVFMDQVNRKTSTQLIVQKLK 1054

Query: 1370 N---AQFIVIS 1377
            +    Q I+I+
Sbjct: 1055 DDSRTQTIIIT 1065

>Ecym_3173 Chr3 complement(327173..329692) [2520 bp, 839 aa] {ON}
            similar to Ashbya gossypii AAL085C
          Length = 839

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 125/527 (23%), Positives = 236/527 (44%), Gaps = 93/527 (17%)

Query: 581  EIDQFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNT 640
            EID +K+EI+  K+++      LD+L  + K + ++  +G+K+                 
Sbjct: 184  EIDMYKREIDKVKERLGSYQNFLDALEEKSKWLFDQKKSGDKKI---------------E 228

Query: 641  QRQKALDARSALSNAENK--SKVLTALSRLQKS--GRISGFHGRLGDLGVIDEKYDVAIS 696
            Q ++  D+ +A     NK  S++ T +  L+ S   + +   GR           D+ I 
Sbjct: 229  QLKQLYDSMTAKVKQYNKQSSELKTTIENLRSSYLSQQTEIKGR-----------DIEID 277

Query: 697  TACPRLEDIVVETVECGQQCIEYLRKN-----KLGYARFILLDKLRKFNLDSINT-PESV 750
                 L +       C  Q  E   KN     +LGY    L D+ R  + D +    ++V
Sbjct: 278  YLKNELNN-------CAGQLSEEKIKNSDLIQQLGY----LKDEFRVISTDLLQKHGQNV 326

Query: 751  PRLFDLIHPKDPKFSSAFFS-------VLGNTLVANDLKQANRVAYGKKRFRVVTLDGNL 803
             ++F  +  K  +  +   S        L +T+ +  L QAN +   K  F ++ L  +L
Sbjct: 327  TQVFGDVTAKIDQVGNVVTSGITQKVEALSSTIDSKYLAQANLIRE-KNDFVLLKLSESL 385

Query: 804  IDISGTMSGGGSRVSRGLMQI--NRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTI 861
             D +  +    S+   G+  +    N+T ++  ++S  + Q        EK   V +D+ 
Sbjct: 386  EDFNKKLV---SKFDSGVTTLLSKWNQTNELHKHTSTTIQQ------GNEKFKCVLNDSS 436

Query: 862  YQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVELR 921
             + +E   +LK+   +I   +++L   ++S+ S++K  E    E   +   TQ +NV L+
Sbjct: 437  KKYQEHFIELKD---SIHEEVNKLGTSLQSFGSQLKKNE--KYEERLSELQTQIHNVVLQ 491

Query: 922  ETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVV 981
            ++   V SL           KSK   IE L N+I +       ++S K +SV+  ++  V
Sbjct: 492  KS--EVVSL----------MKSKDTEIEDLNNQIFKKNEM---LESLKDNSVL--LEREV 534

Query: 982  SKQKKERSVIKKTENEINKSHKMKLETSRDLENF---NQEIQTLKTTIEGLQDSLNKVHE 1038
            +++K+E S  KK E  +  S ++K   S   + F   ++ ++ L    E L+  L    E
Sbjct: 535  AERKQETS--KKVEEYLRLSEELKSHRSTSEQKFAAQHEVVKLLTQETESLKLKLAGCQE 592

Query: 1039 SVTSVQHTKEGLIEESRTLEDKLNDINEDIAIFKSFEMEMKNELEKL 1085
            S+++    K+  +E+S+ L++ L+ +N DI   K+ E+E++ E  KL
Sbjct: 593  SLSATNKDKQETLEKSQKLQEHLHKLNVDIVQLKAHELELEEENRKL 639

>TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2.351
            YDL102W
          Length = 1094

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 9/71 (12%)

Query: 1341 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG 1391
            PLYV++   +ID+     N      +SI+A  I E+  NA F+V S++ N  E+   L+G
Sbjct: 939  PLYVLEHNIQIDSRYYLTNQLQNPLISIIAPIIGEKQANAMFVVKSIKINTGEMKGGLMG 998

Query: 1392 IYKRDNKTKSA 1402
              K+ +  KS 
Sbjct: 999  FIKKVDSCKSC 1009

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL034W
            (SMC5)
          Length = 1097

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 1319 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR-----NVSIVANYIKERTKNAQF 1373
            SGGE+ +S++  + AL  +   P  V+DEI+  +D R     + ++V N   E T     
Sbjct: 992  SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVENACAENTSQYFL 1051

Query: 1374 IVISLRNNM 1382
            I   L  N+
Sbjct: 1052 ITPKLLTNL 1060

 Score = 35.4 bits (80), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 68/157 (43%), Gaps = 14/157 (8%)

Query: 150 LQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLIH 208
           L +F +Y+  +     + S + ++GPNGSGKS  + ++      +   + R  R+ D I 
Sbjct: 51  LTNFVTYSLAEF--HMSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRAKRVEDFIK 108

Query: 209 KSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNL---VVTRKAFRNNTSKYYVNDQE 265
                      ++E+  +   +  SG   I  E   +    V  KA R     YY+N + 
Sbjct: 109 N-----GTAESTIEIQLRNSRN-VSGLPMISAEDEAINVRTVLMKARRK--CAYYINGEP 160

Query: 266 TNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKS 302
            +  ++  L+    + LD+    + Q  VE  A++K+
Sbjct: 161 VSENQMRALVSMLNIQLDNLCQFLSQERVEEFARLKA 197

>CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] {ON}
            similar to uniprot|Q08204 Saccharomyces cerevisiae
            YOL034w SMC5
          Length = 1105

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 1319 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD-----FRNVSIVANYIKERTKNAQF 1373
            SGGE+ +S++  + AL K+   P  V+DEI+  +D       + ++V N  +E T  +Q+
Sbjct: 1000 SGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNFERLVHKAMVQNACEEGT--SQY 1057

Query: 1374 IVIS 1377
             +I+
Sbjct: 1058 FLIT 1061

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1111

 Score = 37.7 bits (86), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1359
            RN+  LSGGEK+ S ++L+ A  +   + +  +DE D  +D  N +I
Sbjct: 1010 RNVDTLSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRTI 1056

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
           (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 37.7 bits (86), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 3/79 (3%)

Query: 132 DAQQNQARHTRLCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVF 191
           D  +N+       I ++IL++F  +    V    N +F  +VG NGSGKS ++ +++   
Sbjct: 60  DGNRNEPPPPPGYIRKVILRNFMCHENFSVELTPNLNF--IVGNNGSGKSAILTAIIVAL 117

Query: 192 GFRANKM-RQDRLSDLIHK 209
           G +A++  R   L +LI K
Sbjct: 118 GVKASETSRGSSLKELIRK 136

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1359
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N ++
Sbjct: 1018 RSVDTLSGGEKSFSQMALLLATWKPMKSRIIALDEFDVFMDQVNRTV 1064

>Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR383W
            (RHC18) - involved in recombination repair [contig 72]
            FULL
          Length = 1102

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1297 FSEG-VTFSVMPPKKSW-RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1354
            FS+G +T  V  P     RN+  LSGGEK+ S  +L+ A  +   + +  +DE D  +D 
Sbjct: 984  FSKGALTMLVKTPNDDQPRNVDTLSGGEKSFSQTSLLLATWRPMRSRIIALDEFDVFMDQ 1043

Query: 1355 RNVSI----VANYIKERTKNAQFIV 1375
             N  I    + N + + T+    I+
Sbjct: 1044 VNRQIGTKLIMNKLSKETRTQTIII 1068

>CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058w USO1
            intracellular protein transport protein
          Length = 1980

 Score = 37.4 bits (85), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 4/86 (4%)

Query: 395  KLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRE 454
            K++N  D+ITNL   LEK    N S+    D+L+   +ELE++LK    E  +L  + ++
Sbjct: 1648 KVENFQDEITNLKSSLEK----NDSLSSSHDELKDKFNELETELKRNLTELNKLESENKQ 1703

Query: 455  LDGKNVLNEEKIKNFEKKRDKAEKTL 480
            L  K + +EEK+   EK+   A+KTL
Sbjct: 1704 LSDKVIEHEEKVSMVEKELSTAQKTL 1729

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} similar
            to uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1102

 Score = 37.0 bits (84), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 41/99 (41%), Gaps = 17/99 (17%)

Query: 1272 TLKEMYQMITMGGNAELELVDT-------LDPFSEGVTFSV----------MPPKKSWRN 1314
            +LK  +Q +T          DT          FS G+ F+            P  +  RN
Sbjct: 944  SLKRRWQSLTYAKTDTCVTADTDFKESLRFRNFSGGLNFNFSKETLNMLVKTPNDEKPRN 1003

Query: 1315 ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1353
            +   SGGEK+ S ++L+ A  +   + +  +DE D  +D
Sbjct: 1004 VDTFSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMD 1042

>ZYRO0F16038g Chr6 complement(1315669..1319583) [3915 bp, 1304 aa]
           {ON} similar to uniprot|P12753 Saccharomyces cerevisiae
           YNL250W RAD50 Subunit of MRX complex with Mre11p and
           Xrs2p involved in processing double-strand DNA breaks in
           vegetative cells initiation of meiotic DSBs telomere
           maintenance and nonhomologous end joining
          Length = 1304

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 85/174 (48%), Gaps = 18/174 (10%)

Query: 530 KDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQ-LAESQISLIKEAE--AKLAQEIDQFK 586
           KD++  +++ I +L+ + E + AQ++E + Q++ + E    L K  +   K+  +++  K
Sbjct: 216 KDRSRVMTMNITRLQAKSEEYQAQVKEVEKQLKDITEQSDKLFKSNQDFQKVLSKLESLK 275

Query: 587 QEIETRKQQILQ----------GSKELDSLHSQHKSV----KEEISTGEKECLNARIRLK 632
              +++ +QI +          G +EL++L S   S     +EE+ + EK    ++ +  
Sbjct: 276 NSQQSKLEQIDRLSNSIDPIDLGKEELENLLSNFSSSLTEKEEELRSMEKSLRESKAKAA 335

Query: 633 EMQNILNTQRQKALDARSALSNAENKSKVLTALSR-LQKSGRISGFHGRLGDLG 685
            +QN  N+  Q+  +  ++  N E    VL  L R LQ S  +SGF   L D  
Sbjct: 336 GIQNKCNSLMQRQGELSASKENHERNKSVLRELQRELQTSYALSGFTENLDDFA 389

>KLLA0C17204g Chr3 (1504341..1506647) [2307 bp, 768 aa] {ON} some
           similarities with uniprot|Q06704 Saccharomyces
           cerevisiae YLR309C IMH1 Protein involved in vesicular
           transport mediates transport between an endosomal
           compartment and the Golgi contains a Golgi-localization
           (GRIP) domain that interacts with activated Arl1p-GTP to
           localize Imh1p to the Golgi
          Length = 768

 Score = 37.0 bits (84), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 133/288 (46%), Gaps = 58/288 (20%)

Query: 406 LNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKREL-DGKNVLNEE 464
           L +KLE   +  ++   +++ +R   +EL  KLK+ N   K++L  + EL +  N+L E 
Sbjct: 467 LQEKLETLQNLKSNSNDQVETIRKQCEELSFKLKDAN---KKILSLEDELNENANILQE- 522

Query: 465 KIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEK 524
                   R++   T+  M             L +LQ D  N +KEL            +
Sbjct: 523 --------RNRETTTMRKM-------------LNELQTDKSNRVKELES----------R 551

Query: 525 IKFSLKDKT---NGISLEIAQLEKELEPWNAQLQEKKTQIQ-LAESQISLIKEAEAKLAQ 580
           + F++++K+   N + +E+ +  ++L+    QL++K TQ+Q +   Q+  I++  A    
Sbjct: 552 LHFAVEEKSKIENELQMELTRKSQDLK----QLKQKNTQLQSVNHDQLIKIEQYSA---- 603

Query: 581 EIDQFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEK---ECLNARIRLKEMQNI 637
           EI++ K   E  K+      ++   L S  KS+KE +   EK   E +N  + LKE+ N 
Sbjct: 604 EIEELKSTFERMKRSNNVSQEDTSELDSIVKSLKEALVKSEKKQREIMNTNVELKELNND 663

Query: 638 LNTQRQKALDARSALSNAENKSKVLTALSRLQ-KSGRISGFHGRLGDL 684
           LN    K  D  S   N +N S  ++    L+ KS R S    R G +
Sbjct: 664 LN----KKFDRLSK--NYKNLSLQISKTKDLEPKSARSSPHPSRSGSI 705

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score = 36.6 bits (83), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 37/72 (51%), Gaps = 10/72 (13%)

Query: 1297 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1356
            F EGV   V P     R  T LSGG+K   +LA  F LH      L ++DE  +ALD ++
Sbjct: 572  FPEGVNTLVGP-----RG-TQLSGGQKQRIALARAFLLHP----ALLILDEATSALDSQS 621

Query: 1357 VSIVANYIKERT 1368
              IVA  + ER 
Sbjct: 622  EEIVAKNLSERV 633

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1102

 Score = 36.2 bits (82), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1370
            R++  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I    I +  K+  
Sbjct: 1002 RDVDTLSGGEKSFSQMALLLATWAPMRSRITALDEFDVFMDQVNRKIGTGLIVKTLKDNA 1061

Query: 1371 -AQFIVIS 1377
              Q I+I+
Sbjct: 1062 RTQTIIIT 1069

>Kwal_56.23745 s56 complement(686641..687162) [522 bp, 173 aa] {ON}
           YDR121W (DPB4) - DNA polymerase II (epsilon) 4th subunit
           [contig 173] FULL
          Length = 173

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 702 LEDIVVETVECGQQCIEYLRKNKL-GYARFILLDKLRKFNLDSINTPES 749
           ++D++   V+CG + +E L ++KL  Y R + L K  K  L+S ++PE+
Sbjct: 95  VDDVLSALVDCGMEGLEMLVRSKLDAYQRALELRKSEKGGLNSKDSPEA 143

>CAGL0B00924g Chr2 complement(81492..82808) [1317 bp, 438 aa] {ON}
           similar to uniprot|P11709 Saccharomyces cerevisiae
           YCL029c BIK1 nuclear fusion protein
          Length = 438

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 87/180 (48%), Gaps = 20/180 (11%)

Query: 409 KLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKN 468
           ++EK+  +    +K L+  R   +E++  +    N E++L  + +EL+ +     EK K+
Sbjct: 183 RIEKQEREILQYRKLLEDQRIVLEEIQPTIDEYENNERRLRSRVQELETELDKQREKFKS 242

Query: 469 ----FEKKRDKAEKTLSSMDRSISSSE----ARLSELKQLQVDYENSLKELNEQTEVEKM 520
               FE + ++    +S +  +I  +E    +R   L++   +   ++++L ++ E  + 
Sbjct: 243 QKEFFEAEHEQLLAVVSQLQVAIEENEQKAISRKESLREDTTEITKTIQDLTDEHERARA 302

Query: 521 KLEKIKFSLKDKTNGISLEIAQLEKEL------------EPWNAQLQEKKTQIQLAESQI 568
           K EK K  LK   + +S E   L KEL            +  N++L E +T+++  ESQ+
Sbjct: 303 KWEKEKMQLKMHNDSLSQEYQSLNKELMNMQGQKSNPPTDELNSELTELRTRVRTLESQL 362

>KAFR0G02780 Chr7 (577037..579172) [2136 bp, 711 aa] {ON} Anc_7.166
           YER015W
          Length = 711

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 63/139 (45%), Gaps = 8/139 (5%)

Query: 338 SLNDICIEKEN-RFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKL 396
           S  D+    EN R  I+DR KN  +  + E   ++  E+   +  S L     +N     
Sbjct: 536 STGDVGFVDENGRLHIIDRVKNFFKLSQGE---YIAPEK---IENSYLSSCPFINQIFIY 589

Query: 397 KNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGK-KREL 455
            N+ +        ++ E  K+  V K+L   +A  +EL   L N    ++QLL    + L
Sbjct: 590 GNSFESYLIGILSIDPEIVKSLLVGKKLISPKATIEELIDLLNNDKFLKRQLLSLINKTL 649

Query: 456 DGKNVLNEEKIKNFEKKRD 474
           +GKN+L+ EKI NF    D
Sbjct: 650 EGKNLLSFEKIHNFYVGVD 668

>Skud_3.157 Chr3 (247977..248549) [573 bp, 190 aa] {ON} YCR086W
           (REAL)
          Length = 190

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 34/58 (58%)

Query: 504 YENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQI 561
           Y+NSLK+  +  ++    L    F L +K +  S EI QL+K+++  N Q+ + KTQ+
Sbjct: 7   YKNSLKQQIDSADLLVANLVNENFMLSEKLDAKSSEIKQLQKQIDSLNGQMTDLKTQV 64

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1364
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1002 RNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMI 1053

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
            Ashbya gossypii AER044W
          Length = 1102

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 1313 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1370
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I ++  +  
Sbjct: 1001 RNVDTLSGGEKSFSQITLLLSTWSTMRARVIALDEFDVFMDQVNRTIGTKMIMKKLSSNI 1060

Query: 1371 -AQFIVIS 1377
              Q I+I+
Sbjct: 1061 RTQTIIIT 1068

>KAFR0D00420 Chr4 complement(60057..62420) [2364 bp, 787 aa] {ON}
            Anc_1.45 YCL030C
          Length = 787

 Score = 34.3 bits (77), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 44/77 (57%), Gaps = 11/77 (14%)

Query: 984  QKKERSVIKKTENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSV 1043
            +KKE S+++K         K+K++TS+D   F Q +++  + IEG+Q ++ +  +  + +
Sbjct: 326  KKKEDSIVEK---------KLKIDTSKDEPVFLQVVES--SDIEGVQGAVTRPIQKTSEI 374

Query: 1044 QHTKEGLIEESRTLEDK 1060
             H  + +IE  +T  DK
Sbjct: 375  MHLVQPIIENVKTNGDK 391

>CAGL0I08569g Chr9 (835234..837567) [2334 bp, 777 aa] {ON} similar
           to uniprot|P40094 Saccharomyces cerevisiae YER157w SEC34
          Length = 777

 Score = 33.9 bits (76), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 47/85 (55%), Gaps = 4/85 (4%)

Query: 443 NEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQV 502
           +E +++  K+ +L+ +N L  E++K FE      +  +  ++ + S S  R    K + V
Sbjct: 130 DETREIHEKRDKLEAQNRLVPEQLKYFEA----LDPIIRRLNHATSPSIVRKESFKNMMV 185

Query: 503 DYENSLKELNEQTEVEKMKLEKIKF 527
             +NSL+ L+E ++ ++ +  +IKF
Sbjct: 186 KIDNSLEYLHEHSDFKEAETYRIKF 210

>ZYRO0A07524g Chr1 (615902..619174) [3273 bp, 1090 aa] {ON} highly
            similar to uniprot|P15436 Saccharomyces cerevisiae
            YDL102W CDC2 Catalytic subunit of DNA polymerase delta
            required for chromosomal DNA replication during mitosis
            and meiosis intragenic recombination repair of double
            strand DNA breaks and DNA replication during nucleotide
            excision repair (NER)
          Length = 1090

 Score = 33.9 bits (76), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 9/71 (12%)

Query: 1341 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG 1391
            PLYV++   +ID+     N      +SIVA  + E+  NA F+V S++ N   +   L+G
Sbjct: 935  PLYVLEHNMQIDSRYYLTNQLQNPIISIVAPILGEKQANAMFVVKSIKINTGNMKGGLMG 994

Query: 1392 IYKRDNKTKSA 1402
              K+ +  K+ 
Sbjct: 995  FVKKVDSCKNC 1005

>YHR023W Chr8 (151666..157452) [5787 bp, 1928 aa] {ON}  MYO1Type II
            myosin heavy chain, required for wild-type cytokinesis
            and cell separation; localizes to the actomyosin ring;
            binds to myosin light chains Mlc1p and Mlc2p through its
            IQ1 and IQ2 motifs respectively
          Length = 1928

 Score = 33.9 bits (76), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 64/119 (53%), Gaps = 25/119 (21%)

Query: 1005 KLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDI 1064
            KLE +++LE  +Q+IQ L+ TI   + +L K+H               ++  L  +++D+
Sbjct: 947  KLEVAQNLEEAHQKIQGLQETIREREATLEKLHS--------------KNNELIKQISDL 992

Query: 1065 NEDIA-------IFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLG----DLKIRDVT 1112
            N DI+       + K  +++++NE+++L  +    ++EIK + +KL     DL I+ VT
Sbjct: 993  NCDISKEQSSQSLIKESKLKLENEIKRLKDVINSKEEEIKSFNDKLSSSEEDLDIKLVT 1051

>TBLA0I02900 Chr9 complement(687092..692476) [5385 bp, 1794 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1794

 Score = 33.9 bits (76), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 66/269 (24%), Positives = 132/269 (49%), Gaps = 56/269 (20%)

Query: 386  QYHILNSNMKLKNTLDKITNLNQKLEKESDKNAS-----------VKKEL-DKLRAFG-- 431
            + H+   + K++N  +KI N+  KL+ +++ N S           +KKEL  K +A G  
Sbjct: 1478 ELHLAKEDAKIQN--EKIKNIELKLKTQANSNESKLKDYMGNIDSLKKELLGKEKALGIL 1535

Query: 432  -DELESKLKNCNNEEKQLLGKKRELDGKNV-LNEEKIKNFEKKRDKAEKTLSSMDRSISS 489
              +LES+L   + ++ ++   +++L   N+ LNE+++   EK    A + L+++      
Sbjct: 1536 QSQLESQLSVVSEKDTEIADIRKQLKNSNIKLNEKEVS--EKLAKSAAEDLAAI------ 1587

Query: 490  SEARLSELKQ----LQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEK 545
             E+ LS++K+    L+ DY+  +K +   T +E +KL + K +L +  + +  ++  LE 
Sbjct: 1588 KESELSKIKEDMKTLRSDYDGKIKVI---TSLE-LKLSEFK-TLSEDYSSLKDKLGNLEN 1642

Query: 546  ELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKELDS 605
            +L+   A  QEKKT                     E  ++KQ +E   ++  + + +L +
Sbjct: 1643 DLKDSKASFQEKKT---------------------EAAEYKQTVENLAKEKEKLTNDLSN 1681

Query: 606  LHSQHKSVKEEISTGEKECLNARIRLKEM 634
            L  +  S +  I   +KE + A+ R +E+
Sbjct: 1682 LTERVNSCETAIQLKDKEAIEAKNRHEEL 1710

>Suva_3.122 Chr3 (180777..181349) [573 bp, 190 aa] {ON} YCR086W
           (REAL)
          Length = 190

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 36/58 (62%)

Query: 504 YENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQI 561
           Y+NS+K+  +  ++    L    F L +K N  S EI QL+K+++  NAQ+++ +TQ+
Sbjct: 7   YKNSVKQQIDSADLLVANLVNENFILSEKLNTDSSEIKQLQKQIDSLNAQVKDLETQV 64

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
            uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
            protein CIN8 and some similarites with YEL061C
            uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
            Kinesin motor protein involved in mitotic spindle
            assembly and chromosome segregation
          Length = 965

 Score = 33.5 bits (75), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 61/125 (48%), Gaps = 1/125 (0%)

Query: 993  KTENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIE 1052
            K++  I  SH    E   D+EN+  EIQ  +  IE L      +H+   S Q T E    
Sbjct: 464  KSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRL 523

Query: 1053 ESRTLEDKLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVT 1112
            + R L+  ++ + E I +    E+E+ N + KL     +++  +K +E+    L+  D+ 
Sbjct: 524  QIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQ-SDIQ 582

Query: 1113 QILHD 1117
            ++L+D
Sbjct: 583  KMLYD 587

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
            CIN8Kinesin motor protein involved in mitotic spindle
            assembly and chromosome segregation
          Length = 1000

 Score = 33.5 bits (75), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 52/89 (58%), Gaps = 1/89 (1%)

Query: 1003 KMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLN 1062
            K KL++   +++ N +I++LKTTI+ L+  L+K H++   +      L + +  ++  L+
Sbjct: 556  KDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEVMQMALH 615

Query: 1063 DINE-DIAIFKSFEMEMKNELEKLNSLSF 1090
            D  + ++ + + FEM +  E++KL S  F
Sbjct: 616  DYKKRELDLNQKFEMHITKEIKKLKSTLF 644

>KAFR0C03340 Chr3 (680435..682924) [2490 bp, 829 aa] {ON} Anc_8.71
           YFL004W
          Length = 829

 Score = 33.5 bits (75), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 68/160 (42%), Gaps = 28/160 (17%)

Query: 522 LEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQE 581
           LEK+     DK N +  ++  LEKE         E K + QL       I E     A+E
Sbjct: 57  LEKVYTFQVDKYNNLMDKLTHLEKETS------TEDKVR-QLDPDTFQRILEDALSEAKE 109

Query: 582 IDQFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQ 641
           +D F +   T   +I+   K+ D LHSQ+ SVK  +          ++RLKE+    +++
Sbjct: 110 LDNFSRLNYTGFMKIV---KKHDKLHSQYPSVKSLL----------QVRLKELP--FHSE 154

Query: 642 RQKALDARSAL------SNAENKSKVLTALSRLQKSGRIS 675
               +  R +        N    SK L + SRL   G IS
Sbjct: 155 EYSPVLYRISFLYTILRCNFSTISKSLASTSRLSNVGSIS 194

>Skud_4.408 Chr4 (727248..733340) [6093 bp, 2030 aa] {ON} YDR150W
           (REAL)
          Length = 2030

 Score = 33.5 bits (75), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 28/44 (63%)

Query: 405 NLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQL 448
           +LN K+E  + +N S  KELD ++    +LESKL N + E KQL
Sbjct: 134 SLNDKIENLNSQNNSFMKELDSIKDLNWDLESKLTNLSMECKQL 177

>Kwal_27.9900 s27 complement(113903..115405) [1503 bp, 500 aa] {ON}
            YGR211W (ZPR1) - zinc finger protein [contig 43] FULL
          Length = 500

 Score = 33.1 bits (74), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 4/72 (5%)

Query: 983  KQKKERSVIKKTENEINKSHKMK---LETSRDLENFNQEIQTLKTTIEGLQDSLNKVHES 1039
            +QK+E    +  + E N S   K   L    D+ENFN E+QT   T      S +  H  
Sbjct: 263  EQKREEQRAQLADKERNPSVAQKPQFLSDETDIENFNNEVQTFSATCPSCMQSCD-THMK 321

Query: 1040 VTSVQHTKEGLI 1051
              ++ H KE +I
Sbjct: 322  PVNIPHFKEVII 333

>KLLA0C09691g Chr3 (837629..840094) [2466 bp, 821 aa] {ON} weakly
           similar to uniprot|P33420 Saccharomyces cerevisiae
           YPL174C NIP100 Large subunit of the dynactin complex
           which is involved in partitioning the mitotic spindle
           between mother and daughter cells putative ortholog of
           mammalian p150(glued)
          Length = 821

 Score = 33.1 bits (74), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 139/294 (47%), Gaps = 62/294 (21%)

Query: 425 DKLRAFGDELESKLKNCNNE----EKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTL 480
           ++L+     LE KLK+ N++    EK+L  + +EL+    L EE+++     RD+AE+  
Sbjct: 98  ERLKKIIGRLEVKLKSVNDKCISFEKELGLRSKELEKVQFL-EEQLEKLTLGRDEAEQRN 156

Query: 481 SSMDRSISSSEARLSELKQLQVDYENSLKELNEQTE-----------VEKMKLEKIKFSL 529
            S+          + EL+ L + +E++LKELN+  E           V   ++E ++   
Sbjct: 157 DSL----------IFELESLTIAHESALKELNDYKEEILIRRKADVDVNTDQIESVESDA 206

Query: 530 KDKTNG-ISLEIAQLEKELEPWNAQL-------QEKKTQIQLAESQISLIKEAEAKL--- 578
             K N  +++ + +L+ +L     Q        +E +TQ   AE+ +  I   E+KL   
Sbjct: 207 LIKQNRLLTVALQKLQSDLTEIQKQCNGLKNSNEELQTQ---AETYLRTISALESKLFET 263

Query: 579 AQEIDQFKQE----------IETRKQQILQGSKELDSLHSQHKSVKE-EISTGEKECLNA 627
            + +D+ KQ           IE+   +  Q S ELD L S+   +K+ +++  E E L  
Sbjct: 264 TKTLDELKQHFSANSNSNNIIESLTTENHQLSTELDCLKSELLKLKQTQLADEELEAL-- 321

Query: 628 RIRLKEMQNILNTQ---RQKALDARSALSNA--ENKSKVLTALSRLQ-KSGRIS 675
               KE+++ LN+Q    Q+ L    ++ NA  EN   +   L  LQ KSG+ S
Sbjct: 322 ---YKEVESELNSQIAKLQETLSTDESIINALKENNKTLKNELQSLQNKSGQYS 372

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score = 33.1 bits (74), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 64/216 (29%), Positives = 100/216 (46%), Gaps = 40/216 (18%)

Query: 377 LTVSKSKLY----QYHILNSNMKLKN-TLDKITNLNQKLEKESDKN--ASVKKELDKLRA 429
           L V KSKL     QY +LNS  K K    DK+      LEK++ +N  ++ KKE++ L  
Sbjct: 100 LYVKKSKLDTLKDQYEMLNSTYKEKKLKWDKLY-----LEKQNKQNQLSTKKKEIEVLND 154

Query: 430 FGDELESKLKNCNNEEKQLLGKKRE----------LDGKNVLNEEKIKNFEKKRDKAEKT 479
             DE   +LK  +    + L  K +          L   N L  +K K F+ +RD  +K 
Sbjct: 155 KNDEKIKQLKKGHELHMEQLKIKNQGEINKLQNEYLIKINQLKHQKEKKFQDERDNLQKE 214

Query: 480 LSSMDRSISSSEARLSEL------------KQLQVDYENSLK---ELNEQ--TEVEKMKL 522
           +  ++R I S++A L++L            +   +DY+N  K   E NE+   E+   KL
Sbjct: 215 VIKLERRIDSNDAILNDLLNDLKIKYDKLKETWLIDYQNEWKQNIEKNERYSNEINDFKL 274

Query: 523 EKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKK 558
            K+   L  +   ++  +  LE E+   NA L +KK
Sbjct: 275 -KLGNDLTPRIEKLNNTVNNLENEITTLNATLIDKK 309

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR188W
            (MDL1)
          Length = 677

 Score = 33.1 bits (74), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 11/82 (13%)

Query: 1297 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1356
            F EG+  +V P        T LSGG+K   +LA  F     +   + ++DE  +ALD ++
Sbjct: 555  FPEGLQTAVGP------RGTQLSGGQKQRVALARAF----LQDPAILILDEATSALDSKS 604

Query: 1357 VSIVANYIKERTKNAQFIVISL 1378
              IVA+ + +R + A+ I IS+
Sbjct: 605  EDIVASTLLQRCQEAK-ITISI 625

>YCR086W Chr3 (263392..263964) [573 bp, 190 aa] {ON}  CSM1Nucleolar
           protein that forms a complex with Lrs4p and then Mam1p
           at kinetochores during meiosis I to mediate accurate
           homolog segregation; required for condensin recruitment
           to the replication fork barrier site and rDNA repeat
           segregation
          Length = 190

 Score = 32.0 bits (71), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 35/57 (61%)

Query: 504 YENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQ 560
           Y+NS+K+  +  ++    L    F L +K +  + EI QL+K+++  NAQ++E KTQ
Sbjct: 7   YKNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQ 63

>Kwal_23.4010 s23 complement(525504..528128) [2625 bp, 874 aa] {ON}
           YGR089W - putative partner of Rpb8p [contig 255] FULL
          Length = 874

 Score = 33.1 bits (74), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 106/231 (45%), Gaps = 44/231 (19%)

Query: 372 ENERKLTVSKSKLYQYHILNSNMKLKNT-LDKITNLNQKLEKESDKNASVKKELDKLRAF 430
           E ++ L  S    Y    L+  + LK++ L   TNL ++  K       + K+L  LR  
Sbjct: 634 ETKKPLDFSFPSYYHRKFLSPVLTLKHSVLTTNTNLAEERAKLKKNKKEISKKLSTLRQQ 693

Query: 431 GDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSS 490
            D L+SK           + +    DGKN L  + +KN                  +  S
Sbjct: 694 IDHLKSK-----------ISQNASQDGKNALKMDNLKNV-----------------LQQS 725

Query: 491 EARLSELKQLQVDYENSLKELNEQ-TEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEP 549
           EA+L+ L       E+ LK+L EQ  +VE+  L++    L+++     L+ A LEK++E 
Sbjct: 726 EAQLTRL-------EDELKDLLEQEQQVEREHLQQKDKHLQNQMEYGKLQ-ATLEKDVEE 777

Query: 550 WN---AQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQIL 597
            +    +LQ++ TQ+     ++++ ++   KL +E+ Q  +++E  K Q L
Sbjct: 778 HSLKLVKLQQELTQLIAKRDKMNVKQQ---KLRKEVSQCTEDMENFKSQFL 825

>NCAS0A02230 Chr1 (418098..419582) [1485 bp, 494 aa] {ON}
          Length = 494

 Score = 32.7 bits (73), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 43/80 (53%), Gaps = 5/80 (6%)

Query: 846 NLVEREKNFQVASDTIYQMEE-----QLKDLKEKEPAIENNISQLTMEIESWNSEIKIKE 900
           +L+ER+ NF+   D +  +EE       + LK+ +  + ++I Q+T  I+    E ++ E
Sbjct: 408 DLLERQLNFKKKYDDLLTVEEGKYQEWAQGLKKTQEEVNHDIKQMTETIQLLQLECEVLE 467

Query: 901 IQMLESERAYSATQDNNVEL 920
            Q+L  +R     +D+NV L
Sbjct: 468 DQLLNGKRTRIYPEDSNVTL 487

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score = 32.7 bits (73), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 74/144 (51%), Gaps = 25/144 (17%)

Query: 329 IEKNLADMESLN--------DICIEKENRFQIVDR-EKNSLENGKEEALLFLENERKLTV 379
           I+  +AD+E +N        +I   ++ +  I+D+ EKN+L +         ENE+ +  
Sbjct: 507 IDAKVADLEEVNVKQKNTQEEINKLQQQKVDILDQIEKNNLTHA--------ENEKVIEG 558

Query: 380 SKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKLK 439
           +K+K Y   +   + ++   L ++T + Q    E  + +++ K+LDK R    E E KLK
Sbjct: 559 AKNKTYLPKLNEVDNQISVLLGQLTTIRQHCANERTELSAITKKLDKERL---EHEEKLK 615

Query: 440 ----NCNNEEKQLLGKKR-ELDGK 458
               N   +E+ LLGK+R EL+ K
Sbjct: 616 LEAENRRRKEEDLLGKQRKELEAK 639

>KNAG0B03300 Chr2 complement(639238..640590) [1353 bp, 450 aa] {ON}
           Anc_5.598 YHR011W
          Length = 450

 Score = 32.7 bits (73), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 56/117 (47%), Gaps = 19/117 (16%)

Query: 485 RSISSSEARLSELKQLQVDYENSLKELNEQTE----------------VEKM--KLEKIK 526
           RS + + A  + LK+  +D +  L  +NE  E                +EK+  K +KIK
Sbjct: 9   RSFAITRAPRTFLKKPHIDIKYVLAHINEYNESIKKRGLVAENELLANLEKLPEKYDKIK 68

Query: 527 FSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEID 583
            SL D+ N +     QLEK ++     L E   QI+  +SQ  ++ E +  L++EI+
Sbjct: 69  -SLNDQINHVQKARNQLEKTVQANKTSLNELIPQIRDLKSQFKVLMETKNDLSKEIE 124

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa] {ON}
            similar to uniprot|P33310 Saccharomyces cerevisiae
            YLR188W MDL1 Half-type ATP-binding cassette (ABC)
            transporter of the inner mitochondrial membrane mediates
            export of peptides generated upon proteolysis of
            mitochondrial proteins plays a role in the regulation of
            cellular resistance to oxidative stress
          Length = 714

 Score = 32.7 bits (73), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 41/81 (50%), Gaps = 6/81 (7%)

Query: 1318 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS 1377
            LSGG+K   +LA  F L       L V+DE  +ALD ++  IVA  ++ER +      IS
Sbjct: 590  LSGGQKQRVALARAFLLDPA----LLVLDEATSALDSQSEEIVARTLQERVRRG-LTTIS 644

Query: 1378 LRNNMFELAQQL-VGIYKRDN 1397
            + + +  +A    V +  RD 
Sbjct: 645  IAHRISTIAHSTRVVVLGRDG 665

>ZYRO0F15378g Chr6 (1257918..1260704) [2787 bp, 928 aa] {ON} weakly
           similar to uniprot|Q07732 Saccharomyces cerevisiae
           YDL239C ADY3 Protein required for spore wall formation
           thought to mediate assembly of a Don1p- containing
           structure at the leading edge of the prospore membrane
           via interaction with spindle pole body components
           potentially phosphorylated by Cdc28p
          Length = 928

 Score = 32.7 bits (73), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 69/269 (25%), Positives = 134/269 (49%), Gaps = 36/269 (13%)

Query: 371 LENERKLTVSKSKLYQYHILNSNMKLKNTL-DKITNLNQKLEKESDKNASVKKELDKLR- 428
           LENE++  ++     +    N   + +NT+ +KI    Q+LE   +      +ELD LR 
Sbjct: 314 LENEKQKLIADIDSLEAEYDNKTTEFQNTIKEKI----QQLEVSDEALRKKTQELDSLRN 369

Query: 429 ---AFGDELESKL-------KNCNNEEKQLLGKKRELDGKNVLNEEKIKNFE---KKRDK 475
                 DEL +KL       KN  +++ +L GK +EL       E++ +N +   K +D+
Sbjct: 370 DMCKKNDELANKLEELEEVRKNLKDKDSELAGKSKELQELQSKCEQRERNLQNDLKSKDE 429

Query: 476 AEKTLSSM----DRSISSSEARLSELKQL--QVDYENSLKELNEQTEVEKMKLEKIKFSL 529
               LS +    D++IS  + R++EL  L  Q D + S K+   + +V ++K  + KFS 
Sbjct: 430 RINVLSDLLKQRDQNISHKDERITELSDLLKQRDQDISHKDEENRQKVRELKALEAKFSE 489

Query: 530 KDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQI-SLIKEAEAKLAQEIDQFKQE 588
           K+       E ++  K+ +     LQE + ++  A+SQ+   ++++E +  +  D+F ++
Sbjct: 490 KND------EFSRKSKDFDL----LQESRKEVLSAKSQVEQQLRKSEIQTKKVEDRFHRQ 539

Query: 589 IETRKQQILQGSKELDSLHSQHKSVKEEI 617
                +QI Q  + L+    +H ++K+++
Sbjct: 540 RMDYNEQIKQLQQSLEDEKKRHDNLKDKM 568

>Ecym_8231 Chr8 complement(471639..477203) [5565 bp, 1854 aa] {ON}
            similar to Ashbya gossypii ACR068W
          Length = 1854

 Score = 32.7 bits (73), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 62/301 (20%), Positives = 128/301 (42%), Gaps = 44/301 (14%)

Query: 394  MKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKR 453
            +K ++TL    +L+Q      ++ +  + +L +LR F DE  +K+K   +E+ QLL    
Sbjct: 877  VKFRDTLKSEESLSQ------EEYSKFQDDLKQLRNFRDESTAKIKQLESEKAQLLN--- 927

Query: 454  ELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELK---QLQVDYENSLKE 510
                       +IK  + + D  EK  +  +   ++ E  L +L+   +++V   + L+ 
Sbjct: 928  -----------QIKTMKSEADSGEKYENKYNAEKAALEEELKKLQNELRIKVKKSSDLEA 976

Query: 511  LNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISL 570
                + VE          LK K   +   ++   + LE   ++ +  K +++ A  +   
Sbjct: 977  AANNSNVE----------LKTKVQQLERGVSSTSRRLEDLVSENKTLKFELERARKEHQD 1026

Query: 571  IKEAEAKLAQEIDQFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIR 630
                 A   +E+ +  +  E  K Q+   +KE DSL + ++S+  E+     E    + +
Sbjct: 1027 AHRHLASKTKELARLTERFEVEKAQVTALTKERDSLITGNESITSELRQSRTEANEFKKK 1086

Query: 631  LKEMQNILNTQRQKAL----DARSALSNAENKSKVL-------TALSRLQKSGRISGFHG 679
             +E++    + ++        +   L N ENK  +L        A++R      +S FHG
Sbjct: 1087 FEELKPSAESTKEDLFMPSPSSPGGLINIENKVNILEDELAKERAMNRFLNEKLLSNFHG 1146

Query: 680  R 680
            +
Sbjct: 1147 K 1147

>NCAS0I00130 Chr9 (9673..14376) [4704 bp, 1567 aa] {ON} Anc_7.68
            YAL029C
          Length = 1567

 Score = 32.7 bits (73), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 57/113 (50%), Gaps = 17/113 (15%)

Query: 985  KKERSVIKKTENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLN-KVHESVTSV 1043
            K E  VI+ T+N        K++ +R L    +E+Q    T+  LQD L  +  E+  ++
Sbjct: 947  KLENKVIQLTQN-----LAAKVKENRQLSKRLEELQATMVTVSELQDQLEAQKMENQKAL 1001

Query: 1044 QHTKEGLIEESRTLEDKLNDINEDI-----------AIFKSFEMEMKNELEKL 1085
               K+G + +S++L+D+L   N+D+           A +   E E KN+L++L
Sbjct: 1002 ADQKDGFVLDSKSLKDQLIKANKDVESVKFELATLTAKYTEMEAESKNQLDEL 1054

>Smik_14.85 Chr14 (154519..158457) [3939 bp, 1312 aa] {ON} YNL250W
           (REAL)
          Length = 1312

 Score = 32.7 bits (73), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 62/123 (50%), Gaps = 8/123 (6%)

Query: 833 EIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEIESW 892
           EI+ + +  +   NL   +K+  V    + Q  E LK  K++   +  NI QL  +I+ +
Sbjct: 177 EIFQAMKFTKALDNLKSIKKDMSVDIKLLKQSVEHLKLDKDRSKGMMLNIHQLQTKIDQY 236

Query: 893 NSEIKIKEIQMLE----SERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRI 948
           N E+   EIQ+ E    S++ + + QD     ++ +  V++LK+   SI +Q K   + I
Sbjct: 237 NEEVSQIEIQLNEITGKSDKLFKSNQD----FQKILSKVENLKNTKVSISDQVKRLSNSI 292

Query: 949 ETL 951
           + L
Sbjct: 293 DIL 295

>NDAI0D04420 Chr4 (1033897..1039641) [5745 bp, 1914 aa] {ON} Anc_4.238
            YDL058W
          Length = 1914

 Score = 32.7 bits (73), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 95/202 (47%), Gaps = 21/202 (10%)

Query: 922  ETIQHVQ----SLKDEFKSIQNQTKSK----KHRIETLKNEIMEIGGAELKIQSSKVDSV 973
            ET + +Q     LK+E + +Q  ++S     + +++T+  E  E  G  LK       ++
Sbjct: 712  ETFEEIQLKCNDLKNEIQELQTSSRSSIDSLQLKLDTITKEFEETSG-NLKTYELNNSNL 770

Query: 974  IQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSL 1033
              ++  + S+  + +  +KK  +E  + +K+K E  + LE  N++IQ L T +  +Q  L
Sbjct: 771  QAKLSQLESELNEAKETLKKVNDECRELNKLKNENLQKLEKDNKKIQDLDTKLHKVQQEL 830

Query: 1034 -------NKVHESVTSVQHTKEGLIEESRTLEDKLNDINEDIAI-FKSFEMEMKNELEKL 1085
                    K H+ +  +     GL  E + LE K   +  D+ I   +F+ E KN   KL
Sbjct: 831  KISSEAKKKAHDDINKMSRDLIGLSREKQELEGKCGSLERDMKIKSNNFDQE-KN---KL 886

Query: 1086 NSLSFHLKKEIKHYEEKLGDLK 1107
            N       KEI+   +KL +LK
Sbjct: 887  NQKIQEKSKEIETLNKKLEELK 908

>Smik_4.176 Chr4 (322038..327425) [5388 bp, 1795 aa] {ON} YDL058W
            (REAL)
          Length = 1795

 Score = 32.7 bits (73), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 116/230 (50%), Gaps = 24/230 (10%)

Query: 425  DKLRAFGDELESKLKNC----NNEEKQLLGKKRELDGKN----VLNEEKIKNFEKKRDKA 476
            DKL    +E ESK K      N+ E+  L K   L+ K     +LN+E I ++++K  + 
Sbjct: 1393 DKLMILQNENESKTKQIDAVRNDLERATLSKDELLEEKRNEIKILNDE-ILSYKEKLSET 1451

Query: 477  EKTLSSMDR----SISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDK 532
             K L S +R    +I S   +L  LK+ +   E  LK + +++  +K +LEK K ++K  
Sbjct: 1452 NKGLLSKERENKQNIESLREQLRTLKESKTKVEEGLKVIEQKSATQKAELEKSKETVKTL 1511

Query: 533  TNGISLEIAQLEKELEPWNAQLQEKKTQIQL----AESQISLIKEAEAKLAQEIDQFKQE 588
             + I       EKEL+     ++E   +++     AE +I  ++  ++ L  +I + K+E
Sbjct: 1512 ESTIKCN----EKELKSSMKVMKESDEKLEQCRKSAEEEIKNLQNEKSTLETQIKESKKE 1567

Query: 589  IE--TRKQQI-LQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQ 635
            IE   RK +I  + + EL+++  Q     E+++   KE    + +LK+++
Sbjct: 1568 IEELERKLKIEAKSTTELETIEQQLSKANEKLNVNRKEDALLKSKLKDLE 1617

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.129    0.343 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 139,608,052
Number of extensions: 6380536
Number of successful extensions: 53436
Number of sequences better than 10.0: 2925
Number of HSP's gapped: 45175
Number of HSP's successfully gapped: 6598
Length of query: 1413
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1291
Effective length of database: 39,492,147
Effective search space: 50984361777
Effective search space used: 50984361777
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 72 (32.3 bits)