Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C01694g8.260ON30063006154120.0
TDEL0F038708.260ON2942303578710.0
NCAS0B050108.260ON2952304370870.0
Smik_12.1468.260ON2958304970830.0
Suva_10.1718.260ON2958304570670.0
YLR087C (CSF1)8.260ON2958304770560.0
Skud_12.1558.260ON2959305070410.0
NDAI0B019808.260ON2959304368580.0
KAFR0B027208.260ON2982304666640.0
KNAG0G020308.260ON2998308165020.0
CAGL0L12210g8.260ON2981305763210.0
Kpol_392.78.260ON2995306661050.0
SAKL0H17072g8.260ON2997309553530.0
TBLA0E044208.260ON3148260153460.0
TPHA0J007308.260ON3046292151950.0
KLTH0G13728g8.260ON2966308746080.0
Kwal_YGOB_56.238088.260ON2941309443670.0
Kwal_56.23810singletonOFF2763284240400.0
Ecym_43108.260ON2943160622940.0
KLLA0F19096g8.260ON2923159619940.0
AGR088W8.260ON2887155819490.0
Kwal_56.23808singletonOFF62601653e-13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C01694g
         (3006 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} simil...  5941   0.0  
TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {...  3036   0.0  
NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {...  2734   0.0  
Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] ...  2732   0.0  
Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] ...  2726   0.0  
YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}...  2722   0.0  
Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] ...  2716   0.0  
NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {...  2646   0.0  
KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {...  2571   0.0  
KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {...  2509   0.0  
CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...  2439   0.0  
Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..1...  2356   0.0  
SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} sim...  2066   0.0  
TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa]...  2063   0.0  
TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] ...  2005   0.0  
KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} sim...  1779   0.0  
Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp,...  1686   0.0  
Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR0...  1560   0.0  
Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar ...   888   0.0  
KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa...   772   0.0  
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...   755   0.0  
Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C...    68   3e-13

>ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} similar to
            uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 3006

 Score = 5941 bits (15412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2899/3006 (96%), Positives = 2899/3006 (96%)

Query: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60
            MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC
Sbjct: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60

Query: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQXXXXXX 120
            KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQ      
Sbjct: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQENLDNE 120

Query: 121  XXXXXXGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVD 180
                  GQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVD
Sbjct: 121  EERLENGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVD 180

Query: 181  DQTMTELFNESEQENKVLSESTPSSVTMETVGXXXXXXXXXXXXXXXAGRNQNDGQAPNN 240
            DQTMTELFNESEQENKVLSESTPSSVTMETVG               AGRNQNDGQAPNN
Sbjct: 181  DQTMTELFNESEQENKVLSESTPSSVTMETVGSNDRNNNEDSNEEEDAGRNQNDGQAPNN 240

Query: 241  LENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPP 300
            LENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPP
Sbjct: 241  LENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPP 300

Query: 301  KEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFLLPTLG 360
            KEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFLLPTLG
Sbjct: 301  KEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFLLPTLG 360

Query: 361  PKHLQTQEDITFRENWKGLSLYRQNMEEDELENVDFDFANHEYARVISILKSAKIVFTYE 420
            PKHLQTQEDITFRENWKGLSLYRQNMEEDELENVDFDFANHEYARVISILKSAKIVFTYE
Sbjct: 361  PKHLQTQEDITFRENWKGLSLYRQNMEEDELENVDFDFANHEYARVISILKSAKIVFTYE 420

Query: 421  YDIPGLVPKEPEETLQGPEVGNSGAPPEFGVDIQLYGANICYGPWAERQLSYLRALLSPV 480
            YDIPGLVPKEPEETLQGPEVGNSGAPPEFGVDIQLYGANICYGPWAERQLSYLRALLSPV
Sbjct: 421  YDIPGLVPKEPEETLQGPEVGNSGAPPEFGVDIQLYGANICYGPWAERQLSYLRALLSPV 480

Query: 481  VSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLRHYVETKEEFRP 540
            VSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLRHYVETKEEFRP
Sbjct: 481  VSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLRHYVETKEEFRP 540

Query: 541  FGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELLLRAKSFDFEAD 600
            FGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELLLRAKSFDFEAD
Sbjct: 541  FGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELLLRAKSFDFEAD 600

Query: 601  MGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPYELFRPFIYRIN 660
            MGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPYELFRPFIYRIN
Sbjct: 601  MGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPYELFRPFIYRIN 660

Query: 661  WNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVANRCTEITYHIS 720
            WNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVANRCTEITYHIS
Sbjct: 661  WNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVANRCTEITYHIS 720

Query: 721  TPMFRXXXXXXXXXXXXEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVDTISVECSSFGT 780
            TPMFR            EFMKNKEVGRSYNFQVNGLYTVFSELDIDNVDTISVECSSFGT
Sbjct: 721  TPMFRLLLNTPPWNTLNEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVDTISVECSSFGT 780

Query: 781  TLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENLGDEHSGFNISSTED 840
            TLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENLGDEHSGFNISSTED
Sbjct: 781  TLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENLGDEHSGFNISSTED 840

Query: 841  VETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGALILPETIYNSDPCIAL 900
            VETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGALILPETIYNSDPCIAL
Sbjct: 841  VETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGALILPETIYNSDPCIAL 900

Query: 901  HFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDNGRQEKSHGYLSSLT 960
            HFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDNGRQEKSHGYLSSLT
Sbjct: 901  HFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDNGRQEKSHGYLSSLT 960

Query: 961  IHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSKIGFGFKNLENILLYE 1020
            IHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSKIGFGFKNLENILLYE
Sbjct: 961  IHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSKIGFGFKNLENILLYE 1020

Query: 1021 TNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFENEAYSQRVDFKFPDI 1080
            TNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFENEAYSQRVDFKFPDI
Sbjct: 1021 TNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFENEAYSQRVDFKFPDI 1080

Query: 1081 NFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREYITLHDSAYYRCSFLL 1140
            NFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREYITLHDSAYYRCSFLL
Sbjct: 1081 NFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREYITLHDSAYYRCSFLL 1140

Query: 1141 PCFFQESVLYKELLGSISPSATXXXXXXXXXAETIDYIIEDCLGEYAPTVKPDDSSSSDT 1200
            PCFFQESVLYKELLGSISPSAT         AETIDYIIEDCLGEYAPTVKPDDSSSSDT
Sbjct: 1141 PCFFQESVLYKELLGSISPSATLPPLPLPVLAETIDYIIEDCLGEYAPTVKPDDSSSSDT 1200

Query: 1201 SEGQRTPLTNEDTRFQANSGFFSPHMPHXXXXXXXXXXXXVLDVEYVNLEVKPSVTGVLL 1260
            SEGQRTPLTNEDTRFQANSGFFSPHMPH            VLDVEYVNLEVKPSVTGVLL
Sbjct: 1201 SEGQRTPLTNEDTRFQANSGFFSPHMPHNPPNNRDRYNNYVLDVEYVNLEVKPSVTGVLL 1260

Query: 1261 NYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVTTSRLHVKDLHFLYDFEEGSGVEL 1320
            NYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVTTSRLHVKDLHFLYDFEEGSGVEL
Sbjct: 1261 NYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVTTSRLHVKDLHFLYDFEEGSGVEL 1320

Query: 1321 ALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISLLEAHPSSISMKPAALQLSIEDL 1380
            ALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISLLEAHPSSISMKPAALQLSIEDL
Sbjct: 1321 ALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISLLEAHPSSISMKPAALQLSIEDL 1380

Query: 1381 ELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQIKVLRDTITSAKELENLRKKTQ 1440
            ELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQIKVLRDTITSAKELENLRKKTQ
Sbjct: 1381 ELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQIKVLRDTITSAKELENLRKKTQ 1440

Query: 1441 KDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVRENRSWRIITRLRHILTYLPNDW 1500
            KDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVRENRSWRIITRLRHILTYLPNDW
Sbjct: 1441 KDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVRENRSWRIITRLRHILTYLPNDW 1500

Query: 1501 RTADHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDLSDITRSYIYKKIFLPQNEDSFKK 1560
            RTADHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDLSDITRSYIYKKIFLPQNEDSFKK
Sbjct: 1501 RTADHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDLSDITRSYIYKKIFLPQNEDSFKK 1560

Query: 1561 ELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNIIVDVLPPSVNTSSENLFKQEKVITL 1620
            ELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNIIVDVLPPSVNTSSENLFKQEKVITL
Sbjct: 1561 ELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNIIVDVLPPSVNTSSENLFKQEKVITL 1620

Query: 1621 TANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLGSISRSASISGFGSQMDRLESSRA 1680
            TANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLGSISRSASISGFGSQMDRLESSRA
Sbjct: 1621 TANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLGSISRSASISGFGSQMDRLESSRA 1680

Query: 1681 SGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIINGKNSMLLENSKENTPPALSAVF 1740
            SGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIINGKNSMLLENSKENTPPALSAVF
Sbjct: 1681 SGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIINGKNSMLLENSKENTPPALSAVF 1740

Query: 1741 FAQRHEIWLKHSTNVLAEVLLKQLHVAATAQLGVIPFVSLNCQATNSFIRAMPSTVVLRN 1800
            FAQRHEIWLKHSTNVLAEVLLKQLHVAATAQLGVIPFVSLNCQATNSFIRAMPSTVVLRN
Sbjct: 1741 FAQRHEIWLKHSTNVLAEVLLKQLHVAATAQLGVIPFVSLNCQATNSFIRAMPSTVVLRN 1800

Query: 1801 SVEKIKRQVEVLIPQFKSHEVKNSSAVTKKTPRIPIKFDIRFNFTDMSSEIMLLSPFYLL 1860
            SVEKIKRQVEVLIPQFKSHEVKNSSAVTKKTPRIPIKFDIRFNFTDMSSEIMLLSPFYLL
Sbjct: 1801 SVEKIKRQVEVLIPQFKSHEVKNSSAVTKKTPRIPIKFDIRFNFTDMSSEIMLLSPFYLL 1860

Query: 1861 QDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSEQFFKFSSTDLQFKCXXXXXXXXXX 1920
            QDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSEQFFKFSSTDLQFKC          
Sbjct: 1861 QDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSEQFFKFSSTDLQFKCEVADEVVPVV 1920

Query: 1921 XXQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHIQKLWNFLRSASGGNDRSPSRNTR 1980
              QISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHIQKLWNFLRSASGGNDRSPSRNTR
Sbjct: 1921 EVQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHIQKLWNFLRSASGGNDRSPSRNTR 1980

Query: 1981 WALDANLKYFGLLVPVSSICYIFELHSLFASLTNANEQYEEYDRHFSGQIVVESCYLLVK 2040
            WALDANLKYFGLLVPVSSICYIFELHSLFASLTNANEQYEEYDRHFSGQIVVESCYLLVK
Sbjct: 1981 WALDANLKYFGLLVPVSSICYIFELHSLFASLTNANEQYEEYDRHFSGQIVVESCYLLVK 2040

Query: 2041 ELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIESSYFRLCLFPELLVDILWSVHYLQSL 2100
            ELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIESSYFRLCLFPELLVDILWSVHYLQSL
Sbjct: 2041 ELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIESSYFRLCLFPELLVDILWSVHYLQSL 2100

Query: 2101 LNHFKKHHTPWLPYSSNKTAKSGESTLDFRSIHILSYNFCVGWLFEVGDNSEPGLILGYD 2160
            LNHFKKHHTPWLPYSSNKTAKSGESTLDFRSIHILSYNFCVGWLFEVGDNSEPGLILGYD
Sbjct: 2101 LNHFKKHHTPWLPYSSNKTAKSGESTLDFRSIHILSYNFCVGWLFEVGDNSEPGLILGYD 2160

Query: 2161 RLFSAYEKHFGKLTLIDGYLSVANGNTSDTFYSQKSEKDSYTRTYLSNMQIFYWLKGENL 2220
            RLFSAYEKHFGKLTLIDGYLSVANGNTSDTFYSQKSEKDSYTRTYLSNMQIFYWLKGENL
Sbjct: 2161 RLFSAYEKHFGKLTLIDGYLSVANGNTSDTFYSQKSEKDSYTRTYLSNMQIFYWLKGENL 2220

Query: 2221 LKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKRFNEMKKAKIKQTGSSTKSKLNMEAAS 2280
            LKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKRFNEMKKAKIKQTGSSTKSKLNMEAAS
Sbjct: 2221 LKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKRFNEMKKAKIKQTGSSTKSKLNMEAAS 2280

Query: 2281 NTLAPFLAHIRTINSQLNFAGGVFKVYSPTELDSKAEPLLEIKSPGVQMAINYEFNETRE 2340
            NTLAPFLAHIRTINSQLNFAGGVFKVYSPTELDSKAEPLLEIKSPGVQMAINYEFNETRE
Sbjct: 2281 NTLAPFLAHIRTINSQLNFAGGVFKVYSPTELDSKAEPLLEIKSPGVQMAINYEFNETRE 2340

Query: 2341 KSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIKNMIRNLSSEDKSHPSKPVTDSIDYKS 2400
            KSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIKNMIRNLSSEDKSHPSKPVTDSIDYKS
Sbjct: 2341 KSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIKNMIRNLSSEDKSHPSKPVTDSIDYKS 2400

Query: 2401 LLNPYDIAFEIASGKQKLSFSCEPKAKVQLDAGFNSFLFRVTTDKVDSVEPFNVSFSMDK 2460
            LLNPYDIAFEIASGKQKLSFSCEPKAKVQLDAGFNSFLFRVTTDKVDSVEPFNVSFSMDK
Sbjct: 2401 LLNPYDIAFEIASGKQKLSFSCEPKAKVQLDAGFNSFLFRVTTDKVDSVEPFNVSFSMDK 2460

Query: 2461 IESSVRHIFSRDSSAAFMLDYIDIVMMFTYPNVYGVALVSDMNIYCNMKQRQNLNIFLDI 2520
            IESSVRHIFSRDSSAAFMLDYIDIVMMFTYPNVYGVALVSDMNIYCNMKQRQNLNIFLDI
Sbjct: 2461 IESSVRHIFSRDSSAAFMLDYIDIVMMFTYPNVYGVALVSDMNIYCNMKQRQNLNIFLDI 2520

Query: 2521 WRLSNRGRTKPSENKAEDKSDAKKXXXXXXXXXXXXXRKVFPWSFTIIFTNMGGVVDLGP 2580
            WRLSNRGRTKPSENKAEDKSDAKK             RKVFPWSFTIIFTNMGGVVDLGP
Sbjct: 2521 WRLSNRGRTKPSENKAEDKSDAKKSLSPPFSPSSNDSRKVFPWSFTIIFTNMGGVVDLGP 2580

Query: 2581 SLGVLTLGLEQVWITTKHQGDQKRTWHTFAHGITVNSEGRLSGMFELDQASSVSEISWPE 2640
            SLGVLTLGLEQVWITTKHQGDQKRTWHTFAHGITVNSEGRLSGMFELDQASSVSEISWPE
Sbjct: 2581 SLGVLTLGLEQVWITTKHQGDQKRTWHTFAHGITVNSEGRLSGMFELDQASSVSEISWPE 2640

Query: 2641 EDLLRVGPLISVSMAINRMSIKSAFDYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSL 2700
            EDLLRVGPLISVSMAINRMSIKSAFDYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSL
Sbjct: 2641 EDLLRVGPLISVSMAINRMSIKSAFDYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSL 2700

Query: 2701 EFESIVLCXXXXXXXXXXDIYNTIMRMQQDNRISYIETLKESNISASSTSVAYEEVLNSL 2760
            EFESIVLC          DIYNTIMRMQQDNRISYIETLKESNISASSTSVAYEEVLNSL
Sbjct: 2701 EFESIVLCATALTAANALDIYNTIMRMQQDNRISYIETLKESNISASSTSVAYEEVLNSL 2760

Query: 2761 NLLRTDMSVIVKELKVHISPMSLFDAEVLVVSVRDVNARSETQSGEKLKTELQLQISDVN 2820
            NLLRTDMSVIVKELKVHISPMSLFDAEVLVVSVRDVNARSETQSGEKLKTELQLQISDVN
Sbjct: 2761 NLLRTDMSVIVKELKVHISPMSLFDAEVLVVSVRDVNARSETQSGEKLKTELQLQISDVN 2820

Query: 2821 AXXXXXXXXXXXXTVSKIAVDDYMLYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLF 2880
            A            TVSKIAVDDYMLYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLF
Sbjct: 2821 ASLSSSKEELDEETVSKIAVDDYMLYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLF 2880

Query: 2881 TCKFFDKISMKWNLGPVNFIKEMWATHVRSLAVRRTQLGNSSPELEVANESDKEDTVKSK 2940
            TCKFFDKISMKWNLGPVNFIKEMWATHVRSLAVRRTQLGNSSPELEVANESDKEDTVKSK
Sbjct: 2881 TCKFFDKISMKWNLGPVNFIKEMWATHVRSLAVRRTQLGNSSPELEVANESDKEDTVKSK 2940

Query: 2941 FIYVPLDEPYIEMPQIKDLGDATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYA 3000
            FIYVPLDEPYIEMPQIKDLGDATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYA
Sbjct: 2941 FIYVPLDEPYIEMPQIKDLGDATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYA 3000

Query: 3001 KLQQRA 3006
            KLQQRA
Sbjct: 3001 KLQQRA 3006

>TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2942

 Score = 3036 bits (7871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1519/3035 (50%), Positives = 2085/3035 (68%), Gaps = 125/3035 (4%)

Query: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60
            M+G+S F++VSL   RNFSWVFLVDWVL C+VTLTVIFYLGR+F + +T +LEW +WK  
Sbjct: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60

Query: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQXXXXXX 120
            KVKI++ESLRIAPL G+I+FRNLCII +D TIS L+G++ WRY L  +R+SQY+      
Sbjct: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120

Query: 121  XXXXXXGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVD 180
                   ++  S      PCRF+L CEG EIF+YN+T +YENII MFS+EER QFEKF+ 
Sbjct: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180

Query: 181  DQTMTELFN-ESEQENKVLSESTPSSVTMETVGXXXXXXXXXXXXXXXAGRNQNDGQAPN 239
             Q M+ELF+  SE+ +                                +  + +    PN
Sbjct: 181  KQEMSELFHCHSERSDD--------------------------KGSTDSVLSSSVSDVPN 214

Query: 240  NLENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCP 299
               ND +F++  + +KS++MRFLP+++   R S+VLGN+FTPS+L+ S  + +G++DLC 
Sbjct: 215  I--NDRVFDEVHNQKKSIFMRFLPMELQLSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQ 272

Query: 300  PKEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFLLPTL 359
            PKEKLDL+K+  + +  D+D S++QNI ++   +T FK   G+LS++W  F ++  +P  
Sbjct: 273  PKEKLDLYKMHFQVDFIDIDISIRQNIEYNRKKAT-FK--NGKLSRMWATFVKVLHIPFY 329

Query: 360  GPKHL-QTQEDITFRENWKGLSLYRQ---NMEEDELENVDFDFANHEYARVISILKSAKI 415
               H  +  E   F   WKGL LY+    + + ++ + V FDFANHEYA+V +I+KS + 
Sbjct: 330  NKSHNNKGTESEPFMTKWKGLGLYKGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRT 389

Query: 416  VFTYEYDIPGLVPKEPEETLQGPEVGNSGAPPEFGVDIQLYGANICYGPWAERQLSYLRA 475
            V TY YDIPG+VP     TL+GPEVGN+GAPPEFG+D+Q YG  ICYGPWA+R++ +L  
Sbjct: 390  VLTYSYDIPGVVPHGAHPTLEGPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLR 449

Query: 476  LLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLRHYVETK 535
            ++SP V+R+  PIKTL+PGS+RIYT+FKT+  +++ S+WRIPTRE+SKDQEFL+ +  T 
Sbjct: 450  MISPTVARSSVPIKTLSPGSRRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATS 509

Query: 536  EEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELLLRAKSF 595
            EE+RPFGW+DLKF  DSYG + TV+CP EEG PN +  HF+ ME  +SVNH+++L+   F
Sbjct: 510  EEYRPFGWLDLKFAMDSYGSVTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCF 569

Query: 596  DFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPYELFRPF 655
            D   D+GYPLGWN  A W INL STQLE F+LREH+TL++D+F DFSSG+PTPYELFRPF
Sbjct: 570  DVAGDVGYPLGWNSSATWTINLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPF 629

Query: 656  IYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVANRCTEI 715
            IY+INW +DGYSIYLNVNDHNIVNNPLDFNENCYLSLHG+ L+ DV  P  ++     ++
Sbjct: 630  IYQINWIIDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDV 689

Query: 716  TYHISTPMFRXXXXXXXXXXXXEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVDTISVEC 775
             Y ISTPMFR            EFMKNKEVGRSY+F V GLYTV+SELDIDNVDT+SVEC
Sbjct: 690  PYKISTPMFRLLLNTPPWNTLNEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVEC 749

Query: 776  SSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENLGDEHSGFNI 835
            +S GTTLHCYGFV+RYLMNVKMNYFGDF HF+T+EEYT     +E ++    +E S  + 
Sbjct: 750  TSTGTTLHCYGFVMRYLMNVKMNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDN 809

Query: 836  SSTEDVETDR---TNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGALILPETIY 892
            S+  ++ TD    ++P  R   +  P   RS++KRT NE DIWF FSVWEGAL+LPETIY
Sbjct: 810  ST--NLSTDSGGLSDPYVRL--RADPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIY 865

Query: 893  NSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDNGRQEKS 952
            N DPC+ALHF EL VDLRS NYYMDLLATM++T +KRYVSR  H+LFE +R+DNGR EK 
Sbjct: 866  NCDPCVALHFGELIVDLRSCNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKE 925

Query: 953  HGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSKIGFGFKN 1012
            HG L++LTIHGHRMYGLPP EPTYFCQWG+D+D L INSD EFAKGF T F+ IGFG+ N
Sbjct: 926  HGSLAALTIHGHRMYGLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTN 985

Query: 1013 LENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFENEAYSQR 1072
            LEN LLY+  T  DMTSVTVRV+++  ++ +   SSR+V+    +TFT+IDFENE YSQR
Sbjct: 986  LENTLLYDVETPDDMTSVTVRVRDMNVVVEN--DSSRAVVDVPNLTFTSIDFENERYSQR 1043

Query: 1073 VDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREYITLHDSA 1132
            +D K P ++ L+   +++ +  R L+ L T++  TDFIQ + FA HR +QR+YITL+DS 
Sbjct: 1044 IDLKVPSLSILLLTSEDDSEPIR-LMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSP 1102

Query: 1133 YYRCSFLLPCFFQESVLYKELLGSISPSATXXXXXXXXXAETIDYIIEDCLGEYAPTVK- 1191
            +YRCSFLLPC+ QES LYK LLGSISPS++         AETID+IIED LGE+A  +K 
Sbjct: 1103 FYRCSFLLPCYLQESPLYKSLLGSISPSSSLPPLPMPLLAETIDFIIEDLLGEFAAGLKC 1162

Query: 1192 ----------PDDSSSS-DTSEGQRTPLTNEDTRFQANSGFFSPHMPHXXXXXXXXXXXX 1240
                      PD  S S DTS+    P      RF       SP+               
Sbjct: 1163 DYDTQRTVDDPDSPSESFDTSQEHEGPDDVRYDRFAQLPKILSPN-------PLEQYDNV 1215

Query: 1241 VLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVTTSR 1300
            ++DV+++ +++ P +   +   L +F+  +T DIID+ E++IVK+LG L +  + V   +
Sbjct: 1216 IIDVKFLAVDLDPLICSYVDGLLGEFWKVNTVDIIDEIEMSIVKRLGQL-WNNTCVLNLK 1274

Query: 1301 LHVKDLHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISLLE 1360
            L+V D++F +  +    V+L  +  DFDL ++T + + E ++ EK   S + ++R ++ +
Sbjct: 1275 LYVVDINFFWGDKNAKVVDLYFDKLDFDLGQRTRDLDGETIVSEKITLSKLRSVRATVFD 1334

Query: 1361 -AHPSSISMKPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQI 1419
             +    +  +P AL L++E  E +S   ++ V SV++ S   T+DESQLE +S Y+  Q 
Sbjct: 1335 RSITEGVEERPPALSLAVEGWEAYSWMREKIVGSVSLLSTDITVDESQLEWLSVYIAEQR 1394

Query: 1420 KVLRDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVRE 1479
             ++++ +TS  +L    + T++DL+ D+T+ASE+YQISH+PYVITKPAFIMRLS GHVRE
Sbjct: 1395 DLIKNMLTSFTKLHEYWQGTRRDLLRDITTASEHYQISHEPYVITKPAFIMRLSNGHVRE 1454

Query: 1480 NRSWRIITRLRHILTYLPNDWRTADHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDLSD 1539
            N SWRIITRLRHILTYLPN+WR    +       +P V   D     SV S+WR W++SD
Sbjct: 1455 NPSWRIITRLRHILTYLPNEWRNNSAIQV-----SPTVDSTD----ASVASHWRRWEISD 1505

Query: 1540 ITRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNIIVDV 1599
            ITRSYIY+ IFL     +  + L+ +LK++F SFFFT+   GY VA + + TR NI+ + 
Sbjct: 1506 ITRSYIYRTIFLSDQSKTQCQSLKKMLKVDFHSFFFTIYSEGYRVAHNFVITRANIVGEE 1565

Query: 1600 LPPSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLGSI 1659
            +P +  +  +     + V+ LT ++GAIKGE  +++ KL+ +FSK               
Sbjct: 1566 IPAAELSKVQQALDYDNVMNLTVSLGAIKGELNDQLLKLRNIFSK--------------- 1610

Query: 1660 SRSASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIING 1719
                      +Q   L+ S+ S   +  ++ K+   + F+R +L FV+G TRLTNRI+NG
Sbjct: 1611 ----------AQTPALKRSKTSI--NISKSYKVNVLLAFDRSELQFVLGQTRLTNRILNG 1658

Query: 1720 KNSMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQL-GVIPFV 1778
            K ++LLE  K +  PALS VFFA+R E WLKH+  VLAE L ++L +  TA+L   +P +
Sbjct: 1659 KAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLVLAEALSRELSLTMTAELWSYMPSL 1718

Query: 1779 SLNCQATNSFIRAMPSTVVLRNSVEKIKRQVEVLIPQFKSHEVKNSSAVTKKTPRIPIK- 1837
            S+N Q +NS IRAM ST +L NS+++I   +  L   F   +   +   T     IP++ 
Sbjct: 1719 SINIQCSNSHIRAMTSTELLVNSIKQIMESISELKRHFAMEKTTPNVQGTSTNLSIPLQN 1778

Query: 1838 FDIRFNFTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSEQ 1897
              +  +F+D+++E+M L+PF +  ++KQL +Y +  ++ E+++   + ++ LKS  ++EQ
Sbjct: 1779 TALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIILKSHQTTEQ 1838

Query: 1898 FFKFSSTDLQFKCXXXXXXXXXXXXQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHI 1957
            +F F+  DLQ KC             +STSLMKLTL EPRR L + LQDE+ + ES+ +I
Sbjct: 1839 YFNFALGDLQVKCNLPTESSAILNVGLSTSLMKLTLSEPRRILSSFLQDEKLIGESLGYI 1898

Query: 1958 QKLWNFLRSASGGNDRSPSRNTRWALDANLKYFGLLVPVSSICYIFELHSLFASLTNANE 2017
            + L       +   +++ S   RW+LDANL YFG+LVP++S  ++FE+H L A++ NA++
Sbjct: 1899 KGLLQLFSPLA--RNKTQSSALRWSLDANLNYFGILVPMASTFFVFEIHMLLAAMNNASD 1956

Query: 2018 QYEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIESSY 2077
              +E D H +GQ+ +E+C LL+KE SLPA+LSK+LDFSIR ++SQKVPNS QSYQIESS+
Sbjct: 1957 GQDEGDHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIRVMSSQKVPNSPQSYQIESSH 2016

Query: 2078 FRLCLFPELLVDILWSVHYLQSLLNHFKKHHT---PWLPYSSNKTAKSGESTLDFRSIHI 2134
            FR+CL P  LV +LW  H LQSLL +F+KH        P+S    + S +  +DFRSIHI
Sbjct: 2017 FRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRKQDKAISPFSLFDGSASADRQIDFRSIHI 2076

Query: 2135 LSYNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDTFYSQ 2194
            LSYN C+GW+F++GD+ + GLI+G+DRLFSAYEKH+GKLTLIDGY SVANG ++DTFYSQ
Sbjct: 2077 LSYNLCIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVANGQSTDTFYSQ 2136

Query: 2195 KSEKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKR 2254
             SEK  Y R++LSN+QI YWLK  + +KDLF+R +GE ++V  LS SF ++E TL SI++
Sbjct: 2137 GSEKQRYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFDIIESTLASIQK 2196

Query: 2255 FNEMKKAKIKQTGSSTKSKLNMEAASNTLAPFLAHIRTINSQLNFAGGVFKVYSPTELDS 2314
            F  +KK ++ +  S  ++KLN+E  SN ++PFL+HIRTI+ Q  + GGV K+YS  +L+ 
Sbjct: 2197 FQTLKKERMHKRDSGPRNKLNLENTSNNISPFLSHIRTIDCQFKYVGGVLKIYSLDDLNR 2256

Query: 2315 KAEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIK 2374
               P LEIKSPGV +A+ Y  NE   + H IR   +I+PTHN+L+++C P+L+D     +
Sbjct: 2257 AEGPSLEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNILYSQCVPILNDIVEASQ 2316

Query: 2375 NMIRNLSSEDKSHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKVQLDAGF 2434
             M++  S ++    S   + SIDYKSLL+ +DIAF++ SG+Q+LS SCEP+AKVQ D GF
Sbjct: 2317 RMVQKHSPDETPLES---SQSIDYKSLLDSFDIAFKVTSGRQQLSLSCEPRAKVQADVGF 2373

Query: 2435 NSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVMMFTYPNVY 2494
            +SF F VTT+ +    P  VS S++KI+SSVRHIFSR++SA+F +D++D   +FT+P+V+
Sbjct: 2374 DSFTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASFSVDFVDFTSIFTHPDVF 2433

Query: 2495 GVALVSDMNIYCNMKQRQNLNIFLDIW----RLSNRGRTKPSENKAEDKSDAKKXXXXXX 2550
            GVALVSD+N++ NMKQ QNLN+FLDIW    +L+N+GR K  + K + KS          
Sbjct: 2434 GVALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGRAKDDDRKKQTKS--------MT 2485

Query: 2551 XXXXXXXRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRTWHTFA 2610
                        WSFT+IFTN+ G VDLGPSLGVL+L L + W  T H G Q+R  H FA
Sbjct: 2486 LSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHYGAQRRVLHAFA 2545

Query: 2611 HGITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIKSAFDYHMF 2670
              +++ SEGRLSG+F+L  A+ +SE+++P    ++    +S+S+++ R++IK+AFDYHMF
Sbjct: 2546 DELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRVAIKTAFDYHMF 2605

Query: 2671 LIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCXXXXXXXXXXDIYNTIMRMQQD 2730
            LIG++  +K HL +ESD Y ILPDLL V+L  + +  C          DIYNTI RM+QD
Sbjct: 2606 LIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANILDIYNTITRMRQD 2665

Query: 2731 NRISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLFDAEVLV 2790
            NRISYIETL+ESN + +  ++ Y+++L SLNLLRTD+S  +   K  ISP+SLFD EVLV
Sbjct: 2666 NRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQISPISLFDVEVLV 2725

Query: 2791 VSVRDVNARSETQSGEKLKTELQLQISDVNAXXXXXXXXXXXXTVSKIAVDDYMLYASKF 2850
            +++ +V+ARSETQSGEKLKTEL LQ+S+                V+KI+++DYMLYASK 
Sbjct: 2726 LNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKISIEDYMLYASKI 2785

Query: 2851 SGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMWATHVRS 2910
            SGGTI+K+P+LLVSMTTWQ+  S ++EYLFTC+FFD++++KWNLGP+NFIKEMW+TH++S
Sbjct: 2786 SGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINFIKEMWSTHIKS 2845

Query: 2911 LAVRRTQLGNSSPELEVANESDKEDTVKSKFIYVPLDEPYIEMPQIKDLGDATPPLEWFG 2970
            LAVR+TQ   +  E +   + D E+ +K+K  YVPLDEPYIEMPQIKDLGDATPP+EWFG
Sbjct: 2846 LAVRQTQSNKTMSEKDKQADLDPEEEIKAKLQYVPLDEPYIEMPQIKDLGDATPPMEWFG 2905

Query: 2971 VHRKNLPAATHQTAVLLIQKLVHTAEKEYAKLQQR 3005
            VHRK LPAATHQ A++LIQKLVH AEKEYAK+Q R
Sbjct: 2906 VHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQGR 2940

>NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2952

 Score = 2734 bits (7087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1398/3043 (45%), Positives = 1973/3043 (64%), Gaps = 136/3043 (4%)

Query: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60
            MD  S FQ V L R RNFSW+FLV W+LT I++L+ IFYLGR   +++TFILEW++WK  
Sbjct: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60

Query: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQXXXXXX 120
            KVK+NI+SLRI+ LGG I F+N+ IIH+D TIS LEG I WRYWLFN+RK ++Q      
Sbjct: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120

Query: 121  XXXXXXGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVD 180
                    +P S    + PCRF++  EGLEIF+YNKT +Y+NII MFSKEER QFEKF++
Sbjct: 121  TQT-----KPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLN 175

Query: 181  DQTMTELFNESEQENKVLSESTPSSVTMETVGXXXXXXXXXXXXXXXAGRNQNDGQAPNN 240
            +Q +++       ++     S  +S                              ++ ++
Sbjct: 176  EQILSDSATVKSMDDSQFDTSESTST----------------------------DKSESS 207

Query: 241  LENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPP 300
              ND +F+++ ++  S ++RFLPIQ    R SL+LGN+FTPS+L+VSA ++  ++D   P
Sbjct: 208  ATNDRVFQEEETDTSS-FLRFLPIQFLVTRGSLILGNKFTPSLLIVSADSADALMDFAQP 266

Query: 301  KEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIF--LLPT 358
            KEKLDL+K KL  EL + +A++KQNIGFD+D+S  FK  RG++S++W  F R+   L   
Sbjct: 267  KEKLDLYKFKLSAELINTEATLKQNIGFDEDVSMKFKLDRGKVSEVWNHFTRMLGILYKP 326

Query: 359  LGPKHL---QTQEDITFRENWKGLSLYRQ---NMEEDELENVDFDFANHEYARVISILKS 412
            L   H+   + + +  F+  W+GL+LY+        +++++++FDFANHEYA+  SILKS
Sbjct: 327  LRFTHMHRRKNEHEDKFQAKWRGLALYKGTGLGERRNDIDDIEFDFANHEYAKFSSILKS 386

Query: 413  AKIVFTYEYDIPGLVPKEPEET---LQGPEVGNSGAPPEFGVDIQLYGANICYGPWAERQ 469
             K+ FT ++D+PG+VP     T   L GP+VGNSGAPP++ +DIQ++G ++C+GPWA+RQ
Sbjct: 387  PKVTFTSQHDMPGIVPHGAHPTISVLDGPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQ 446

Query: 470  LSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLR 529
              +L  LLSPVVSRT KP+K LTPG +RIYT  +  ++IM+++TWRIPTRE SKD EFL+
Sbjct: 447  ADHLWKLLSPVVSRTAKPVKRLTPGCRRIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQ 506

Query: 530  HYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELL 589
            HY ET  E+RPFGWIDLKF K++       +CPT +G  NN+  H +  E R+SVNH++L
Sbjct: 507  HYRETNGEYRPFGWIDLKFSKETTVNTTFALCPTVDGFKNNIKIHLTENETRSSVNHDIL 566

Query: 590  LRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPY 649
            L+ K FDF+ D  +PLGWND+A W INL+S+Q+E FILREHITLI+D   DFSSG+PTPY
Sbjct: 567  LKCKYFDFDIDTSFPLGWNDEATWTINLNSSQMEAFILREHITLIADTLTDFSSGEPTPY 626

Query: 650  ELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVA 709
            ELFRPFIY INW +DGYS+YLNVNDHNIVNNPLDFNENCYLS HGD L  D  IP+ ++ 
Sbjct: 627  ELFRPFIYSINWKIDGYSLYLNVNDHNIVNNPLDFNENCYLSFHGDELSLDFLIPKTSIT 686

Query: 710  NRCTEITYHISTPMFRXXXXXXXXXXXXEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVD 769
             R T+I+Y I TPMFR            EFMK+KEVGRSY+F+V G Y ++S+LDIDNVD
Sbjct: 687  ARHTDISYTIKTPMFRLLLNTPPWNTLNEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVD 746

Query: 770  TISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENLGDE 829
            TI ++C+S GTTL CYGFVVRYL+NVKMNYFGDF HFVT+EEYT A    E   +   + 
Sbjct: 747  TIMMDCTSKGTTLQCYGFVVRYLINVKMNYFGDFFHFVTSEEYTGAIRANEDDMQYASES 806

Query: 830  HSGFNISSTEDVETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGALILPE 889
                +  S+ D       P  R  +  +   +RS+LKRT NE D+WF F+VWEGAL+LPE
Sbjct: 807  DDDRSSISSFDTMQGNDAPGRRRLHTEL---QRSDLKRTTNETDLWFTFTVWEGALLLPE 863

Query: 890  TIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDNGRQ 949
            TIYN DPC+ LHF EL +DLRS NYYMDLLA MN+  +KRYVS+HPH++FE + K+NG +
Sbjct: 864  TIYNCDPCVGLHFGELVIDLRSCNYYMDLLANMNDVSIKRYVSKHPHEIFEAIHKNNGEE 923

Query: 950  EKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSKIGFG 1009
              +HG LSSLTIHGHRMYGLPP EPTYFCQW  D+  L+I SD+EF +GF + F++IGFG
Sbjct: 924  YHTHGSLSSLTIHGHRMYGLPPMEPTYFCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFG 983

Query: 1010 FKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFENEAY 1069
            + +LENILLYE  T  DMTSVTV +++L  M+ +   +  +      + FT IDFENE Y
Sbjct: 984  YVDLENILLYEKETYDDMTSVTVNLEKLSVMLQEPKLNMYASFDLNNLYFTFIDFENEKY 1043

Query: 1070 SQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREYITLH 1129
            S R+D   P + F +F + E     + L  L+T++  T+F+Q+Q F +HR  QREYI LH
Sbjct: 1044 STRLDLIIPTLEFSLF-IKEEDGTTKKLFTLETKVKITNFVQSQDFDEHRKTQREYIKLH 1102

Query: 1130 DSAYYRCSFLLPCFFQESVLYKELLGSISPSATXXXXXXXXXAETIDYIIEDCLGEYAPT 1189
            D+ Y+RCSF+LP  +Q++  Y+EL G+I+PS++           T D+IIED LGE+   
Sbjct: 1103 DAPYHRCSFILPQEYQDAEQYQELFGAIAPSSSLPPLPVPLIPSTTDFIIEDLLGEFQDL 1162

Query: 1190 VKPDDSSSSDTSEGQRTPLTNEDTRFQANSG----------FFSPHMPHXXXXXXXXXXX 1239
            +        +TS   R P +++D     +            F +P               
Sbjct: 1163 L--------ETSSPFRMPFSDQDYATDVSDDETEEDIDPLEFNTP--SEAIQNDKCERDS 1212

Query: 1240 XVLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVTTS 1299
             ++DV ++++E+ P +   +  +L  F TE+   IID  EIA V +L NL+ GA  +T  
Sbjct: 1213 FIIDVSFISIEICPDILDSIGTFLMLFSTENIVQIIDDIEIATVNRLSNLREGAFKLTNV 1272

Query: 1300 RLHVKDLHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISLL 1359
            ++++  L   +     +GV + L+  DF +  KT+E   EK ++E T+ + I ++R ++ 
Sbjct: 1273 KINILYLDLFWGSRTDTGVGIYLDRIDFAMCEKTVEENKEKKLIELTVLNKIRSVRGTVN 1332

Query: 1360 E-AHPSSISMKPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQ 1418
            + A  S    +P AL L IE  E+WSSTV++ VNS+N+ S   T+DE+QLE + GY   Q
Sbjct: 1333 QTAANSKNEERPPALSLVIEGWEIWSSTVEDQVNSLNILSTDITVDEAQLEWLFGYFDNQ 1392

Query: 1419 IKVLRDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVR 1478
               ++D I ++  ++  + +++K+LI  LT+ASEYYQISHDPYVITKPAFI RLS GHVR
Sbjct: 1393 GLQIQDMIKTSDTIQKRKIESRKELISSLTAASEYYQISHDPYVITKPAFITRLSRGHVR 1452

Query: 1479 ENRSWRIITRLRHILTYLPNDWRTADHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDLS 1538
            ENRSW+IITRLRHILTYLP DW +  +    Q S+     Q  + IF+SVFSNWRNW+ S
Sbjct: 1453 ENRSWKIITRLRHILTYLPEDWHSTINRSLTQ-SKTAATTQDAKGIFISVFSNWRNWEFS 1511

Query: 1539 DITRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNIIVD 1598
            DI RSYIY+K+FL Q+ +      +  + I   SFF TV  +GYEV  + I TRTN++++
Sbjct: 1512 DIARSYIYRKLFLNQHSNQEIHTTKKSITIKIASFFVTVYSAGYEVEHNFIITRTNLLLE 1571

Query: 1599 VLPPSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLGS 1658
               P+ ++S      +E +  +T  +G  KG+  +++  +K L                 
Sbjct: 1572 TNSPTSDSS----LSRETIFNITGTLGTAKGKLSDKIIMIKNLLP--------------- 1612

Query: 1659 ISRSASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIIN 1718
               S  I+  G   +           D  ++ K+   ++ ER +L   +G+TRL +R+  
Sbjct: 1613 ---SLKITDGGKSKETF---------DFVKSFKLNTLILCERGELQIDIGNTRLVSRVFG 1660

Query: 1719 GKNSMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLH-VAATAQLGVIPF 1777
             + SML E+ K+ T  A+S   + QR EI LKH    LAE+ ++    +  T      P 
Sbjct: 1661 ARLSMLWESPKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPT 1720

Query: 1778 VSLNCQATNSFIRAMPSTVVLRNSV----EKIKRQVEVLIPQFKSHEVKNSSAVTKKTPR 1833
            + +N Q ++  + AM +T +L  S+    E I R  + L+   ++ ++   + V    P+
Sbjct: 1721 ILVNSQCSDLHLMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEKI---TKVESHGPK 1777

Query: 1834 IPIKFDIRFNFTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQL 1893
              +   +   FT++S E+M +SPF++  + KQL IY +   + E++L   + D+YL S L
Sbjct: 1778 PKVNTILTCFFTNISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHL 1837

Query: 1894 SSEQFFKFSSTDLQFKCXXXXXXXXXXXXQISTSLMKLTLCEPRRALHNLLQDEQTLVES 1953
            + +Q+F+FS  DLQ K              +S S++KLT+ + ++ + + LQDE+ L ES
Sbjct: 1838 TKQQYFRFSFGDLQLKGNMVNDPYHINLY-LSASILKLTVSDVQKLIPSFLQDEKILTES 1896

Query: 1954 VDHIQKLWNFLRSASGGNDRSPSRNT-RWALDANLKYFGLLVPVSSICYIFELHSLFASL 2012
            ++    L  F  S +  +      N   W++D N+ YFGLL P+ S  ++FEL  L ASL
Sbjct: 1897 IEDFITLDLFGLSKNQKSKPEKDNNKFSWSIDTNINYFGLLAPIGSAYFLFELRMLLASL 1956

Query: 2013 TNANEQYEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQ 2072
            T             SGQ  VE+    +KE +LP  LSK+LDFSI+    QK  N+  +YQ
Sbjct: 1957 TKMGSDIPN-QSDISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQ 2015

Query: 2073 IESSYFRLCLFPELLVDILWSVHYLQSLLNHFKKHHT--PW-LPYSSNKTAKSGESTLDF 2129
            IESS+FR+CL PE LV +LW+ + + + + ++K HH    W L    N   K+ +  L+ 
Sbjct: 2016 IESSHFRVCLSPESLVRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPKAPDLPLNV 2075

Query: 2130 RSIHILSYNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSD 2189
             S HILSYNFCVGWLF V   SEPGLILGY+RLFSAYEK+ GKLTL+D + S+ANGN+SD
Sbjct: 2076 PSFHILSYNFCVGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSD 2135

Query: 2190 TFYSQKSEKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTL 2249
             F+S+  EKD Y R+YL NMQI YW K    ++DLFVRFHGE +DV FLS+   ++E  L
Sbjct: 2136 NFFSEGKEKDKYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESAL 2195

Query: 2250 HSIKRFNEMKKAKIKQTGSSTKSKLNMEAA--SNTLAPFLAHIRTINSQLNFAGGVFKVY 2307
             S++ F E+KK  I   G   K K+N +     NTL+PFLA+IR+I+ Q  + GGVFK++
Sbjct: 2196 TSVQTFQELKKDLIP--GLPKKQKVNDDKTLELNTLSPFLANIRSISCQFKYDGGVFKIF 2253

Query: 2308 SPTELDSKAEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLS 2367
            S  + ++++EP  E+ SP V + +NY+  E R K H IR    I  THN+L+AKCAPLLS
Sbjct: 2254 SLEDAETQSEPSFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCAPLLS 2313

Query: 2368 DFNHNIKNMIRNLSSEDKSHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSCEPKAK 2427
            DF   I+ M++  SS ++S  SKP + ++DYK LL+ +DIA +I S KQ+LS SCEPKAK
Sbjct: 2314 DFFERIQGMVKKHSSSEESTLSKPSSQNLDYKRLLDSFDIALKITSAKQQLSLSCEPKAK 2373

Query: 2428 VQLDAGFNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVMM 2487
            VQ D GF SF+F VTT+ +D+ EP + S S++K E+S++HIFSR++S +  +D++D+ +M
Sbjct: 2374 VQADIGFQSFIFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLM 2433

Query: 2488 FTYP---NVYGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAKK 2544
            FT+P   NV+G AL+S++N++ N+KQ QNL +FLDIWRLS+  ++KP+ +  + K+D+  
Sbjct: 2434 FTHPDVINVHGTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTDSS- 2492

Query: 2545 XXXXXXXXXXXXXRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKR 2604
                           + PW FT+IFTN+ G VDLGPSLGV+++ L++ W  T H  + ++
Sbjct: 2493 ----LSIAQLSDPESIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRK 2548

Query: 2605 TWHTFAHGITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIKSA 2664
              H F  G +++S+GRLSG+FEL  AS +SE++WP +  +   PL+S++M I+ +S K+A
Sbjct: 2549 VLHAFTDGTSLSSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAA 2608

Query: 2665 FDYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCXXXXXXXXXXDIYNTI 2724
            FDYHMFLIG++ + +VHLH+E D   ++PDLL+V+   ESI LC          DIYNT 
Sbjct: 2609 FDYHMFLIGAINNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTA 2668

Query: 2725 MRMQQDNRISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLF 2784
            MRM+QDN+ISYIETL+ESN + S   + Y ++L SLNLL+TD+SV +  L + ISP++LF
Sbjct: 2669 MRMRQDNKISYIETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLF 2728

Query: 2785 DAEVLVVSVRDVNARSETQSGEKLKTELQLQISDVNAXXXXXXXXXXXXTVSKIAVDDYM 2844
            D EVLV+++  ++ARSET SG+KL TEL++Q+ D +             TVSKI+V +Y+
Sbjct: 2729 DVEVLVITIESISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYL 2788

Query: 2845 LYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMW 2904
             YASK  GGTII++P+LLVSMTT+Q++ S +LEYL+TC F DK+S++WNLGP+NFIKEMW
Sbjct: 2789 QYASKIVGGTIIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMW 2848

Query: 2905 ATHVRSLAVRRTQLGNSSPELEVANESDKEDTVK-----SKFIYVPLDEPYIEMPQIKDL 2959
             TH+R++AVRR+Q+      L+  +E D E  +K     S+F YV L+ P I+MPQI+DL
Sbjct: 2849 TTHIRAIAVRRSQVVGV---LDGQSEEDVEKRIKEEENFSRFKYVALEPPRIDMPQIRDL 2905

Query: 2960 GDATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKL 3002
            GDATPP+EWFGV+RK  PA THQTAV L+QKLV++AE+EYA +
Sbjct: 2906 GDATPPMEWFGVNRKRFPAFTHQTAVFLVQKLVYSAEREYANI 2948

>Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 2732 bits (7083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1371/3049 (44%), Positives = 1990/3049 (65%), Gaps = 143/3049 (4%)

Query: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60
            M+  S  + V L   ++FSWVFLVDW+LT +  LT++FY+GRI+ +L++FILEW++WKR 
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQXXXXXX 120
            KVKIN+E+LR++ LGG I F++L +IH+DYTIS LEG+I W+YWL N RK++        
Sbjct: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAE-------- 112

Query: 121  XXXXXXGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVD 180
                    +  S +  K PC+F L CEGLEIF+YN+T +Y+N+I++ SK+ER +FEK+++
Sbjct: 113  ---LIDNNKSPSKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLN 169

Query: 181  DQTMTELFNESEQENKVLSESTPSSVTMETVGXXXXXXXXXXXXXXXAGRNQNDGQAPNN 240
            + +  E F++    +K+  + + S+ T                             +  +
Sbjct: 170  EHSFPEPFSDGSSADKLDEDLSESAYTT---------------------------NSDAS 202

Query: 241  LENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPP 300
            + ND  +++    +   +++FLPI+++  R SL+LGN+FTPS++++S ++ +GI+D+ PP
Sbjct: 203  IINDRDYQETDIGKHPQFLKFLPIELNFSRGSLLLGNKFTPSVMILSYESGEGIVDVLPP 262

Query: 301  KEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFLL---P 357
            KE++DL++ K + E  + + S+KQNIG+DD I   FK   G++SKLW+ F R+  L   P
Sbjct: 263  KERVDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKLDTGKVSKLWKAFIRVLQLVSKP 322

Query: 358  TLGP---KHLQTQEDITFRENWKGLSLYRQNMEE---DELENVDFDFANHEYARVISILK 411
             +     K+ ++  D +F + WKGLSLY+    E   ++L++++FD  NHEYA+  SILK
Sbjct: 323  VVSKRTKKNTRSSND-SFYQKWKGLSLYKATSGEAKANDLDDIEFDLTNHEYAKFTSILK 381

Query: 412  SAKIVFTYEYDIPGLVPKEPEETLQ---GPEVGNSGAPPEFGVDIQLYGANICYGPWAER 468
              K+  +Y+ D+PG+VP     T+    GP+VGN+GAPP+F +D+Q++G +ICYGPWA+R
Sbjct: 382  CPKVTISYDVDVPGVVPHGAHPTISDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQR 441

Query: 469  QLSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFL 528
            Q+S+L+ +LSPVVSRT KPIK L PGS+R+YT+F+ +ISI E++TWRIPTRE SKD EFL
Sbjct: 442  QVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNISITEDTTWRIPTRETSKDAEFL 501

Query: 529  RHYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHEL 588
            +HY ET EE+RPFGW+DL+F KD+Y   +  +CPT EG  NN + HF   EIR+SVNH++
Sbjct: 502  QHYKETSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGFQNNFHVHFVETEIRSSVNHDI 561

Query: 589  LLRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTP 648
            LL++K F+ + D+GYPLGWN +A W IN+ S QLE F+LREHITL++D  +DFS+GDPTP
Sbjct: 562  LLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTP 621

Query: 649  YELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTV 708
            YELFRPF+Y++NW ++GYSIYLNVNDHNIVNNPLDFNENCYLSLHGD L  DV +PR+++
Sbjct: 622  YELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDKLAIDVTVPRESI 681

Query: 709  ANRCTEITYHISTPMFRXXXXXXXXXXXXEFMKNKEVGRSYNFQVNGLYTVFSELDIDNV 768
                T+I+Y ISTPMFR            EFMK+KEVGR+Y+F + G Y ++SELDIDNV
Sbjct: 682  LGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGRAYDFTIKGTYLLYSELDIDNV 741

Query: 769  DTISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENLGD 828
            DT+ +EC+S  T LHCYGFV+RYL NVKMNYFG+F +FVT+EEYT      +     +GD
Sbjct: 742  DTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFVTSEEYTGVLGARD-----VGD 796

Query: 829  ---EHSGFNISSTEDVETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGAL 885
               + S  +++ST D     ++ +     KG PM KRS+LKRT NE DIWF FSVW GAL
Sbjct: 797  VTTKSSVVDLASTVDSGYQNSSVKNNSEAKG-PM-KRSDLKRTTNETDIWFTFSVWNGAL 854

Query: 886  ILPETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKD 945
            ILPETIY+ DPCIALHF+EL VD RS NYYMD++A ++ T +KR+VS+  +++F+ +R++
Sbjct: 855  ILPETIYSFDPCIALHFSELVVDFRSCNYYMDIMAVLDGTSIKRHVSKQINEVFDFIRRN 914

Query: 946  NGRQEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSK 1005
            NG  E+ HG LS LTIHGHRMYGLPPTEPTYFCQW +++  L I+SD+EF KGF + F K
Sbjct: 915  NGADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLSIDSDVEFIKGFFSSFYK 974

Query: 1006 IGFGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFE 1065
            IGFG+ +LENILLY+T T+ DMTS+TV  + ++  + D    S+SV+ A+ I FT IDFE
Sbjct: 975  IGFGYNDLENILLYDTETIDDMTSLTVHAERIRISLEDPVMKSQSVISAESILFTLIDFE 1034

Query: 1066 NEAYSQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREY 1125
            NE YSQR+D K P +   +  +  +  +  FL   +T+L FT+F Q +     R  QR+Y
Sbjct: 1035 NENYSQRIDVKVPKLKISLNCVMGDGVDMSFL-KFETKLRFTNFEQYKDIDKKRSEQRKY 1093

Query: 1126 ITLHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATXXXXXXXXXAETIDYIIEDCLGE 1185
            IT HDS Y+RCSFLLP F+Q+S  Y++L G+I+PS++          +TID+IIED +GE
Sbjct: 1094 ITFHDSPYHRCSFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLPTLPDTIDFIIEDIVGE 1153

Query: 1186 YAPTVKPDD------SSSSDTSEGQRTPLTNEDTRFQANSGFFSPHMPHXXXXXXXXXXX 1239
            YA  ++  +      + +  T E  +   T +D   +A+S  F P               
Sbjct: 1154 YATLLEAANPFKDSFAETPSTVEPSKASFTEDDNDEEASSSGFKPGA--FTEDGDDEKDN 1211

Query: 1240 XVLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVTTS 1299
             V+DV Y+ L++ P +     + L++ Y+E+   ++D  EI IVK+L NLQ G + ++  
Sbjct: 1212 YVVDVSYILLDIDPLLFVFTKSLLEQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNI 1271

Query: 1300 RLHVKDLHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISL- 1358
             +H+  L+ ++      G EL L+  D+ +R K++E      +LE    + + T+R+++ 
Sbjct: 1272 DIHIAYLNLIWQETGEEGFELYLDRIDYQMREKSLEKNRTTKLLEVAALARVKTVRVTVN 1331

Query: 1359 LEAHPSSISMKPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQ 1418
             + +P     +P AL L +E  E+WSST    VNS+N+TS   T+DESQ+E +  Y   Q
Sbjct: 1332 QKKNPDLSEDRPPALSLGLEGFEIWSSTEGRQVNSLNLTSSDITIDESQMEWLFQYCSDQ 1391

Query: 1419 IKVLRDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVR 1478
              +L++  TS   +++ R  ++ +LI +LT+ASEYYQISHDPYVITKPAFIMRLS+GHVR
Sbjct: 1392 ANLLQEVATSFHSIQDTRTSSKTELISELTAASEYYQISHDPYVITKPAFIMRLSKGHVR 1451

Query: 1479 ENRSWRIITRLRHILTYLPNDWRTADHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDLS 1538
            ENRSW+IITRLRHILTYLP+DW+  +++  V            ++IF+SVFS WRNW+ S
Sbjct: 1452 ENRSWKIITRLRHILTYLPDDWQ--NNIDKVLKERKYTSANDAKNIFMSVFSTWRNWEFS 1509

Query: 1539 DITRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNIIVD 1598
            D+ RSYIY K+F   NE   +  ++ +LK    SF+ TV   GYEV  + +    N++VD
Sbjct: 1510 DVARSYIYGKLFSTDNEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVD 1569

Query: 1599 VLPPSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLGS 1658
            + PP  + S      +E+ I +T  +G++KG++ + + KL++L                 
Sbjct: 1570 LTPPVTSLS----LNREETIEITGRIGSVKGKFSDRLLKLQDL----------------- 1608

Query: 1659 ISRSASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIIN 1718
            I   A++          E  ++    +  +  ++   ++ ++ +L  V+ +T+L +R + 
Sbjct: 1609 IPLVAAVG---------EDDKSDPKTELSKQFRMNTVLLVDKSELQLVMDETKLMSRTVG 1659

Query: 1719 GKNSMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQL-GVIPF 1777
            G+ S+L EN K++T  A S V F+Q+ E+WLKH++ +L E  L+   + AT +     P 
Sbjct: 1660 GRVSLLWENLKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILATTEAWSHKPT 1719

Query: 1778 VSLNCQATNSFIRAMPST-------VVLRNSVEKIKRQVEVLIPQFKSHEVKNSSAVTKK 1830
            + +N Q  +   RAM ST         +R S  KIK +++      K  +      V +K
Sbjct: 1720 ILINNQCADLHFRAMSSTEQTVTAITEIRESALKIKERIKFKPKSKKKSQF-----VGQK 1774

Query: 1831 TPRIPIKFDIRFNFTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLK 1890
               +   +     F+++SSEIM LSPFY+  + KQL IY +   + E+++   + D ++ 
Sbjct: 1775 INTVLTCY-----FSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTDFFMT 1829

Query: 1891 SQLSSEQFFKFSSTDLQFKCXXXXXXXXXXXXQISTSLMKLTLCEPRRALHNLLQDEQTL 1950
            S  + EQ+ +FS  D++ K              IS S++KLT  EPRR +++ LQDE+  
Sbjct: 1830 SHQTKEQYLRFSFGDIEIKGGVSKEGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLA 1889

Query: 1951 VESVDHIQKLWNFLRSAS--GGNDRSPSRNTRWALDANLKYFGLLVPVSSICYIFELHSL 2008
             + ++ +  L +   S++      + P+    W LD ++ YFG+L+PV+S  ++FELH L
Sbjct: 1890 SQGINLLCSLKSLFFSSNIPKKEKQVPALMINWTLDTSISYFGILIPVASTYFVFELHML 1949

Query: 2009 FASLTNANEQYEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSL 2068
              SLTN N      +   +GQ  +E+   L+KE SLP  LSKVLDFSI+  T Q+  ++ 
Sbjct: 1950 LLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKVLDFSIKVSTLQRTIDTE 2009

Query: 2069 QSYQIESSYFRLCLFPELLVDILWSVHYLQSLLNHFKKHHTP--W-LPYSSNKTAKSGES 2125
            QS+Q+ESS+FR+CL P+ L+ ++W  H L  L +++ KHH P  W +   + K+ K  E 
Sbjct: 2010 QSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNIKMFTGKSDKPKEI 2069

Query: 2126 TLDFRSIHILSYNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANG 2185
             L+FRSIHILSY FC+GWLF+ G  S+PGL+LGY+RLFSAYE+ FGK T++D + SVANG
Sbjct: 2070 PLNFRSIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFTVVDSFFSVANG 2129

Query: 2186 NTSDTFYSQKSEKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLV 2245
            NTS TF+S+ +EKD Y R++L NMQI YW K    LKD F RFHGE +DV F+ +   ++
Sbjct: 2130 NTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVI 2189

Query: 2246 EKTLHSIKRFNEMKKAKIKQTGSSTKSKLNMEAASN------TLAPFLAHIRTINSQLNF 2299
            + TL S++ F E+K+  +  + +S     N+ AAS+      +LAPFL +IR++NS   +
Sbjct: 2190 DSTLQSMRAFQELKRNILDVSENSHSEDSNIYAASSVENAPSSLAPFLNNIRSVNSNFKY 2249

Query: 2300 AGGVFKVYSPTELDSKAEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLF 2359
             GGVF+VY+  ++++K+EP  EIKSP V +   Y+ +E + + H IR   T++PTHN L+
Sbjct: 2250 DGGVFRVYTYEDIEAKSEPSFEIKSPVVTINCTYKHDEDKVRPHKIRTLITVDPTHNTLY 2309

Query: 2360 AKCAPLLSDFNHNIKNMIRNLSSEDKSHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLS 2419
            A CAPLL +F+ +++ MI+  S+++K + +KP   ++DYK LL+ +D+A ++ S KQ+LS
Sbjct: 2310 AGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSPQNVDYKRLLDQFDVAVKLTSAKQQLS 2369

Query: 2420 FSCEPKAKVQLDAGFNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFML 2479
             SCEPKAKVQ D GF SFLF VTT++ DS  P   S +++  ++S++HIFSR+ S +F +
Sbjct: 2370 LSCEPKAKVQADVGFESFLFSVTTNEFDSEHPLEFSLTLEHTKASIKHIFSREVSTSFEV 2429

Query: 2480 DYIDIVMMFTYPNV---YGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKA 2536
             ++D+ ++FT+P+V   YG+ LVSD+N++ N+KQ QNL +FLDIWR S+   T+P++   
Sbjct: 2430 GFMDLTILFTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLFLDIWRFSSILHTRPAQRSV 2489

Query: 2537 EDKSDAKKXXXXXXXXXXXXXRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITT 2596
                D                    PW FT+IFTN+ G VDLGPSLGV++L  ++ W+ T
Sbjct: 2490 NKGIDMHSLTSTSHVDLGTE----IPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLAT 2545

Query: 2597 KHQGDQKRTWHTFAHGITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAI 2656
             H  ++++  H F  GI++ SEGRLSG+FE+  AS +SE+ W  E      PL+S S+ I
Sbjct: 2546 DHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWSPEKGKNTHPLVSTSLNI 2605

Query: 2657 NRMSIKSAFDYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCXXXXXXXX 2716
            + M+IK+AFDYHMFLIG++ ++   LHNE D   +LPDLLQVS   + I+L         
Sbjct: 2606 DDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVAAN 2665

Query: 2717 XXDIYNTIMRMQQDNRISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKV 2776
              DIYNTI+RM+QDN+ISY+ETL++SN   S   V Y+++L SL LLRTD+SV +  LKV
Sbjct: 2666 ILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPVLYKDILRSLKLLRTDLSVSISSLKV 2725

Query: 2777 HISPMSLFDAEVLVVSVRDVNARSETQSGEKLKTELQLQISDVNAXXXXXXXXXXXXTVS 2836
             ISP+SLFD EVLVV +  V+ RSET SG+KLKT+LQLQ+ DV+A              +
Sbjct: 2726 QISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGA 2785

Query: 2837 KIAVDDYMLYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGP 2896
             IA+DDYM YASK  GGTII +P+L V MTT Q++ +  LEYLF C F DKIS++WNLGP
Sbjct: 2786 SIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGP 2845

Query: 2897 VNFIKEMWATHVRSLAVRRTQLGNSS---PELEVANESDKEDTVKSKFIYVPLDEPYIEM 2953
            VNFIKEMW THV++LAVRR+Q+ N S    E E+    +KE+T  SKF Y+ L+EP IE+
Sbjct: 2846 VNFIKEMWTTHVKALAVRRSQIANISFGQTEEELEESINKEETA-SKFNYIALEEPQIEV 2904

Query: 2954 PQIKDLGDATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKL 3002
            PQI+DLGDATPP+EWFGV+RK  P  THQTAV+ +QKLV+ AEK+Y K+
Sbjct: 2905 PQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKI 2953

>Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 2726 bits (7067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1374/3045 (45%), Positives = 1982/3045 (65%), Gaps = 135/3045 (4%)

Query: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60
            M+  S  + V L   ++FSWVFLVDW+LT I  LT IFY+GRI+ +L++FILEW++WKR 
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQXXXXXX 120
            K+KIN+E+LRI+ LGG I F++L +IH+DYTIS LEG++ W+YWL N RK++        
Sbjct: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELI------ 114

Query: 121  XXXXXXGQEPKSNSGR--KHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKF 178
                   +  K++SG+  + PC+FLL CEGLE F+YN+T +Y+N+I++ SK+ER +FEK+
Sbjct: 115  -------ENEKNSSGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKY 167

Query: 179  VDDQTMTELFNESEQENKVLSESTPSSVTMETVGXXXXXXXXXXXXXXXAGRNQNDGQAP 238
            +++ +  E F++    +K+  + + S+ T                             + 
Sbjct: 168  LNEHSFPEPFSDGSSADKLDEDLSESAYTT---------------------------NSD 200

Query: 239  NNLENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLC 298
            +++ ND  +++    +    + F PI++   R SL+LGN+FTPS++++S +N +GIID+ 
Sbjct: 201  SSIINDRDYQETNIGKYPKGLSFFPIELKLNRGSLLLGNKFTPSVMILSYENGEGIIDVL 260

Query: 299  PPKEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIF---- 354
            PPKE+LDL++ K   EL + + S+KQNIG+DD I   FK   G++SKLW+ F R+     
Sbjct: 261  PPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRVVT 320

Query: 355  --LLPTLGPKHLQTQEDITFRENWKGLSLYRQ---NMEEDELENVDFDFANHEYARVISI 409
              ++P  G K      D  F + WKGLSLY+    + +  +L++++FDF +HEYA+  SI
Sbjct: 321  KPVIPRRGKK--AGPSDDAFFQKWKGLSLYKASAGDAKTSDLDDIEFDFTSHEYAKFTSI 378

Query: 410  LKSAKIVFTYEYDIPGLVPKEPEETL---QGPEVGNSGAPPEFGVDIQLYGANICYGPWA 466
            LK  K+  +Y+ D+PG+VP     T+    GP+VGN+GAPP+F +D+Q++G +ICYGPWA
Sbjct: 379  LKCPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWA 438

Query: 467  ERQLSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQE 526
            +RQ+S+L+ +LSPVVSRT KPIK L PGS+R+YT+F+ +I IME++TWRIPTRE SKD E
Sbjct: 439  QRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNILIMEDTTWRIPTRESSKDAE 498

Query: 527  FLRHYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNH 586
            FL+HY +T EE+RPFGW+DL+F KD+Y   +  +CPT EG  N+ + HF   EIR+SVNH
Sbjct: 499  FLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGFKNDFHVHFVETEIRSSVNH 558

Query: 587  ELLLRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDP 646
            ++LL++K FD + D+GYPLGWN    W IN+ S QLE F+LREHITL++D  +DFS+GDP
Sbjct: 559  DILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDP 618

Query: 647  TPYELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQ 706
            TPYELFRPF+Y++NW +DGYSIYLNVNDHNIVNNPLDFNENCYLSLHGD L  D+ +PR+
Sbjct: 619  TPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDKLTIDITVPRE 678

Query: 707  TVANRCTEITYHISTPMFRXXXXXXXXXXXXEFMKNKEVGRSYNFQVNGLYTVFSELDID 766
            ++    T+++Y ISTPMFR            EFMK+KEVGRSY+F + G Y ++SELDID
Sbjct: 679  SILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGRSYDFTIKGCYLLYSELDID 738

Query: 767  NVDTISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENL 826
            NVD++++ C+S  T LHCYGFV+RYL+NVKMNYFG+F +FVT+EEYT      E     +
Sbjct: 739  NVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFGEFFNFVTSEEYTGVLGAREVGE--V 796

Query: 827  GDEHSGFNISSTEDVETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGALI 886
              + S  +++ST D E    + +    + G PM KRS+LKRT NE DIWF FSVW GALI
Sbjct: 797  VTKSSVVDLASTLDSEYQNGSMKNDAEDNG-PM-KRSDLKRTTNETDIWFTFSVWNGALI 854

Query: 887  LPETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDN 946
            LPETIY+ DPCIALHF EL VD RS NYYMD++A +N T +KR+VS+  +++F+ +R++N
Sbjct: 855  LPETIYSFDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNN 914

Query: 947  GRQEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSKI 1006
            G  E+ HG LS LTIHGHRMYGLPPTEPTYFCQW +++  L INSD+EF KGF T F K+
Sbjct: 915  GADEQEHGVLSDLTIHGHRMYGLPPTEPTYFCQWDINLGELNINSDIEFLKGFFTSFYKV 974

Query: 1007 GFGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFEN 1066
            GFG+ +LENILLY+T T+ DMTS+TV  + +   +ND    S+S++  + + FT IDFEN
Sbjct: 975  GFGYNDLENILLYDTETINDMTSLTVHAERINISLNDPVMKSQSIVSVESLLFTLIDFEN 1034

Query: 1067 EAYSQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREYI 1126
            E YSQR+D K P +   +  +  +     FL + +T+L FT+F Q +     R  QR YI
Sbjct: 1035 ERYSQRIDIKVPKLTVSLSCVMGDGTNTSFL-NFETKLRFTNFGQYKDSDKKRSEQRRYI 1093

Query: 1127 TLHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATXXXXXXXXXAETIDYIIEDCLGEY 1186
             ++DS Y+RC FLLP F+Q+S  Y++L G+I+PS++          +TIDYIIED +GEY
Sbjct: 1094 MMNDSPYHRCPFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLPTLPDTIDYIIEDIVGEY 1153

Query: 1187 APTVKPDD------SSSSDTSEGQRTPLTNEDTRFQANSGFFSPHMPHXXXXXXXXXXXX 1240
            A  ++  +      + +  T E  R   T +D    A+   F P                
Sbjct: 1154 ATLLEATNPFKDLFAETPSTVEPLRASFTEDDDEEAADPLEFKPVA--FTEEINHERDNY 1211

Query: 1241 VLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVTTSR 1300
            V+DV Y+ L++ P +     + L++FY+ED   ++D  EI IVK+L NLQ G   ++   
Sbjct: 1212 VIDVSYILLDIDPLLFVFTKSLLEQFYSEDMVQVLDDIEIGIVKRLSNLQEGIVSISNID 1271

Query: 1301 LHVKDLHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISL-L 1359
            +HV  L+ ++      G EL L+  ++ +  K++E       LE  + + + T+R ++  
Sbjct: 1272 IHVAYLNLIWQETGEEGFELYLDRINYQMSEKSLEKNRTSKSLEVAVLAKVKTVRATVNQ 1331

Query: 1360 EAHPSSISMKPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQI 1419
            + +P     +P AL L +E  E+WSST D  VNS+N+TS   T+DESQ+E +  Y   Q 
Sbjct: 1332 KKNPELSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQG 1391

Query: 1420 KVLRDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVRE 1479
             ++++  TS   ++N R  T+ +LI  LT+ASEYYQISHDPYVITKPAFIMRLS+GHVRE
Sbjct: 1392 NLIQEVFTSVNSIQNTRSSTKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRE 1451

Query: 1480 NRSWRIITRLRHILTYLPNDWRTADHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDLSD 1539
            NRSW+IITRLRHILTYLP+DW+T  ++  V      +  +  ++IF+SVFS WRNW+ SD
Sbjct: 1452 NRSWKIITRLRHILTYLPDDWQT--NIDKVLKERKYSFAKDAKNIFMSVFSTWRNWEFSD 1509

Query: 1540 ITRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNIIVDV 1599
            + RSYIY K+FL  +       ++ +LK    SF+ TV   GYEV  + +    N++VD+
Sbjct: 1510 VARSYIYGKLFLADHAKHKGNSIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDL 1569

Query: 1600 LPPSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLGSI 1659
             PP  + SS     +E+ I +T  +G++KG++ +++ KL++L         DD S+    
Sbjct: 1570 TPPVTSLSS----NREETIEITGKVGSVKGKFSDKLLKLQDLIPLVVAVTEDDKSD---- 1621

Query: 1660 SRSASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIING 1719
               A +S                     +  K+   ++ ++ ++  V+  T++ +R + G
Sbjct: 1622 -PKAELS---------------------KQFKMNTVLLVDKSEIQVVMDKTKVMSRTVGG 1659

Query: 1720 KNSMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQL-GVIPFV 1778
            + S+L EN K++T  A S V F+Q+ E+WLKH + +L E  L    + AT +     P +
Sbjct: 1660 RVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDFSILATTEAWSHKPTI 1719

Query: 1779 SLNCQATNSFIRAMPSTVVLRNSVEKIKRQVEVLIPQFK-SHEVKNSSAVTKKTPRIPIK 1837
             +N Q  +   RAM +T  + N++ +IK  V  +  Q K   + KN S          I 
Sbjct: 1720 LVNNQCADLHFRAMSTTEQMVNAITEIKESVLKVKEQIKFKPKSKNKSQFVGSR----IN 1775

Query: 1838 FDIRFNFTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSEQ 1897
              +   F+++SSEIM LSPFY+  + KQL IY +   + E++L   + D ++ S  + EQ
Sbjct: 1776 TVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQ 1835

Query: 1898 FFKFSSTDLQFKCXXXXXXXXXXXXQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHI 1957
            + +FS  D++ K              IS S++KLT  EPRR +++ LQDE+   + ++ +
Sbjct: 1836 YLRFSFGDIEIKGGFSKEAYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLL 1895

Query: 1958 QKLWNFLRSASGGNDR--SPSRNTRWALDANLKYFGLLVPVSSICYIFELHSLFASLTNA 2015
              L +   +    N +  +P++   W LD N+ YFG+LVPV+S  ++FELH L  SLTN 
Sbjct: 1896 SSLNSLFLTTDPMNAKKETPAKMINWTLDTNISYFGILVPVASTYFVFELHMLLLSLTNT 1955

Query: 2016 NEQYEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIES 2075
            N          +GQ+ +E+   L+KE SLP  LSK+LDFSI+  T Q+  ++ QS+Q+ES
Sbjct: 1956 NNGLLPEQTRLTGQLSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVES 2015

Query: 2076 SYFRLCLFPELLVDILWSVHYLQSLLNHFKKHHTP--W-LPYSSNKTAKSGESTLDFRSI 2132
            S+FR+CL P+ L+ ++W  + L  ++ ++ K H P  W +   + K+ K  E  ++FRSI
Sbjct: 2016 SHFRVCLSPDSLLRLIWGAYKLLDMVQYYSKRHAPNIWNIRMFTGKSDKPKEIPINFRSI 2075

Query: 2133 HILSYNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDTFY 2192
            HILSY FC+GWLF+ G   +PGL+ GY+RLFSAYEK FGK T++D + SV+NGNTS TF+
Sbjct: 2076 HILSYKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFF 2135

Query: 2193 SQKSEKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSI 2252
            S+ +EK+ Y R++L NMQI YW K    LKD F RFHGE +DV FL +   +++ TL SI
Sbjct: 2136 SEGNEKEKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSI 2195

Query: 2253 KRFNEMKKAKI------KQTGSSTKSKLNMEAASNTLAPFLAHIRTINSQLNFAGGVFKV 2306
            + F E+KK  +          SS  +  N E ASN+LAPFL +IR++N    + GGVF+V
Sbjct: 2196 RAFQELKKNILDMPHESNMENSSPDAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRV 2255

Query: 2307 YSPTELDSKAEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLL 2366
            Y+  ++++K+EP  E+KSP V +   Y+ +E++ K H IR   T++PTHN L+A CAPLL
Sbjct: 2256 YTYDDIEAKSEPSFELKSPVVTINCTYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLL 2315

Query: 2367 SDFNHNIKNMIRNLSS-EDKSHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSCEPK 2425
             +F+ +++NMI+  S+ E K + +KP T ++DYK LL+ +D+A ++ S KQ+LS SCEPK
Sbjct: 2316 MEFSESLQNMIKKHSTGEKKPNFTKPSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPK 2375

Query: 2426 AKVQLDAGFNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIV 2485
            AKVQ D GF SFLF +TT++ DS +P   S ++++ ++S++HIFSR+ S +F + ++D+ 
Sbjct: 2376 AKVQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLT 2435

Query: 2486 MMFTYPNV---YGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDA 2542
            ++FT+P+V   YG +LVSD++++ N+KQ QNL +FLDIWR S+   T+P++     + + 
Sbjct: 2436 LLFTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNM 2495

Query: 2543 KKXXXXXXXXXXXXXRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQ 2602
                               PW FT+IFTN+ G VDLGPSLGV++L  ++ W+ T H  ++
Sbjct: 2496 STLSSNSNVDVGTE----IPWCFTLIFTNLSGDVDLGPSLGVISLRSQRTWLATDHYDEK 2551

Query: 2603 KRTWHTFAHGITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIK 2662
            ++  H F  GI++ SEGRLSG+FE+  AS VSE+ WP E+     PL+S S+ I+ +++K
Sbjct: 2552 RQLLHAFTDGISLTSEGRLSGLFEVANASWVSEVKWPLENSKNTHPLVSTSLNIDDVAVK 2611

Query: 2663 SAFDYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCXXXXXXXXXXDIYN 2722
            +AFDYHMFLIG++ +++ HLHNE D+  ILPDLLQVS   + I L           DIYN
Sbjct: 2612 AAFDYHMFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSDEITLSSTALVAANILDIYN 2671

Query: 2723 TIMRMQQDNRISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMS 2782
            TI+RM+QDN+ISY+ETL++SN S S   + Y+++L SL LLRTD+SV +  LKV ISP+S
Sbjct: 2672 TIVRMRQDNKISYMETLRDSNPSESKQPILYKDILRSLKLLRTDLSVNISSLKVQISPIS 2731

Query: 2783 LFDAEVLVVSVRDVNARSETQSGEKLKTELQLQISDVNAXXXXXXXXXXXXTVSKIAVDD 2842
            LFD EVLVV +  V+ RSET SG+KLKT+LQLQ+ DV+A              + IA+DD
Sbjct: 2732 LFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDD 2791

Query: 2843 YMLYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKE 2902
            YM YASK  GGTII +P+L V MTT Q++ +  LEYLF C F DKIS++WNLGP+NFIKE
Sbjct: 2792 YMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPINFIKE 2851

Query: 2903 MWATHVRSLAVRRTQ-----LGNSSPELEVANESDKEDTVKSKFIYVPLDEPYIEMPQIK 2957
            MW THV++LAVRR+Q      G +  ELE   ES K +   SKF Y+ L+EP IE+PQI+
Sbjct: 2852 MWTTHVKALAVRRSQTANISFGQTEEELE---ESIKREENASKFNYIALEEPQIEVPQIR 2908

Query: 2958 DLGDATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKL 3002
            DLG+ATPP+EWFGV+RK LP  THQTAV+ +QKLV+ AEK+Y K+
Sbjct: 2909 DLGEATPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQYVKI 2953

>YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}
            CSF1Protein required for fermentation at low temperature;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 2958

 Score = 2722 bits (7056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1372/3047 (45%), Positives = 1989/3047 (65%), Gaps = 139/3047 (4%)

Query: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60
            M+  S  + V L   ++FSWVFLVDW+LT +V LT+IFY+GRI+ +L++FILEW++WKR 
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQXXXXXX 120
            K+KIN+E+LR++ LGG I F+NL +IH+DYTIS LEG++ W+YWL N RK++        
Sbjct: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELI------ 114

Query: 121  XXXXXXGQEPKSNSGRKH--PCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKF 178
                   +  KS+SG+K   PC+  + CEGLEIF+YN+T +Y+N+I++ SK+ER +FEK+
Sbjct: 115  -------ENNKSSSGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKY 167

Query: 179  VDDQTMTELFNESEQENKVLSESTPSSVTMETVGXXXXXXXXXXXXXXXAGRNQNDGQAP 238
            +++ +  E F++    +K+  + + S+ T  +                            
Sbjct: 168  LNEHSFPEPFSDGSSADKLDEDLSESAYTTNSDA-------------------------- 201

Query: 239  NNLENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLC 298
             ++ ND  +++    +    + FLPI++   R SL+LGN+FTPS++++S ++ KGIID+ 
Sbjct: 202  -SIVNDRDYQETDIGKHPKLLMFLPIELKFSRGSLLLGNKFTPSVMILSYESGKGIIDVL 260

Query: 299  PPKEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFLLPT 358
            PPKE+LDL++ K + E  + + S+KQNIG+DD I   FK  RG++SKLW+ F R+F + T
Sbjct: 261  PPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKIDRGKVSKLWKTFVRVFQIVT 320

Query: 359  LGPKHLQTQ-----EDITFRENWKGLSLYRQ---NMEEDELENVDFDFANHEYARVISIL 410
                  +T+      D  F   WKGLSLY+    + +  +L++V+FD  NHEYA+  SIL
Sbjct: 321  KPVVPKKTKKSAGTSDDNFYHKWKGLSLYKASAGDAKASDLDDVEFDLTNHEYAKFTSIL 380

Query: 411  KSAKIVFTYEYDIPGLVPKEPEETL---QGPEVGNSGAPPEFGVDIQLYGANICYGPWAE 467
            K  K+   Y+ D+PG+VP     T+    GP+VGN+GAPP+F +D+Q++G +ICYGPWA+
Sbjct: 381  KCPKVTIAYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQ 440

Query: 468  RQLSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEF 527
            RQ+S+L+ +LSPVVSRT KPIK L PGS+RIYT+F+ +ISIME++TWRIPTRE SKD EF
Sbjct: 441  RQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIYTLFRMNISIMEDTTWRIPTRESSKDPEF 500

Query: 528  LRHYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHE 587
            L+HY ET EE+RPFGW+DL+F KD+Y   +  +CPT +G  NN + HF   EIR+SVNH+
Sbjct: 501  LKHYKETNEEYRPFGWMDLRFCKDTYANFNISVCPTVQGFQNNFHVHFLETEIRSSVNHD 560

Query: 588  LLLRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPT 647
            +LL++K FD + D+GYPLGWN +A W IN+ S QLE F+LREHITL++D  +DFS+GDPT
Sbjct: 561  ILLKSKVFDIDGDIGYPLGWNSKAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPT 620

Query: 648  PYELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQT 707
            PYELFRPF+Y++NW ++GYSIYLNVNDHNIVNNPLDFNENCYLSLHGD L  DV +PR++
Sbjct: 621  PYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDKLSIDVTVPRES 680

Query: 708  VANRCTEITYHISTPMFRXXXXXXXXXXXXEFMKNKEVGRSYNFQVNGLYTVFSELDIDN 767
            +    T+++Y ISTPMFR            EFMK+KEVGR+Y+F + G Y ++SELDIDN
Sbjct: 681  ILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGRAYDFTIKGSYLLYSELDIDN 740

Query: 768  VDTISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENLG 827
            VDT+ +EC+S  T LHCYGFV+RYL NVKMNYFG+F +FVT+EEYT      E     +G
Sbjct: 741  VDTLVIECNSKSTVLHCYGFVMRYLTNVKMNYFGEFFNFVTSEEYTGVLGARE-----VG 795

Query: 828  D---EHSGFNISSTEDVETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGA 884
            D   + S  +++ST D     ++ +    +KG PM KRS+LKRT NE DIWF FSVW+GA
Sbjct: 796  DVTTKSSVADLASTVDSGYQNSSLKNESEDKG-PM-KRSDLKRTTNETDIWFTFSVWDGA 853

Query: 885  LILPETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRK 944
            LILPETIY+ DPCIALHF EL VD RS NYYMD++A +N T +KR+VS+  +++F+ +R+
Sbjct: 854  LILPETIYSFDPCIALHFAELVVDFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRR 913

Query: 945  DNGRQEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFS 1004
            +NG  E+ HG LS LTIHGHRMYGLPPTEPTYFCQW +++  L I+SD+EF KGF   F 
Sbjct: 914  NNGADEQEHGLLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLCIDSDIEFIKGFFNSFY 973

Query: 1005 KIGFGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDF 1064
            KIGFG+ +LENILLY+T T+ DMTS+TV V++++  + D    S+SV+ A+ I FT IDF
Sbjct: 974  KIGFGYNDLENILLYDTETINDMTSLTVHVEKIRIGLKDPVMKSQSVISAESILFTLIDF 1033

Query: 1065 ENEAYSQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQRE 1124
            ENE YSQR+D K P +   +  +  +  +  FL   +T+L FT+F Q +     R  QR 
Sbjct: 1034 ENEKYSQRIDVKIPKLTISLNCVMGDGVDTSFL-KFETKLRFTNFEQYKDIDKKRSEQRR 1092

Query: 1125 YITLHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATXXXXXXXXXAETIDYIIEDCLG 1184
            YIT+HDS Y+RC FLLP F+Q+S  Y+ L G+I+PS++          +TIDYIIED +G
Sbjct: 1093 YITIHDSPYHRCPFLLPLFYQDSDTYQNLYGAIAPSSSIPTLPLPTLPDTIDYIIEDIVG 1152

Query: 1185 EYAPTVKPDD------SSSSDTSEGQRTPLTNEDTRFQANSGFFSPHMPHXXXXXXXXXX 1238
            EYA  ++  +      + +  T E  R   + +D   +A+   F P              
Sbjct: 1153 EYATLLETTNPFKNIFAETPSTMEPSRASFSEDDNDEEADPSSFKP--VAFTEDRNHERD 1210

Query: 1239 XXVLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVTT 1298
              V+DV Y+ L+V P +     + L++ Y+E+   ++D  EI IVK+L NLQ G + ++ 
Sbjct: 1211 NYVVDVSYILLDVDPLLFIFAKSLLEQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISN 1270

Query: 1299 SRLHVKDLHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISL 1358
              +H+  L+ ++      G EL L+  D+ +  K++E      +LE    + + T+R+++
Sbjct: 1271 IDIHIAYLNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTNKLLEVAALAKVKTVRVTV 1330

Query: 1359 -LEAHPSSISMKPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFG 1417
              + +P     +P AL L IE  E+WSST D  VNS+N+TS   T+DESQ+E +  Y   
Sbjct: 1331 NQKKNPDLSEDRPPALSLGIEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSD 1390

Query: 1418 QIKVLRDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHV 1477
            Q  ++++  TS   ++N R  ++ +LI  LT+ASEYYQISHDPYVITKPAFIMRLS+GHV
Sbjct: 1391 QGNLIQEVCTSFNSIQNTRSNSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHV 1450

Query: 1478 RENRSWRIITRLRHILTYLPNDWRTADHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDL 1537
            RENRSW+IITRLRHILTYLP+DW++  ++  V   +     +  ++IF+SVFS WRNW+ 
Sbjct: 1451 RENRSWKIITRLRHILTYLPDDWQS--NIDEVLKEKKYTSAKDAKNIFMSVFSTWRNWEF 1508

Query: 1538 SDITRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNIIV 1597
            SD+ RSYIY K+F  +NE   +  ++ +LK    SF+ TV   GYEV  + +    N++V
Sbjct: 1509 SDVARSYIYGKLFTAENEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVV 1568

Query: 1598 DVLPPSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLG 1657
            D+ PP  +  S     +E+ I +T  +G++KG++ + + KL++L                
Sbjct: 1569 DLTPPVTSLPS----NREETIEITGRVGSVKGKFSDRLLKLQDLI--------------- 1609

Query: 1658 SISRSASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRII 1717
                   I+  G      E  ++    +  +  K+   ++ ++ +L  V+  T+L +R +
Sbjct: 1610 -----PLIAAVG------EDDKSDPKKELSKQFKMNTVLLVDKSELQLVMDQTKLMSRTV 1658

Query: 1718 NGKNSMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQL-GVIP 1776
             G+ S+L EN K++T  A S V F+Q+ E+WLKH++ +L E  L+   V AT +     P
Sbjct: 1659 GGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAWSHKP 1718

Query: 1777 FVSLNCQATNSFIRAMPSTVVLRNSVEKIKRQVEVLIPQFKSHEVKNSSA--VTKKTPRI 1834
             + +N Q  +   RAM ST  L  ++ +I+  + ++  + K        +  V +K   +
Sbjct: 1719 TILINNQCADLHFRAMSSTEQLVTAITEIRESLMMIKERIKFKPKSKKKSQFVDQKINTV 1778

Query: 1835 PIKFDIRFNFTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLS 1894
                 +   F+++SSE+M LSPFY+  + KQL IY +   + E++L   + D ++ S  +
Sbjct: 1779 -----LSCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQT 1833

Query: 1895 SEQFFKFSSTDLQFKCXXXXXXXXXXXXQISTSLMKLTLCEPRRALHNLLQDEQTLVESV 1954
             EQ+ +FS  D++ K              IS S++KLT  EPRR +++ LQDE+   + +
Sbjct: 1834 KEQYLRFSFGDIEIKGGISREGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGI 1893

Query: 1955 DHIQKLWNFLRSAS--GGNDRSPSRNTRWALDANLKYFGLLVPVSSICYIFELHSLFASL 2012
            + +  L     S++      ++PS    W LD ++ YFG+LVPV+S  ++FELH L  SL
Sbjct: 1894 NLLYSLKPLFFSSNLPKKEKQAPSIMINWTLDTSITYFGVLVPVASTYFVFELHMLLLSL 1953

Query: 2013 TNANEQYEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQ 2072
            TN N      +   +GQ  +E+   L+KE SLP  LSK+LDFSI+  T Q+  ++ QS+Q
Sbjct: 1954 TNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQ 2013

Query: 2073 IESSYFRLCLFPELLVDILWSVHYLQSLLNHFKKHHTP--W-LPYSSNKTAKSGESTLDF 2129
            +ESS+FR+CL P+ L+ ++W  H L  L +++ + H P  W     + K+ KS E  ++F
Sbjct: 2014 VESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYSRRHAPNIWNTKMFTGKSDKSKEMPINF 2073

Query: 2130 RSIHILSYNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSD 2189
            RSIHILSY FC+GW+F+ G  S PGL+LGY+RLFSAYEK FGK T++D + SVANGNTS 
Sbjct: 2074 RSIHILSYKFCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNTSS 2133

Query: 2190 TFYSQKSEKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTL 2249
            TF+S+ +EKD Y R++L NMQI YW K    LKD F RFHGE +DV F+ +   ++E TL
Sbjct: 2134 TFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIESTL 2193

Query: 2250 HSIKRFNEMKK------AKIKQTGSSTKSKLNMEAASNTLAPFLAHIRTINSQLNFAGGV 2303
             S++ F E+KK        ++    ++ +  ++E+AS++LAPFL +IR++NS   + GGV
Sbjct: 2194 QSMRAFQELKKNILDVSESLRAENDNSYASTSVESASSSLAPFLDNIRSVNSNFKYDGGV 2253

Query: 2304 FKVYSPTELDSKAEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCA 2363
            F+VY+  ++++K+EP  EIKSP V +   Y+ +E + K H  R   T++PTHN L+A CA
Sbjct: 2254 FRVYTYEDIETKSEPSFEIKSPVVTINCTYKHDEDKVKPHKFRTLITVDPTHNTLYAGCA 2313

Query: 2364 PLLSDFNHNIKNMIRNLSSEDKSHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSCE 2423
            PLL +F+ +++ MI+  S+++K + +KP + ++DYK LL+ +D+A ++ S KQ+LS SCE
Sbjct: 2314 PLLMEFSESLQKMIKKHSTDEKPNFTKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCE 2373

Query: 2424 PKAKVQLDAGFNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYID 2483
            PKAKVQ D GF SFLF + T++ DS +P   S +++  ++S++HIFSR+ S +F + ++D
Sbjct: 2374 PKAKVQADVGFESFLFSMATNEFDSEQPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMD 2433

Query: 2484 IVMMFTYPNV---YGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKS 2540
            + ++FT+P+V   YG  LVSD++++ N+KQ QNL +FLDIWR S+   T+P +     + 
Sbjct: 2434 LTLLFTHPDVISMYGTGLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPVQRTVNKEI 2493

Query: 2541 DAKKXXXXXXXXXXXXXRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQG 2600
            +                    PW FT+IFTN+ G VDLGPSLG+++L  ++ W+ T H  
Sbjct: 2494 EMSSLTSTNYADAGTE----IPWCFTLIFTNVSGDVDLGPSLGMISLRTQRTWLATDHYN 2549

Query: 2601 DQKRTWHTFAHGITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMS 2660
            ++++  H F  GI++ SEGRLSG+FE+  AS +SE+ WP E      PL+S S+ I+ ++
Sbjct: 2550 EKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWPPEKSKNTHPLVSTSLNIDDIA 2609

Query: 2661 IKSAFDYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCXXXXXXXXXXDI 2720
            +K+AFDYHMFLIG++ ++  HLHNE D   +LPDLLQVS   + I+L           DI
Sbjct: 2610 VKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVVANILDI 2669

Query: 2721 YNTIMRMQQDNRISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISP 2780
            YNTI+RM+QDN+ISY+ETL++SN   S   + Y+++L SL LLRTD+SV +   KV ISP
Sbjct: 2670 YNTIVRMRQDNKISYMETLRDSNPGESRQPILYKDILRSLKLLRTDLSVNISSSKVQISP 2729

Query: 2781 MSLFDAEVLVVSVRDVNARSETQSGEKLKTELQLQISDVNAXXXXXXXXXXXXTVSKIAV 2840
            +SLFD EVLV+ +  V+ RSET SG+KLKT+LQLQ+ DV+A              + IA+
Sbjct: 2730 ISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAI 2789

Query: 2841 DDYMLYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFI 2900
            DDYM YASK  GGTII +P+L V MTT Q++ +  LEYLF C F DKIS++WNLGPV+FI
Sbjct: 2790 DDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVDFI 2849

Query: 2901 KEMWATHVRSLAVRRTQLGNSS-----PELEVANESDKEDTVKSKFIYVPLDEPYIEMPQ 2955
            KEMW THV++LAVRR+Q+ N S      ELE   ES K++   SKF Y+ L+EP IE+PQ
Sbjct: 2850 KEMWTTHVKALAVRRSQVANISFGQTEEELE---ESIKKEEAASKFNYIALEEPQIEVPQ 2906

Query: 2956 IKDLGDATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKL 3002
            I+DLGDATPP+EWFGV+RK  P  THQTAV+ +QKLV+ AEK+Y K+
Sbjct: 2907 IRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQKLVYLAEKQYVKI 2953

>Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] {ON}
            YLR087C (REAL)
          Length = 2959

 Score = 2716 bits (7041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1371/3050 (44%), Positives = 1979/3050 (64%), Gaps = 144/3050 (4%)

Query: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60
            M+  S  + V L   ++FSWVFLVDW+LT ++ LT+IFY+GRI+ +L+TFILEW++WKR 
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60

Query: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQXXXXXX 120
             +KIN+E+LR++ LGG I F++L +IH+DYTIS LEG++ W+YWL N RK++        
Sbjct: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAE-------- 112

Query: 121  XXXXXXGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVD 180
                    +   +   K PC+F L CEGLEIF+YN+T +Y+N+I++ SK+ER +FEK+++
Sbjct: 113  ---LIENNKDSLSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLN 169

Query: 181  DQTMTELFNESEQENKVLSESTPSSVTMETVGXXXXXXXXXXXXXXXAGRNQNDGQAPNN 240
            + +  E F++    +K+  + + S+ T                             +  +
Sbjct: 170  EHSFPESFSDGSSADKLDEDLSESAYTT---------------------------NSDAS 202

Query: 241  LENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPP 300
            + ND  +++    +   +++FLPI++   R SL+LGN+FTPS++++S +N +G+ID+ PP
Sbjct: 203  IINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLLGNKFTPSVMILSYENGEGVIDVLPP 262

Query: 301  KEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFLL---P 357
            KE+LDL++ K + E  + + S+KQNIG+DD I   FK   G++SKLW+ F R+  +   P
Sbjct: 263  KERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRIVTKP 322

Query: 358  TLGPKHLQTQ--EDITFRENWKGLSLYRQ---NMEEDELENVDFDFANHEYARVISILKS 412
             +  K+ +     D +F + WKGLSLY+    + +  +L++++FDF NHEYA+  SILK 
Sbjct: 323  IISKKNKKKTGPSDDSFFQKWKGLSLYKAAPGDAKPSDLDDIEFDFTNHEYAKFTSILKC 382

Query: 413  AKIVFTYEYDIPGLVPKEPEETL---QGPEVGNSGAPPEFGVDIQLYGANICYGPWAERQ 469
             K+   Y+ D+ G VP     T+    GP+VGN+GAPP+F +D+Q++G +ICYGPWA+RQ
Sbjct: 383  PKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQ 442

Query: 470  LSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLR 529
            +S+L+ +LSPVVSRT KP+K L PGS+RIYT+F+ ++ IME++TWRIPTRE SKD EFL+
Sbjct: 443  VSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFRMNVLIMEDTTWRIPTRETSKDAEFLQ 502

Query: 530  HYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELL 589
            HY ET EE+RPFGW+DL+F KD+Y   + V+CPT EG  NN + HF   EIR+SVNH++L
Sbjct: 503  HYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPTVEGFQNNFHVHFVETEIRSSVNHDIL 562

Query: 590  LRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPY 649
            L++K F+ + D+GYPLGWN +A W IN+ S QLE F+LREHITL++D  +DFS+G+PTPY
Sbjct: 563  LKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLEAFLLREHITLVADTLSDFSAGEPTPY 622

Query: 650  ELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVA 709
            ELFRPF+Y++NW ++GYSIYLNVNDHNIVNNPLDFNENCYLSLHGD L  D+ +PR+++ 
Sbjct: 623  ELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDRLYIDITVPRESIL 682

Query: 710  NRCTEITYHISTPMFRXXXXXXXXXXXXEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVD 769
               T+I+Y ISTPMFR            EFMK+KEVGR+Y+F V G Y ++SELDIDNVD
Sbjct: 683  GTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGRAYDFTVKGSYLLYSELDIDNVD 742

Query: 770  TISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENLGDE 829
            T+ +EC+S  T LHCYGFV+RYL NVKMNYFG+F +FVT+EEYT      E     +  +
Sbjct: 743  TLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVG--EIITK 800

Query: 830  HSGFNISSTEDVETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGALILPE 889
             S  +++ST D     ++ +    +K  P+ KRS+LKRT NE DIWF FSVW GALILPE
Sbjct: 801  SSVLDLASTLDSGYQNSSLKNESEDKD-PV-KRSDLKRTTNETDIWFTFSVWNGALILPE 858

Query: 890  TIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDNGRQ 949
            TIY+ DPCIALHF EL VD RS NYYMD++A +N T +KR+VS+  +++F+ +R++NG  
Sbjct: 859  TIYSLDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHVSKPINEVFDFIRRNNGAN 918

Query: 950  EKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSKIGFG 1009
            E+ HG LS LTIHGHRM+GLPPTEPTYFCQW +++  L I+SD+EF KGF   F KIGFG
Sbjct: 919  EQEHGTLSDLTIHGHRMFGLPPTEPTYFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFG 978

Query: 1010 FKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFENEAY 1069
            + +LENILLY+T T+ DMTS+TV  + +K   ND    S+SV+ A+ + FT IDFENE Y
Sbjct: 979  YNDLENILLYDTETVDDMTSLTVHAERIKISFNDPVMKSQSVVTAESLLFTLIDFENERY 1038

Query: 1070 SQRVDFKFPDINFLIFELDENQKEG--RFLLHLKTQLNFTDFIQNQAFADHRYRQREYIT 1127
            SQR+D K P    LI  L     +G     L  +T+L FT+F Q +     R  QR YIT
Sbjct: 1039 SQRIDVKIPK---LIISLSCVMGDGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYIT 1095

Query: 1128 LHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATXXXXXXXXXAETIDYIIEDCLGEYA 1187
             HDS Y+RC FLLP F+Q+S  Y++L G+I+PS++          +TID+IIED +GEYA
Sbjct: 1096 AHDSPYHRCPFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLPTLPDTIDFIIEDIVGEYA 1155

Query: 1188 PTVKPDD------SSSSDTSEGQRTPLTNEDTRFQANSGFFSPHMPHXXXXXXXXXXXXV 1241
              ++  +      + +  T E  R   T +D   +A+   F P                V
Sbjct: 1156 TLLETTNPFKDIFAETPSTVEPSRASSTEDDNDERADPLEFKPIA--FTEGRNHQRGNYV 1213

Query: 1242 LDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVTTSRL 1301
            +DV Y+ L+V P +     + LK+FY+ED   ++D  EI IVK+L NLQ G + ++   +
Sbjct: 1214 IDVSYILLDVDPLLFVFTKSLLKEFYSEDMVQVLDDIEIGIVKQLSNLQEGITSISNIDV 1273

Query: 1302 HVKDLHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISLLEA 1361
            H+  ++ ++      G EL L+  D+ +  K++E      +LE    + I T+R+++ + 
Sbjct: 1274 HIAYMNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTSKLLEVATLARIKTVRVTVNQK 1333

Query: 1362 HPSSISM-KPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQIK 1420
                +S  +P AL L +E  E+WSST D  VNS+N+TS   T+DESQ+E +  Y   Q  
Sbjct: 1334 RNPDLSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGN 1393

Query: 1421 VLRDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVREN 1480
            ++++ + S   +++ R  ++ +LI  LT+ASEYYQISHDPYVITKPAFIMRLS+GHVREN
Sbjct: 1394 LIQEALNSFHSIQSTRISSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVREN 1453

Query: 1481 RSWRIITRLRHILTYLPNDWRTADHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDLSDI 1540
            RSW+IITRLRHILTYLP+DW+  D++  V         +  ++IF+SVFS WRNW+ SD+
Sbjct: 1454 RSWKIITRLRHILTYLPDDWQ--DNIEKVLKERKYTSAKDAKNIFMSVFSTWRNWEFSDV 1511

Query: 1541 TRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNIIVDVL 1600
             RSYIY K+F   N +  +  ++ +LK    SF+ TV   GYEV  + +    N++VD+ 
Sbjct: 1512 ARSYIYGKLFSVDNAEHKQNLMKKLLKCTMGSFYLTVYGEGYEVEHNFVIADANLVVDLT 1571

Query: 1601 PPSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLGSIS 1660
            PP  + S      +E+ I +T  +G++KG++ + + KL++L                 I 
Sbjct: 1572 PPVTSLS----LNREETIEITGRVGSVKGKFSDRLLKLQDL-----------------IP 1610

Query: 1661 RSASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIINGK 1720
              A++ G           ++    +  +  K+   ++ ++ ++  V+  T+L +R + G+
Sbjct: 1611 LVAAVGG---------GDKSDAKAELSKQFKMNTVLLVDKSEIQLVMDQTKLMSRTVGGR 1661

Query: 1721 NSMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQL-GVIPFVS 1779
             S+L EN K++T  A S V F+Q+ E+WLKH++ +L E  L+   + AT +     P + 
Sbjct: 1662 VSLLWENLKDSTSQAGSLVIFSQKSEVWLKHASIILCEAQLRDFSILATTEAWSHKPTIL 1721

Query: 1780 LNCQATNSFIRAMPST-------VVLRNSVEKIKRQVEVLIPQFKSHEVKNSSAVTKKTP 1832
            +N Q  +   RAM +T         +R SV KIK ++     +FK    K S  V    P
Sbjct: 1722 INNQCADLHFRAMSTTEQTVTVITEIRESVLKIKDRI-----KFKPKSKKRSQFV---GP 1773

Query: 1833 RIPIKFDIRFNFTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQ 1892
            +I I       F+++SSEIM LSPFY+  + KQL IY +   + E++L   + D ++ S 
Sbjct: 1774 KINIVLSCY--FSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEVLLSIWDTDFFMTSH 1831

Query: 1893 LSSEQFFKFSSTDLQFKCXXXXXXXXXXXXQISTSLMKLTLCEPRRALHNLLQDEQTLVE 1952
             + EQ+ +FS  D++ K              IS S++KLT  EPRR +++ LQDE+   +
Sbjct: 1832 QTKEQYLRFSFGDIEIKGGISKEDYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQ 1891

Query: 1953 SVDHIQKLWNFLRSAS---GGNDRSPSRNTRWALDANLKYFGLLVPVSSICYIFELHSLF 2009
             ++ +  L + L ++        ++P+R   W LD ++ YFG+LVPV+S  ++FELH L 
Sbjct: 1892 GINLLSSLKSLLFTSGLPKKKKKKAPARMINWTLDTSITYFGILVPVASTYFVFELHMLL 1951

Query: 2010 ASLTNANEQYEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQ 2069
             SLTN N      +   +GQ  +E+   L+KE SLP  LSK+LDFSI+  T Q+  ++ Q
Sbjct: 1952 LSLTNTNNGMLPEEAKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQ 2011

Query: 2070 SYQIESSYFRLCLFPELLVDILWSVHYLQSLLNHFKKHHTP--W-LPYSSNKTAKSGEST 2126
            S+Q+ESS+FR+CL P+ L+ ++W  H L  L +++ + H P  W +   + K+ K  E  
Sbjct: 2012 SFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYSRRHAPNIWDIKMFTGKSDKPKEIP 2071

Query: 2127 LDFRSIHILSYNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGN 2186
            ++FRSIHILSY FC+GWLF+ G  S+PGL+LGY+RLFSAYEK FGK T++D + SVANGN
Sbjct: 2072 INFRSIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGN 2131

Query: 2187 TSDTFYSQKSEKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVE 2246
             S TF+S+ +EKD Y R++L NMQI YW K    LKD F RFHGE +DV F+ +   +++
Sbjct: 2132 KSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVID 2191

Query: 2247 KTLHSIKRFNEMKKAKIKQTGSSTKSKLN------MEAASNTLAPFLAHIRTINSQLNFA 2300
             TL S++ F E+KK  +  +  S     N      ME+ASN+LAPFL +IR++NS   + 
Sbjct: 2192 STLQSVRAFQELKKNILDVSEDSHMEDDNPYATSSMESASNSLAPFLDNIRSVNSNFKYD 2251

Query: 2301 GGVFKVYSPTELDSKAEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFA 2360
            GGVF+VY+  ++++K+EP  EIKSP V +   Y+ NE   K H IR    ++PT N L+A
Sbjct: 2252 GGVFRVYTYDDIEAKSEPSFEIKSPVVTINCTYKHNENEAKPHRIRILIAVDPTLNTLYA 2311

Query: 2361 KCAPLLSDFNHNIKNMIRNLSSEDKSHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSF 2420
             CAPLL +F+ +++ MI+  S++DK   +KP + ++DYK LL+ +D+A ++ S KQ+LS 
Sbjct: 2312 GCAPLLMEFSESLQKMIKKHSTDDKPSFTKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSL 2371

Query: 2421 SCEPKAKVQLDAGFNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLD 2480
            SCEPKAKVQ D GF SFLF +TT++ DS +P   S ++ + ++S+RHIFSR+ S +F + 
Sbjct: 2372 SCEPKAKVQADVGFESFLFSMTTNEFDSEQPLEFSLTLQQTKASIRHIFSREVSTSFEVG 2431

Query: 2481 YIDIVMMFTYPNV---YGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAE 2537
            ++D+ ++FT+P+V   YG +LVSD++++ N+KQ QNL +FLDIWR S+   T+P +    
Sbjct: 2432 FMDLTLLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPVQGSIS 2491

Query: 2538 DKSDAKKXXXXXXXXXXXXXRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTK 2597
             + D                    PW FT+IFTN+ G VDLGPSLGV++L  ++ W+ T 
Sbjct: 2492 KEIDMSSLTSTNYVDVGAE----IPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATD 2547

Query: 2598 HQGDQKRTWHTFAHGITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAIN 2657
            H  ++++  H F  G+++ SEGRLSG+FE+  AS +SE+ W  E      PL+S S+ I+
Sbjct: 2548 HYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANASWISEVKWSLEKSKNSHPLVSTSLNID 2607

Query: 2658 RMSIKSAFDYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCXXXXXXXXX 2717
             +++K+AFDYHMFLIG++ +++  LHNE D   ILPDLLQVS   + I L          
Sbjct: 2608 DVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKGILPDLLQVSFSSDEITLSSTALVAANI 2667

Query: 2718 XDIYNTIMRMQQDNRISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVH 2777
             DIYNTI+RM+QDN+ISY+ETL++SN   S   + Y+++L SL LLRTD+S+ +  LKV 
Sbjct: 2668 LDIYNTIVRMRQDNKISYMETLRDSNPGESKQPILYKDILRSLKLLRTDLSLNISSLKVQ 2727

Query: 2778 ISPMSLFDAEVLVVSVRDVNARSETQSGEKLKTELQLQISDVNAXXXXXXXXXXXXTVSK 2837
            ISP+SLFD EVLVV +++V+ RSET SG+KLKT+LQLQ+ DV+A              + 
Sbjct: 2728 ISPISLFDVEVLVVRIKNVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGAS 2787

Query: 2838 IAVDDYMLYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPV 2897
            IA+DDY+ YASK  GGTII +P+L V MTT Q++ +  +EYLF C F DKIS+KWNLGPV
Sbjct: 2788 IAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEYLFACSFSDKISVKWNLGPV 2847

Query: 2898 NFIKEMWATHVRSLAVRRTQLGNSS-----PELEVANESDKEDTVKSKFIYVPLDEPYIE 2952
            NFIKEMW THV++LAVR++Q+ N S      ELE   ES K     SKF Y+ L+EP I+
Sbjct: 2848 NFIKEMWTTHVKALAVRQSQIANVSFGQTEEELE---ESIKTKETTSKFNYIALEEPQIQ 2904

Query: 2953 MPQIKDLGDATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKL 3002
            +PQI+DLGDATPP+EWFGV+RK  P  THQTAV+ +QKLV+ AEK+Y K+
Sbjct: 2905 VPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKI 2954

>NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2959

 Score = 2646 bits (6858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1385/3043 (45%), Positives = 1944/3043 (63%), Gaps = 135/3043 (4%)

Query: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60
            MD  S FQ++ L + ++FSWVFLVDW+L  IVTL VIFYL R   + ++FILEW +WKR 
Sbjct: 1    MDAISQFQRIPLTKQKDFSWVFLVDWILILIVTLFVIFYLSRTLAYGISFILEWFLWKRS 60

Query: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQXXXXXX 120
             VKINIES+RI+PLGG + F+N+ IIH+DYTIS LE  + WRYWL N RKS Y       
Sbjct: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPEL-- 118

Query: 121  XXXXXXGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVD 180
                    +  S +  K PCRF L  EGLEIFVYN+  +Y+NII  FSKEER QFEKF++
Sbjct: 119  -------PDKASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLN 171

Query: 181  DQTMTELFNESEQENKVLSESTPSSVTMETVGXXXXXXXXXXXXXXXAGRNQNDGQAPNN 240
            +Q  T+  +++E  N   SES     T E+ G                       ++ ++
Sbjct: 172  EQVFTD--SKAEVSN---SESNSEEDTFESAGTF---------------------KSDSS 205

Query: 241  LENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPP 300
              ND +F+++ S R   ++ FLPI       SL++GN+FTPS+++ S  +  G+ID+C P
Sbjct: 206  TTNDRVFQEELSERPQ-FLDFLPIDFKVSHGSLIIGNKFTPSLMIGSCSSCTGMIDVCQP 264

Query: 301  KEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFL--LPT 358
             EKLDL+K++   +       +KQNIGF+++ S  FK  R R+SK+WQ+F ++ L     
Sbjct: 265  SEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEFSMKFKIDRNRVSKMWQQFNKVLLTCYSH 324

Query: 359  LGPKHLQTQ---EDITFRENWKGLSLYRQNM---EEDELENVDFDFANHEYARVISILKS 412
            +   HL++    E+  F E W+GLSLYR  +     D++ ++DFDFANHEYA+  SI+++
Sbjct: 325  MKLSHLRSNKVSEEDPFYEKWRGLSLYRGTIFGKSNDDINDIDFDFANHEYAKFSSIVRT 384

Query: 413  AKIVFTYEYDIPGLVPKEPEETL---QGPEVGNSGAPPEFGVDIQLYGANICYGPWAERQ 469
             + +FT+E DIPG+VP     TL    GP+VGNSGAPPEF ++IQ+ G +IC+GPWA+RQ
Sbjct: 385  PQAIFTFECDIPGIVPHGAHPTLTATDGPDVGNSGAPPEFSLEIQISGGSICFGPWAQRQ 444

Query: 470  LSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLR 529
            L+ L  LLSP+ SR  KP K LTPG  RIYT FKT+IS  EE+TWRIPTRE SKD EFL+
Sbjct: 445  LNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQFKTTISTTEETTWRIPTRESSKDPEFLQ 504

Query: 530  HYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELL 589
            HY ET EE+RPFGWIDLKF KD+Y       CPT+EG  N ++ H  + EIR+SVNH++L
Sbjct: 505  HYRETNEEYRPFGWIDLKFSKDTYICSTVAQCPTKEGFKNTLDIHLGDNEIRSSVNHDIL 564

Query: 590  LRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPY 649
            L+ KSF+F  D+G+PLGWN++A W I+L STQLE FILREHITLI+D   DFSSG+PTPY
Sbjct: 565  LKCKSFNFVMDIGFPLGWNEEATWTIDLESTQLEAFILREHITLIADTLTDFSSGEPTPY 624

Query: 650  ELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVA 709
            ELFRPF+YRINW ++GYS+YLNVNDHNIVNNPLDFNENCYLS HGD L  D+ +P++ V+
Sbjct: 625  ELFRPFVYRINWKINGYSLYLNVNDHNIVNNPLDFNENCYLSFHGDILQIDLVVPKREVS 684

Query: 710  NRCTEITYHISTPMFRXXXXXXXXXXXXEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVD 769
               TE++Y I TPMFR            EFMKNKEVGRS++F++ G Y ++SELDIDNVD
Sbjct: 685  AGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMKNKEVGRSHDFKITGSYLIYSELDIDNVD 744

Query: 770  TISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENLGDE 829
            TI +ECSS  T L CYGFV+RYL NVKMNYFGDF HFVT+EEYT      E +N+    +
Sbjct: 745  TIIIECSSQSTVLQCYGFVIRYLTNVKMNYFGDFFHFVTSEEYTGEIRANEVQNQFTDRQ 804

Query: 830  --HSGFNISSTEDVETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGALIL 887
                  ++SS E +ET       R    G    KRS+LKR  NE D+WF F+VWEGA++L
Sbjct: 805  LYEDKASLSSYESIETSSV----RKEQTGDSKIKRSDLKRATNETDLWFTFTVWEGAILL 860

Query: 888  PETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDNG 947
            PETIYN DPCI LHF EL +D RS NYYMDLLA+MN+  L+RY+ +  ++++E VR+DNG
Sbjct: 861  PETIYNCDPCIGLHFGELLIDFRSCNYYMDLLASMNDISLRRYIGKQQNEIYESVRQDNG 920

Query: 948  RQEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSKIG 1007
               K +G LS + IH HRMYGLPP EPTYFCQW   +  L++N D+ F +GF+T F+KI 
Sbjct: 921  CGNKKYGSLSDMVIHAHRMYGLPPLEPTYFCQWDFSLGTLDLNCDISFLEGFITSFNKIS 980

Query: 1008 FGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFENE 1067
            FG  +LENILLYE   + DMTS+TV VK++  M+ +++  +  +  A+++ F+ I+FENE
Sbjct: 981  FGLVDLENILLYEKEVIDDMTSLTVDVKKISIMIRESEMDTFLLCTAEELYFSNINFENE 1040

Query: 1068 AYSQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREYIT 1127
             Y  R+D + P  N  ++ ++  +KE   L   +T++N ++F +    A H+ +Q+EYIT
Sbjct: 1041 KYCTRLDLRIPIFNLFMYTMNGAKKEK--LFEFETKVNLSNFEKPNDIATHKSKQQEYIT 1098

Query: 1128 LHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATXXXXXXXXXAETIDYIIEDCLGEYA 1187
            LHD+ Y+RC+F+LP   Q+S +Y++L GSI+PS++           TIDYI++D LG + 
Sbjct: 1099 LHDAPYHRCAFILPPSLQDSEIYQDLFGSIAPSSSLPPLPIPLLPATIDYIVDDLLGCFP 1158

Query: 1188 PTVKPDD----SSSSDTSEGQRTPLTNEDTRFQANSGFFSPHMPHXXXXXXXXXXXXVLD 1243
              ++ ++      S  TS     P    DT                           V+D
Sbjct: 1159 EILESENPFRIPFSPATSPKLGNPFEGSDTESDEELDPLEFKTETSGDSETFASDNFVID 1218

Query: 1244 VEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVTTSRLHV 1303
            + Y +L + P +   L N  + F ++D   I+D  EI IV  L +LQ G       +L +
Sbjct: 1219 ISYCSLSINPRLWSYLDNCREHFCSQDIVQILDDIEIGIVNHLSDLQEGIETARNIKLQI 1278

Query: 1304 KDLHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISLLEAHP 1363
              L   +   + +G+ L L+  D ++ +K +E  +E  I E T  + I ++R ++ EA  
Sbjct: 1279 LYLDLFWGDRQNAGISLYLDRIDLEMCQKMLEENNETKITEVTFLNKIRSVRATINEA-- 1336

Query: 1364 SSISM---KPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQIK 1420
            SS+     +P AL L IE  E+WS   +  VNS+N+ S   T+DE+Q++ +  Y+  Q+ 
Sbjct: 1337 SSVGKADERPPALSLVIEGSEIWSCITNAQVNSLNILSADITIDEAQIDWLFQYIDKQLT 1396

Query: 1421 VLRDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVREN 1480
            + ++  ++ + ++  R  T+K L+  L  ASEYYQISHDPYVITKPAFI RLS GHVREN
Sbjct: 1397 LSQEIASALQSIQESRSTTRKQLVSKLAVASEYYQISHDPYVITKPAFITRLSRGHVREN 1456

Query: 1481 RSWRIITRLRHILTYLPNDW-RTADHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDLSD 1539
            RSW+IITRLRHILTYLP DW R  D +   QDS     P    + F+SVFSNWRNW+ SD
Sbjct: 1457 RSWKIITRLRHILTYLPIDWLRVIDEMRNQQDSHTLPDPG---NAFISVFSNWRNWEFSD 1513

Query: 1540 ITRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNIIVDV 1599
            I RSYIY+ +F   +    +  +   +K+   S FFTV  +GYEV  + I TRTN++V+ 
Sbjct: 1514 IARSYIYRNMFSEGHSKKQENSMENSIKLKLASLFFTVYSTGYEVEHNFILTRTNVVVET 1573

Query: 1600 LPPSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLGSI 1659
            LP   ++S      QEK+I +T ++G IKG+   ++  LK+L  + S  +     NL   
Sbjct: 1574 LPAISDSS----IIQEKIINVTGSLGTIKGKTSHKLINLKKLLPELSMKK-----NL--- 1621

Query: 1660 SRSASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIING 1719
                               + S P    R  K+   ++FER +L FV+G +++ +R+  G
Sbjct: 1622 -------------------KPSTP--FLRCFKLNMLLLFERSELQFVLGASKVMSRVFGG 1660

Query: 1720 KNSMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQ-LGVIPFV 1778
            K SML E+ K+    A+S   +AQR E+W+KH   +LAE  +++  +  TA+     P V
Sbjct: 1661 KLSMLWESPKDLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAESWSYKPTV 1720

Query: 1779 SLNCQATNSFIRAMPSTVVLRNSVEKIKRQVEVLIPQFKSHEVKNSSAVTKKTPRIPIKF 1838
             +N Q T+   RAM +T VL  SV +I   ++ L   F S        ++ + P +  K 
Sbjct: 1721 LVNLQCTDIHFRAMTATDVLAKSVGEIIENIKELEKLFYSDSDSGIQQIS-QYPVMEQKI 1779

Query: 1839 DIRFN--FTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSE 1896
            ++     FT+++ EIM LSPF    + KQL IY +   + +LVL   + D++L S L+ E
Sbjct: 1780 NMVLTCYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKE 1839

Query: 1897 QFFKFSSTDLQFKCXXXXXXXXXXXXQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDH 1956
            ++F+FS  ++Q K              +S S++KLTL + RR + + LQDE+ L+ES++ 
Sbjct: 1840 EYFRFSFGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQ 1899

Query: 1957 IQKLWNFLRSASGGNDRSPSRNTRWALDANLKYFGLLVPVSSICYIFELHSLFASLTNAN 2016
               L  F R     +     R   W+L++N+ YFGLLVP+SS  +I ELH L  SL    
Sbjct: 1900 FSSLKLFQRKKPAPSTEKSGRTVTWSLESNINYFGLLVPISSTYFILELHMLLMSLNKIQ 1959

Query: 2017 EQYEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIESS 2076
                +Y+   SGQ  +++   L+KE SLPA+LSK+LDFSI+  T QK+  + +S+QIES 
Sbjct: 1960 GISSKYN-GLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESP 2018

Query: 2077 YFRLCLFPELLVDILWSVHYLQSLLNHFKKHHT-PWLPYSSNK-TAKSGESTLDFRSIHI 2134
            +FR+CL P  L  +LW  +   + + ++K+H +  W    + K T  S E   DF S H+
Sbjct: 2019 HFRVCLSPGSLAHMLWRGNQALTNIRYYKEHTSVAWEKVINFKNTNNSAEVQADFPSFHV 2078

Query: 2135 LSYNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDTFYSQ 2194
            LSYNFCVGWLF    ++EPGLI+GY RLFSAYEK+FGKLTLID Y SVANG TSDTF+S+
Sbjct: 2079 LSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSK 2138

Query: 2195 KSEKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKR 2254
              EKD Y R+YL NMQI YWLK E LL+D+++RFHGE +DV FL++   ++E +L SI++
Sbjct: 2139 GHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQK 2198

Query: 2255 FNEMKKAKI-------KQTGSSTKSKLNMEAASNTLAPFLAHIRTINSQLNFAGGVFKVY 2307
            F E+K+  +       +QT S+T+  +        ++PF   IR+IN Q  + GGVFKV+
Sbjct: 2199 FQELKRDLVGTASNIKEQTQSTTQEPI------GDISPFFTGIRSINCQFQYDGGVFKVF 2252

Query: 2308 SPTELDSKAEPLLEIKSPGVQMAINYEFNETREKSHC-IRFFTTIEPTHNMLFAKCAPLL 2366
            S  E  +  +P  EIKSP V + +NY++NE + ++   IR   TI  THN LFAKCAPL+
Sbjct: 2253 SSAEASNHLKPSFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTHNTLFAKCAPLI 2312

Query: 2367 SDFNHNIKNMIRNLSSEDKSHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSCEPKA 2426
            ++F+  I+ M++  SS+ +   +     +IDYK +L+ +D+A E+ S KQ LS  CEP+A
Sbjct: 2313 AEFSEGIQKMVKRHSSDREPSGTNISKQNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRA 2372

Query: 2427 KVQLDAGFNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVM 2486
            KVQ D GF SF F VTT+  D  EP   + S++K E+S++HIFSR++S +F +D+ID+ +
Sbjct: 2373 KVQADIGFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREASTSFGVDFIDLTV 2432

Query: 2487 MFTYP---NVYGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAK 2543
            MFT+P   N+ G  L+SD++++ N+KQ QNL +FLDIW+LSN   +KP     + ++D K
Sbjct: 2433 MFTHPNSINILGTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNSKPMNEVVKSRTDLK 2492

Query: 2544 KXXXXXXXXXXXXXRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQK 2603
                              PW FT+IF+N+ G VDLGP+LGVL+L  ++ W  T H    +
Sbjct: 2493 SLSSVQSKDTD----STIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFATDHYKSTR 2548

Query: 2604 RTWHTFAHGITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIKS 2663
            +  H +  GIT+ S+GRLSG+ ELD AS +SE++WP  + +   PL+S+S+ I+R+  K 
Sbjct: 2549 KVLHAYTKGITLTSKGRLSGILELDGASWISEVNWPIYENINDYPLVSISLNIDRVETKV 2608

Query: 2664 AFDYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCXXXXXXXXXXDIYNT 2723
            AFDYHMFL+G++ ++ VH+H+E D   I PDLL+V++  E+I LC          DIYNT
Sbjct: 2609 AFDYHMFLVGAINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTALVAANILDIYNT 2668

Query: 2724 IMRMQQDNRISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSL 2783
            +MR++QDN+ISYIETLKESN S    ++ Y+++L SLNL++TD+SV +  L + ISP+SL
Sbjct: 2669 VMRLRQDNKISYIETLKESNTSEPRQALDYKDILRSLNLIQTDVSVDIYTLNIQISPISL 2728

Query: 2784 FDAEVLVVSVRDVNARSETQSGEKLKTELQLQISDVNAXXXXXXXXXXXXTVSKIAVDDY 2843
            FDAE+LVV++ +++ARSET +G KLKTEL++Q+ D +              ++ I+V+DY
Sbjct: 2729 FDAEILVVNIENISARSETHAGNKLKTELEMQVYDASVALSTSKEELDEDIIATISVEDY 2788

Query: 2844 MLYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEM 2903
            M YA + SGG II+ P+LL++MTT+Q++ S +LEYL+TC F DKIS++WNLGPVNFIKEM
Sbjct: 2789 MHYAGRISGGVIIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLGPVNFIKEM 2848

Query: 2904 WATHVRSLAVRRTQL----GNSSPELEVANESDKEDTVKSKFIYVPLDEPYIEMPQIKDL 2959
            WATHVR++AVRR+Q+    G  S E +V     KE+   S+F YVPL+EP I+MPQI+DL
Sbjct: 2849 WATHVRAMAVRRSQIDVTFGPVSEE-DVGKRIKKEEEF-SRFQYVPLEEPRIDMPQIRDL 2906

Query: 2960 GDATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKL 3002
            GDATPPLEWFG++RK  PA THQTAV+L+QKLVHTAEKEY  +
Sbjct: 2907 GDATPPLEWFGLNRKRFPAFTHQTAVILVQKLVHTAEKEYGSI 2949

>KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2982

 Score = 2571 bits (6664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1334/3046 (43%), Positives = 1931/3046 (63%), Gaps = 113/3046 (3%)

Query: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60
            M   S FQ V +   +NFSWVFL+DW+L  ++ L+VIFY+GR   ++ + ILEW++WKR 
Sbjct: 1    MASSSEFQSVPISGGKNFSWVFLLDWILLVVLCLSVIFYVGRAIAYITSLILEWLLWKRA 60

Query: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQXXXXXX 120
             +K+NIESLRI+ LGG I F+N+ IIH+DYTIS L+GT+ WRYWL  +RK  Y       
Sbjct: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120

Query: 121  XXXXXXGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVD 180
                  G   K N   + PCRF+L CEG EIFVYN+T SY+NII++FSKEER +F+KF+D
Sbjct: 121  N-----GVTMKKN--EQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLD 173

Query: 181  DQTMTELFNESEQENKVLSESTPSSVTMETVGXXXXXXXXXXXXXXXAGRNQNDGQAPNN 240
            +Q    +FN+    +   +    SS      G               +G +    Q+  N
Sbjct: 174  EQ----IFNDHSSYSSKTTNGANSST-----GESNSDTKLNDEDFVESGYS---SQSTYN 221

Query: 241  LENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPP 300
              ND +F+Q  S++ S++++  P++I   R SL  GN+FTPS++++S+++  GIID C P
Sbjct: 222  QNNDRIFDQAKSDKDSLFLQTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQP 281

Query: 301  KEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFLLPT-- 358
            KEKLDL+K+KL  E ++   +VK NIG+ +++   FK  RG+LS+LW++F  I  + T  
Sbjct: 282  KEKLDLYKMKLAIETHNFAVTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRP 341

Query: 359  LG---PKHLQTQEDITFRENWKGLSLYRQNMEE---DELENVDFDFANHEYARVISILKS 412
            LG    K  + +    F + W+GLSLY+  + E   D+L+++ FDF NHEYA+  S++K 
Sbjct: 342  LGLTQRKKKRNEPPDLFIQKWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKC 401

Query: 413  AKIVFTYEYDIPGLVPKEPEET---LQGPEVGNSGAPPEFGVDIQLYGANICYGPWAERQ 469
             K +FTYEYDIPG VP     T   + GP+VGN+GAPP   +DIQ++G +ICYGPW +RQ
Sbjct: 402  PKAIFTYEYDIPGCVPHGAHPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQ 461

Query: 470  LSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLR 529
            ++++ ++L+P VSRT  P+K   PGS RIYT  K SISIM+++TWRI TRE SKD  FL+
Sbjct: 462  MNFIHSMLAPAVSRTESPVKRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLK 521

Query: 530  HYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELL 589
            HY ET +++RPFGWIDL+F K+SY      + PT EG  N++N H +  EIR+SVNH++L
Sbjct: 522  HYKETNDDYRPFGWIDLRFSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDIL 581

Query: 590  LRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPY 649
            ++ K FDF+ D+ YPL WND+A W I+++S QLE F+LREHITLI+D   DF+SG+PTPY
Sbjct: 582  MKCKFFDFDIDVSYPLVWNDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPY 641

Query: 650  ELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVA 709
            ELFRP    INW +D Y IYLNVNDHNIVNNPLDFNENCYLSLHGD L+ +V IP + + 
Sbjct: 642  ELFRPSETFINWKMDAYFIYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDIT 701

Query: 710  NRCTEITYHISTPMFRXXXXXXXXXXXXEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVD 769
             +  EITY+I+TPMFR            EFMK KEVGRSY+F   G Y ++SELD+DNVD
Sbjct: 702  AQFNEITYNITTPMFRLLLNTPPWNTLNEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVD 761

Query: 770  TISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPK----NEN 825
            TIS+ C S GTTL CYGFV+RYL NVKMNYFGDF +F+T+EEYT     EE +    + N
Sbjct: 762  TISIICESRGTTLQCYGFVIRYLANVKMNYFGDFFNFITSEEYTGITRDEELEEELISSN 821

Query: 826  LGDEHSGFNISSTEDVETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGAL 885
            L D     ++ S  +   D    +  P    +   KRS+L+RT NE D++  FSVW+GA+
Sbjct: 822  LSDNEDNGDVYSDGESGMDDAISQEIPERTTL---KRSDLRRTANETDLFLTFSVWDGAI 878

Query: 886  ILPETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKD 945
            ILPETIYN D C AL F EL +DLRS+NYYMDLLA++ +T ++RY  + P D+F+ V  D
Sbjct: 879  ILPETIYNCDNCTALKFGELIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHD 938

Query: 946  NGRQEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSK 1005
            N    ++ G+LS L+IHGHRM+GLPP EPTYFC+W  DI  L +NS+ +F KGFLT FS+
Sbjct: 939  NRESSEAQGFLSDLSIHGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSR 998

Query: 1006 IGFGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFE 1065
            IGFGFK+LENILLY    + DMTS+TV  +E+   + +  +     L  + + FT+IDFE
Sbjct: 999  IGFGFKDLENILLYSKEVINDMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFE 1058

Query: 1066 NEAYSQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREY 1125
            +  YS R+D   P +   ++ LD + K+ R L +  T+++ TDF Q + F  HR  QR Y
Sbjct: 1059 SANYSSRLDLIIPSLKMSMYGLDIDGKKAR-LFNFTTKVHLTDFAQKKNFKRHRSMQRNY 1117

Query: 1126 ITLHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATXXXXXXXXXAETIDYIIEDCLGE 1185
            ITL+D+A++R SFLLP  FQ+  LY EL GSI PS++          +T+D+I+ED LGE
Sbjct: 1118 ITLNDAAFHRTSFLLPQSFQKKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGE 1177

Query: 1186 YAPTVKPDDSSSSDTSEGQRTPLTNEDTRFQANSGFFSPHMPHXXXXXXXXXXX------ 1239
            Y   +        D     R P  + +T  QA++       P                  
Sbjct: 1178 YVSLL--------DDRTIFRMPFGSTNTPNQASTHHEEDMDPLEFSNSTVSTEKNYQCDN 1229

Query: 1240 XVLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVTTS 1299
             V+D+EY+++E+ PS++  + +     Y E+   +ID  EI  +K L   Q G S +T  
Sbjct: 1230 LVIDIEYISVEINPSISTYIESLSSTVYEENIVQVIDDIEIETIKILSTFQEGTSSITNI 1289

Query: 1300 RLHVKDLHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISLL 1359
            +L V      +   +  G+EL L+  DF++ ++ IE + EK +LE TM +   ++R S+ 
Sbjct: 1290 KLRVLYSDIYWGERDRYGIELYLDKLDFEMSQRNIEKDREKGLLEITMLAKTRSIRASIS 1349

Query: 1360 -EAHPSSISMKPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQ 1418
             E    +   +P AL L +E  ELWS+T ++ VNS++  S   T+DESQLE +  ++  Q
Sbjct: 1350 EEGSTKNEKERPPALSLVVEGCELWSATAEKQVNSIDTISTDITIDESQLEWLFLFVNEQ 1409

Query: 1419 IKVLRDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVR 1478
             + L++ IT+   ++     +++ LI  LT+A+++YQISHDPYVITKPAFI RLS+GHVR
Sbjct: 1410 NQNLQNIITTLNSVQAEHTVSRRKLISKLTAANDFYQISHDPYVITKPAFITRLSKGHVR 1469

Query: 1479 ENRSWRIITRLRHILTYLPNDWRTADHLVTVQDSENPNVPQRDE--DIFVSVFSNWRNWD 1536
            ENRSW+IITRLRHILTY+P+DW +       + S N     +DE   +F+SVFSNWRNW+
Sbjct: 1470 ENRSWKIITRLRHILTYIPSDWESGVENYLKEKSLN----DQDEAKKVFMSVFSNWRNWE 1525

Query: 1537 LSDITRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNII 1596
             SD+ RSYIY ++FL    +  K+ +R ++K+N  SFF T   +GY++ ++ + T  NI+
Sbjct: 1526 FSDVARSYIYGRLFLTNQAEKHKQSMRRIIKVNLSSFFLTSYTAGYDIDQNFVLTNANIV 1585

Query: 1597 VDVLPPSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNL 1656
             +  PP     +E    +EK+I LT ++G++KG + +E+ +LKEL    ++ +       
Sbjct: 1586 FEQTPP----FTEAGVSREKLINLTGSIGSVKGNFSDELLRLKELIPLLNKEQ------- 1634

Query: 1657 GSISRSASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRI 1716
              + RS S      Q+D +  S            K+ A ++FE+ ++  V+G+++LTNRI
Sbjct: 1635 EKMERSPSF-----QVDNIPKS-----------FKLNALLLFEKTEVQLVIGESKLTNRI 1678

Query: 1717 INGKNSMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQ-LGVI 1775
            +NGK S+LL++ KE   PA S + +A+R E  + H    L E  ++   ++AT +     
Sbjct: 1679 LNGKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSATVESWSSK 1738

Query: 1776 PFVSLNCQATNSFIRAMPSTVVLRNSVEKIKRQVEVLIPQFK-SHEVKNSSAVTKKTPRI 1834
            P V ++ Q  +  I++M  T  L NSV+++ + V+ +  Q   S  +      + K    
Sbjct: 1739 PTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAEGENKSPKKKLK 1798

Query: 1835 PIKFDIRFNFTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLS 1894
             ++ ++    +++S EIM +SPFY+  + K+  +      +  +++   + D +L+S L+
Sbjct: 1799 DVEIEVVCQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTDFFLRSDLT 1858

Query: 1895 SEQFFKFSSTDLQFKCXXXXXXXXXXXXQISTSLMKLTLCEPRRALHNLLQDEQTLVESV 1954
             +Q+F+ S  D Q                +S S++KLT  EP R L + LQDE+T  ES 
Sbjct: 1859 KQQYFRISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPNRILSSFLQDERTASESF 1918

Query: 1955 DHIQKLWNFLRSASGGN-DRSPSRNTRWALDANLKYFGLLVPVSSICYIFELHSLFASLT 2013
              ++ L  FL   + G    + ++  RW LD ++KYFG+LVP+S+  ++FE H+L  S++
Sbjct: 1919 KLLKALKPFLLPQTEGRLQPATTKEMRWLLDTDIKYFGILVPISTTYFVFETHALVLSMS 1978

Query: 2014 NAN-EQYEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQ 2072
            + + E+Y E D   S Q+ +E+   L+K+  +P+ LS++LDFSI F T QK+     S+Q
Sbjct: 1979 DIDTEKYTEKDETQS-QVSIENVVFLIKDRGIPSALSRMLDFSISFSTIQKMMELDTSFQ 2037

Query: 2073 IESSYFRLCLFPELLVDILWSVHYLQSLLNHFKKHHTP--W-LPYSSNKTAKSGEST--L 2127
            +ES++FR+ L P  LV ++W       L N++K+      W +  S  K  K G S+  +
Sbjct: 2038 VESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIKASKLKKEKKGSSSIGM 2097

Query: 2128 DFRSIHILSYNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNT 2187
            +  S H+LSYNFC+GW+F   + S PG++LG+ RLFSAYE  +GKLTL+D + SVA G T
Sbjct: 2098 NMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTLVDAFFSVARGAT 2157

Query: 2188 SDTFYSQKSEKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEK 2247
            S TFY ++SE +S  R+YL NMQI YW+K   L+KD+F+RFHGE +DV FL+T   ++E 
Sbjct: 2158 SATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDVSFLTTFITVIES 2217

Query: 2248 TLHSIKRFNEMKKAKIKQTGSSTKSKLNMEAASNTLAPFLAHIRTINSQLNFAGGVFKVY 2307
             L S + F E+K + I+   S+T++  N E    +LAPFL++I+++N Q  + GGVFKV+
Sbjct: 2218 MLQSFQVFQELKTSLIQPNTSTTEN--NTEPKIKSLAPFLSNIKSVNCQFKYDGGVFKVF 2275

Query: 2308 SPTELDSKAEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLS 2367
            S  +++S  EP  E+K+PGV +  NY+ N    K H IR    I  THN LFA CAPL++
Sbjct: 2276 SFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALVAIGSTHNTLFAVCAPLIA 2335

Query: 2368 DFNHNIKNMIRNLSSEDK-----SHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSC 2422
            +F  +I  M++  SS  K     ++ SK  + +IDYK LL+ +DIAF++ S +QKLS SC
Sbjct: 2336 EFLEHIHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDGFDIAFKLTSSEQKLSLSC 2395

Query: 2423 EPKAKVQLDAGFNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYI 2482
            EPKAKVQ D GF+SF+  + T+ +D  EP   S S+ K ++S++HIFS+++S +F LD I
Sbjct: 2396 EPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIKHIFSKETSTSFGLDLI 2455

Query: 2483 DIVMMFTYP---NVYGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDK 2539
            D+  MFT+P   N+YG  L+S++++Y N+KQ QNL +F+DIW+LS+  R  P       K
Sbjct: 2456 DLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKLSSFIRPGPKGKSNNGK 2515

Query: 2540 SDAKKXXXXXXXXXXXXXRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQ 2599
             + K                  PWSFT+IFTN+ G  DLGPSLGVL+L L++ W+ + H 
Sbjct: 2516 RENKHLTLPQPSNLYGE----IPWSFTLIFTNINGSADLGPSLGVLSLKLKRTWVASDHY 2571

Query: 2600 GDQKRTWHTFAHGITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRM 2659
             D+++    F   ++  S+GRLSG+FELD AS +SE+SWP+E      PL++VS+ I+ +
Sbjct: 2572 QDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTHNYPLVNVSVNIDNL 2631

Query: 2660 SIKSAFDYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCXXXXXXXXXXD 2719
            S+K+AFDYHMFLIG++ + K  LH+E D    +PDLL+V+   E I +C          D
Sbjct: 2632 SLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMINICSTALVAANILD 2691

Query: 2720 IYNTIMRMQQDNRISYIETLKESN-ISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHI 2778
            +YNT+MRM+QDN+I Y+ETL+ES+ +        Y ++L SLNLL+TD+S  +  LK+ +
Sbjct: 2692 LYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQTDVSTNIHVLKLQV 2751

Query: 2779 SPMSLFDAEVLVVSVRDVNARSETQSGEKLKTELQLQISDVNAXXXXXXXXXXXXTVSKI 2838
            SP++LFD EVLV+++ +++AR+ T +GEKLKT L+L++ D               TVS I
Sbjct: 2752 SPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGYVALSTSKREIDEDTVSAI 2811

Query: 2839 AVDDYMLYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVN 2898
            +V DYM YASK SGGTII++P+L ++MT+WQ+++S +LEYL+ C F DKI++KWNLGPVN
Sbjct: 2812 SVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTFEDKIAVKWNLGPVN 2871

Query: 2899 FIKEMWATHVRSLAVRRTQ--LGNSSPELEVANESDKEDTVKSKFIYVPLDEPYIEMPQI 2956
            FIKEMW THV++LAVRR+Q  L       E   +  KE+   SK  YVP++EP I+MPQI
Sbjct: 2872 FIKEMWTTHVKALAVRRSQNVLDTDMQTDEEVQKRIKEEENISKLKYVPIEEPRIDMPQI 2931

Query: 2957 KDLGDATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKL 3002
            +DLGDATPPLEWFGV+RK LPA THQT V+ +QKLVH AEK+YA L
Sbjct: 2932 RDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASL 2977

>KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2998

 Score = 2509 bits (6502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1318/3081 (42%), Positives = 1923/3081 (62%), Gaps = 170/3081 (5%)

Query: 2    DGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRCK 61
            D  S F  +SLD+ ++FSWVFLVDW+LT I+++TV+FY+GR   + ++FI EW++WKR +
Sbjct: 3    DTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYR 62

Query: 62   VKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQXXXXXXX 121
            +K+NIESLR++ LGG I F+NL II +DYTIS L G I+WRYWLF  R  Q+        
Sbjct: 63   LKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAED 122

Query: 122  XXXXXGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVDD 181
                  Q        K  CR LL CEG+E+F+YN+T +Y+N I MFSKEERA+FE+F+++
Sbjct: 123  DDGASLQR-----NEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNE 177

Query: 182  QTMTE------LFNESEQENKVLSESTPSSVTMETVGXXXXXXXXXXXXXXXAGRNQNDG 235
               T+          S +E+K   E    S T  +                       D 
Sbjct: 178  HVFTDRASTESSNGSSSEESKAQDEVEIKSYTESSF----------------------DE 215

Query: 236  QAPNNLENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGII 295
               + + ND +F  + +  K++++ +LP+QI     S V+GN+FTPS+L+VSA +++G++
Sbjct: 216  SNESQMANDRIFHDEETG-KNLFLNYLPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVM 274

Query: 296  DLCPPKEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKF--ARI 353
            D C PKEKLD++K KL  +  +V  S+KQNIG+++++   FK T G+LSKLW  F  A  
Sbjct: 275  DYCQPKEKLDIYKTKLTMDAKNVSVSLKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATA 334

Query: 354  FLLPTLG-PKHLQTQEDIT--FRENWKGLSLYRQNMEED---ELENVDFDFANHEYARVI 407
            F+   LG  +  + +  +T  F + W+GLSLY+  M ED   +L++++FD A HEYA+  
Sbjct: 335  FVRKPLGLSRKKKNRPSVTANFHQKWRGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFT 394

Query: 408  SILKSAKIVFTYEYDIPGLVPKEPEETLQ---GPEVGNSGAPPEFGVDIQLYGANICYGP 464
            SI+K  + + TYE+DIPG VP     TL    GP++GN+GAPP FG++IQL+G ++CYGP
Sbjct: 395  SIIKCPRAILTYEFDIPGFVPHGAHPTLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGP 454

Query: 465  WAERQLSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKD 524
            WA+RQ++++++LL+P +SR  KP+K L PG +R+YT+FK  I + E+ TWRIPTRE SKD
Sbjct: 455  WAQRQVAFIQSLLAPQISRDQKPVKPLQPGERRMYTLFKLGIVVNEDITWRIPTRESSKD 514

Query: 525  QEFLRHYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSV 584
             EFLRHY  T E++RPFGW+DLKF KDSY   +  +C T +GS N +  H  + EIR+SV
Sbjct: 515  AEFLRHYKNTNEDYRPFGWLDLKFSKDSYASFNFALCSTADGSQNTMKIHLGDSEIRSSV 574

Query: 585  NHELLLRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSG 644
            NH++ +++KS DF+ ++G+PLGWN++A W IN++S+QLE F+LREHITLI+D  +DFS+G
Sbjct: 575  NHDIFIKSKSLDFDLNLGFPLGWNEKAKWTINVASSQLETFLLREHITLIADTMSDFSTG 634

Query: 645  DPTPYELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIP 704
            +PTPYELFRPF+Y INW LDGYSIYLNVNDHNIVNNPLDFNENCYLS HGD L  D+ +P
Sbjct: 635  EPTPYELFRPFLYTINWKLDGYSIYLNVNDHNIVNNPLDFNENCYLSFHGDILNVDITVP 694

Query: 705  RQTVANRCTEITYHISTPMFRXXXXXXXXXXXXEFMKNKEVGRSYNFQVNGLYTVFSELD 764
            +  +  R T+I+Y+I TPMFR            EFMK+KEVGR+Y+F+  G Y +++ELD
Sbjct: 695  KDRIDARATDISYNIYTPMFRLMLNAPPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELD 754

Query: 765  IDNVDTISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNE 824
            +DNVD I++ CSS  T LHCYGFV+RYLMN+KMNYFGDF HFVT+EEYT    ++     
Sbjct: 755  VDNVDMITIICSSKSTVLHCYGFVIRYLMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEG 814

Query: 825  NLGDEHSGFNISSTEDVETDRTNPEGRPANKGIPMPKR-SELKRTENEMDIWFVFSVWEG 883
            +L +++S  + +ST   + D+ N E    +  + +P+  ++++R  NE D+W  F++WEG
Sbjct: 815  SLFEKYS--DDASTFVSDFDKNNEE----DDKVKVPRGPADVRRKTNETDLWLTFNIWEG 868

Query: 884  ALILPETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVR 943
            AL+LPETIYN DPCIALHF EL +D+RSTNYYMDLLA++++  L++Y +  P+++FE VR
Sbjct: 869  ALLLPETIYNCDPCIALHFGELAIDVRSTNYYMDLLASLDDIILRQYSNVQPNEIFENVR 928

Query: 944  KDNGRQEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCF 1003
            + NGR  K H Y+S++ IHGHRMYGLPPTEPTYFC+W  D+  +++ S+++F KG +T F
Sbjct: 929  QCNGRDVKGHSYISNINIHGHRMYGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSF 988

Query: 1004 SKIGFGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAID 1063
             KIGFGF +LEN+LLYE   + DMT+VTV VK+ K ++++ +  SR+ L    + F  ID
Sbjct: 989  QKIGFGFDDLENVLLYEKEVVDDMTAVTVNVKDFKIIIHNPELHSRAELILNNMQFCNID 1048

Query: 1064 FENEAYSQRVDFKFPDINFLIFELD-ENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQ 1122
            FENE YS R+D + P +   ++  + E  KE  F  + +T++NFT+F   +    HR  Q
Sbjct: 1049 FENEKYSTRMDIRIPLLKLSLYGYNYEASKELSF-FNFETKINFTNFCNYKNCVQHRALQ 1107

Query: 1123 REYITLHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATXXXXXXXXXAETIDYIIEDC 1182
            R+YIT++D+ ++RC F+LP  +Q SV+Y++L GSI PS++          ET ++II+D 
Sbjct: 1108 RDYITMNDAPFHRCGFILPASYQNSVIYQKLYGSIVPSSSLPPLPLPLLEETFEFIIQDF 1167

Query: 1183 LGEYAPTVK--------PDDS---SSSDTSEGQRTPLTNEDTRFQANSGFFSPHMPHXXX 1231
            L EY  T          PD +   S S  S     P T  DT  +      SP +P    
Sbjct: 1168 LHEYNTTSDCIILNLPYPDSTNLNSDSFNSYPDTAPHTLSDTIIRK-----SP-LPE--- 1218

Query: 1232 XXXXXXXXXVLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQY 1291
                     V+D  Y+++ + P +   +   L  FY +D T +ID  EI +VK+L N Q 
Sbjct: 1219 ---DERDNYVIDFRYISISIDPELFFYIEKLLNHFYGDDDTQVIDSIEIGLVKRLSNFQE 1275

Query: 1292 GASFVTTSRLHVKDLHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNI 1351
            G S +   ++ +      +   +  G+EL L++ DF++  K+IE   EK + E T    +
Sbjct: 1276 GISSINNFKIRILFFDVFWGQRDTGGIELYLDTLDFEMNEKSIEKNREKSLTEVTTLMKL 1335

Query: 1352 HTLRISLLEAHP-SSISMKPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLER 1410
            +++R S+   +       +P AL L +E ++ WS+T  + +NS+ +TS   T+DE+Q+  
Sbjct: 1336 NSIRASVNAKYSRGKTEGQPPALSLMVEGVKFWSTTAKKVINSIILTSIDATIDETQVVW 1395

Query: 1411 ISGYLFGQIKVLRDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIM 1470
            +  +   Q +++   + + ++++ LR +++K+LI  LT ASEYYQISHDPYVITKPAFI 
Sbjct: 1396 LFNFFGDQKELIGSVVKTFEKVQKLRTQSRKELISRLTVASEYYQISHDPYVITKPAFIT 1455

Query: 1471 RLSEGHVRENRSWRIITRLRHILTYLPNDWRTADHLVTVQDSENP-NVPQRDEDIFVSVF 1529
            RLS GHVRENRSW+IITRLRHI+TYLP+DW   +  V  Q  E   N  +  + IF+SVF
Sbjct: 1456 RLSRGHVRENRSWKIITRLRHIMTYLPDDW---NETVAKQLKERKYNASKDAKSIFMSVF 1512

Query: 1530 SNWRNWDLSDITRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTI 1589
            S+WRNW+ SD+ RSYIY K+FL    +  +K +    K  F S + TV  +G  V  S I
Sbjct: 1513 SSWRNWEFSDVARSYIYNKVFLANQAEKQQKTVNKGWKAAFVSVYITVYTAGLGVDHSFI 1572

Query: 1590 FTRTNIIVDVLPPSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENE 1649
             T++N++ +  P     ++E+ + QEKVI +T N+G+IKG+  +++FKL  L +   + E
Sbjct: 1573 VTKSNLVFEETP----DTTESGYNQEKVINVTGNLGSIKGKISDKMFKLHNLMNLVQQQE 1628

Query: 1650 LDDLSNLGSISRSASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGD 1709
               L ++ S SRS                            K+   ++F+  DL FV G+
Sbjct: 1629 DPALKSISSFSRS---------------------------FKLNIALLFDSSDLLFVFGE 1661

Query: 1710 TRLTNRIINGKNSMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAAT 1769
            T LTN I +GK S L EN K  T    S V +A+R E  +KH  ++L E  +  + ++A 
Sbjct: 1662 TSLTNTIHSGKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQITGIALSAA 1721

Query: 1770 AQLGVI--PFVSLNCQATNSFIRAMPSTVVLRNSVEKIKRQVEVLIPQFKSHEVKNSSAV 1827
            A   +I  P +  N Q  +  +R MP T V+   +++   +  ++   F++ ++   +  
Sbjct: 1722 AD-SIISHPSIVANFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKESFETDDLPKPTPT 1780

Query: 1828 --------TKKTPRIPIKFDIRFNFTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELV 1879
                    TK  P + +  D    F+++S +IM + PF   Q+ K++    S        
Sbjct: 1781 NDSPKPTPTKINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQ 1840

Query: 1880 LGFLEYDVYLKSQLSSEQFFKFSSTDLQFKCXXXXXXXXXXXXQISTSLMKLTLCEPRRA 1939
                + D+YL S L+ +Q+F+ S  ++                 +S S++KLT  EP R 
Sbjct: 1841 FNIWDSDLYLGSHLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSASIVKLTFSEPHRM 1900

Query: 1940 LHNLLQDEQTLVESVDHIQKLWNFLRSASGGNDRSPSRNTRWALDANLKYFGLLVPVSSI 1999
            L + LQDE+ +  SV  +Q L N   S    N         W L+A++KY G+L+PVS+ 
Sbjct: 1901 LFSFLQDEREVSRSVKKLQVLGNLFSSEPEINTIPAGAKIDWRLNADIKYLGILIPVSTT 1960

Query: 2000 CYIFELHSLFASLTNAN--EQYEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIR 2057
             ++FE+H+L ASL + +  E Y E D   SGQ+ V++   L+K+ ++P+ LS+++D S +
Sbjct: 1961 FFVFEMHTLLASLADVDYGEIYREADEA-SGQVSVDNILFLIKDRTIPSTLSRIIDLSFK 2019

Query: 2058 FLTSQKVPNSLQSYQIESSYFRLCLFPELLVDILWSVHYLQSLLNHFKKHHTP----WLP 2113
                QK+  S  SYQIES + R C  P  LV ILW  H L +L +H+++HH+     +LP
Sbjct: 2020 ISAIQKIMESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLP 2079

Query: 2114 ----YSSNKTAKSGESTLDFRSIHILSYNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKH 2169
                        S  STL F S HILSYNFCVGWLF+   +++ GLILGY+RLFSAYEK 
Sbjct: 2080 KKEKKVEEDKTTSFFSTLTFGSCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKG 2139

Query: 2170 FGKLTLIDGYLSVANGNTSDTFYSQKSEKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFH 2229
             GKLTL+D + SV+NG TSDTFYS  +E+D Y R++L N+QI YWLK    +KD+F+R H
Sbjct: 2140 CGKLTLVDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLH 2199

Query: 2230 GEVIDVRFLSTSFKLVEKTLHSIKRFNEMKKAKIKQTGSSTKSKLNM------------- 2276
            GE +DV FLS+  K++E TL SI+ F E+KK  +     S                    
Sbjct: 2200 GETLDVNFLSSFVKIIEATLQSIQVFQELKKVLVNPLTQSEARSEEEEEESEEHNRRETV 2259

Query: 2277 -------EAASNTLAPFLAHIRTINSQLNFAGGVFKVYSPTELDSKAEPLLEIKSPGVQM 2329
                   +A    +APFL+ IR +N Q  + GG+FKVYS  +++S  +P  EI+SPGV +
Sbjct: 2260 PGKEKKEDAPRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTI 2319

Query: 2330 AINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIKNMIRNLSSEDKSHPS 2389
             ++Y+ N    K H IR   T+  THN+LFA+CAPLL   + +I++M++  SS+ K  P 
Sbjct: 2320 DLDYKNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVKKHSSKKKPEPK 2379

Query: 2390 KPV---TDSIDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKVQLDAGFNSFLFRVTTDKV 2446
            + V   + +IDYK LLN +DI F+I S +QKLS SCEPKAKVQ + GF+SF+F + T+ +
Sbjct: 2380 QRVSRPSQNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDL 2439

Query: 2447 DSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVMMFTYPNV---YGVALVSDMN 2503
            D+ EP + +  +    S++RHIFSR+ SA+F LD ID+  MFT+PN+   +G  L+SD+ 
Sbjct: 2440 DTSEPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVE 2499

Query: 2504 IYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAKKXXXXXXXXXXXXXRKVFPW 2563
            +Y N+KQ QNL +FLDIW+LSN  R KP + K ED   A                 + PW
Sbjct: 2500 VYFNVKQLQNLYLFLDIWKLSNLLRPKPMK-KPEDHHVA----IDAPPSSPMDVGNIIPW 2554

Query: 2564 SFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRTWHTFAHGITVNSEGRLSG 2623
             FT+IF N+ G VDLGPSLG+L+L + + W  + H   +++  H +   I + ++GRLSG
Sbjct: 2555 CFTLIFANINGKVDLGPSLGLLSLSMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSG 2614

Query: 2624 MFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIKSAFDYHMFLIGSMKSVKVHLH 2683
            + ELD A   +E++WP+ D     PL+++S  I+ +S+K AFDYHMFLIG++ +   HLH
Sbjct: 2615 IVELDGALWAAEVNWPKYD--DPYPLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLH 2672

Query: 2684 NESDTYAILPDLLQVSLEFESIVLCXXXXXXXXXXDIYNTIMRMQQDNRISYIETLKESN 2743
            +E DT   +PDLL+V L  E I +C          D+YNTIMRM+QD  +SY+ETL+ESN
Sbjct: 2673 SERDTSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESN 2732

Query: 2744 ISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLFDAEVLVVSVRDVNARSETQ 2803
             + +  +V Y+++L  LNL++TD+ V +  L V ISP+SLFD EVLVV++ +V A  +T 
Sbjct: 2733 TTDTKETVDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTH 2792

Query: 2804 SGEKLKTELQLQISDVNAXXXXXXXXXXXXTVSKIAVDDYMLYASKFSGGTIIKLPQLLV 2863
            +GEKL+T L LQ+ + +              VSKI+V+DYM+YASK  GGTI  +P+L +
Sbjct: 2793 AGEKLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEI 2852

Query: 2864 SMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMWATHVRSLAVRRTQ--LGNS 2921
            SM T+Q+ +S +LEY +   F DKI+++WNLGPVNFIKEMW TH+++LAVRR+Q  +G +
Sbjct: 2853 SMHTFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSLVGTT 2912

Query: 2922 SPELEVANESDKEDTVKSKFIYVPLDEPYIEMPQIKDLGDATPPLEWFGVHRKNLPAATH 2981
              E     +  +++   SK  Y+ ++EP I+ PQIKDLGDATP LEWFG++RK  P  TH
Sbjct: 2913 GDEEGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTH 2972

Query: 2982 QTAVLLIQKLVHTAEKEYAKL 3002
            QT ++ +QKL+H+AEKEYA +
Sbjct: 2973 QTVIVPVQKLIHSAEKEYANI 2993

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087c
          Length = 2981

 Score = 2439 bits (6321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1274/3057 (41%), Positives = 1885/3057 (61%), Gaps = 143/3057 (4%)

Query: 7    FQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRCKVKINI 66
            F+  SL   RNFSWVFLVDW+LT I+TL  +FYL R F + +TFILEW++WK+ KVK++I
Sbjct: 10   FRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKVKVSI 69

Query: 67   ESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQXXXXXXXXXXXX 126
             +LRI+ L G + F+NL II +D TI+ LEG+I WRYWL  +RKS+Y+            
Sbjct: 70   GALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHASAGSS 129

Query: 127  GQEPKSNS---------GRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEK 177
            G                  K PCRFL  CEG E+F+YN+T +Y+NI+++ SK ER +FEK
Sbjct: 130  GNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVEREKFEK 189

Query: 178  FVDDQTMTELFNESEQENKVLSESTPSSVTMETVGXXXXXXXXXXXXXXXAGRNQNDGQA 237
            F+ +    +  ++   ++K+   S+ ++ T E                            
Sbjct: 190  FMAENDFLDPSSDGSSDDKIEETSSATNSTDE---------------------------- 221

Query: 238  PNNLENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDL 297
               + ND  F+         Y+  LPI+    + S+++GN+FTP +L++S +++  + D+
Sbjct: 222  -ETIANDRTFQNDTRKTLPRYLEALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDV 280

Query: 298  CPPKEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIF-LL 356
                 KLDL+++K E  L +++  +KQNI +D++ S +F++ +G+LS+LW +F RIF L+
Sbjct: 281  GEAPSKLDLYRMKYEVRLKNLEIMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLV 340

Query: 357  P-TLGPKHLQTQEDITFRENWKGLSLYRQNM--EEDELENVDFDFANHEYARVISILKSA 413
            P        + Q    F + WKGLS+YR +M  E DE ++++FD ++HEYA+  S+LKS 
Sbjct: 341  PFPFKSNRRKEQPHDNFMQKWKGLSMYRNDMFGEFDEFDDIEFDISSHEYAKFTSLLKSP 400

Query: 414  KIVFTYEYDIPGLVPK---EPEETLQGPEVGNSGAPPEFGVDIQLYGANICYGPWAERQL 470
            ++   ++YD+PG VP     P     GP+VGN+ APP++  +I ++G  +CYGPWA+RQ 
Sbjct: 401  RVTIHHDYDMPGWVPHGAHPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQT 460

Query: 471  SYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLRH 530
            ++L++LLSP VSRT KPIK L PGS+RIYT+ K +I+ ME+ TWRIPTRE SKD EFL H
Sbjct: 461  NHLQSLLSPSVSRTAKPIKKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMH 520

Query: 531  YVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELLL 590
            Y ET +++RPFGWID+K  +DS GI D  +CPT +G  N ++    + EIR+SVNH++ L
Sbjct: 521  YKETNDDYRPFGWIDIKVSRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFL 580

Query: 591  RAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPYE 650
            ++KSF F  D+GYPLGWN +ANW I + S QLE+F+LREH+TLI+D   DFSSG+P PYE
Sbjct: 581  KSKSFSFNCDIGYPLGWNAEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYE 640

Query: 651  LFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVAN 710
            LFRPF+Y I WN+ GYS YLNVNDHNIVNNPLDFNENCYLS+HGD L  +V +P++T+ +
Sbjct: 641  LFRPFVYHIKWNMKGYSFYLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITS 700

Query: 711  RCTEITYHISTPMFRXXXXXXXXXXXXEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVDT 770
            R T +TY I TPMFR            EFM+NKEVGRS++F++ G Y ++SELDIDNVDT
Sbjct: 701  RFTNMTYDIYTPMFRLLLNTPPWNTLNEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDT 760

Query: 771  ISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKN----ENL 826
            ++VECSS GT LH YGFV+RYL+NVKMNYFG+F HFVT+EEYT      + +N    +  
Sbjct: 761  LTVECSSRGTALHIYGFVIRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRR 820

Query: 827  GDEHSGFNISSTEDVETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGALI 886
             D+ S +   S     +   NP+ +  +      K+S+LKRT NE DIWF FSVW+GALI
Sbjct: 821  DDDFSSYESVSRISSNSSDKNPKAKKKHSL----KKSDLKRTSNETDIWFTFSVWDGALI 876

Query: 887  LPETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDN 946
            LPETIYN+DPCIALHF EL VDLRS NYYMD+LAT  +  LKRYV +   +++E V  +N
Sbjct: 877  LPETIYNADPCIALHFAELIVDLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNN 936

Query: 947  GRQEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSKI 1006
            G+  + HG LS + IHGHRMYGLPPTEPTYFCQW +D   L I+S++ F +G    F KI
Sbjct: 937  GKDHEVHGTLSDIYIHGHRMYGLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKI 996

Query: 1007 GFGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFEN 1066
            GFG+K+LENILLYET  + DMTS+T+ +  +   +ND DT++ + L  ++  FT IDFEN
Sbjct: 997  GFGYKDLENILLYETEIIDDMTSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFEN 1056

Query: 1067 EAYSQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREYI 1126
            E YS+R+D K P + F IF  ++N      LL+ K  +NFT+F+QNQ F  HR  QR+YI
Sbjct: 1057 ERYSKRMDIKIPSLEFNIFSNEDNDLS---LLNFKVDMNFTNFVQNQDFNKHRKIQRDYI 1113

Query: 1127 TLHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATXXXXXXXXXAETIDYIIEDCLGEY 1186
             L+D+ Y+RC+FLLP  +Q+S +Y EL G+I+PS++         A+TI+Y++ED L +Y
Sbjct: 1114 VLNDAPYHRCAFLLPESYQKSRIYNELFGAIAPSSSLPPLPIPLTADTIEYVLEDLLEDY 1173

Query: 1187 APTVKPD-DSSSSDTSEGQRTPLTNEDTRFQANSGFFSPHM-PHXXXXXXXXXXXXVLDV 1244
                + + D   S     + + +  E TR     G    H  P             V+ V
Sbjct: 1174 MGLFEGNYDIKESSVENLELSAI--EATRAITGIGAERTHSNPITLSDYAVESDNYVVKV 1231

Query: 1245 EYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVTTSRLHVK 1304
            E + +++ P++   +   LK  Y +D   IID  EI IVK+L ++  G + +T  ++ +K
Sbjct: 1232 ESIVIDINPALYTTIEKLLKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIK 1291

Query: 1305 DLHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISLLEAHPS 1364
              +  +  +E   V +  +  DF L  KT+E   EK +LE T+ + I  +R+++++  P 
Sbjct: 1292 HFNLFWGEKESDNVSMFFDKMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQ-QPG 1350

Query: 1365 SISM--KPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQIKVL 1422
             I    +P A+ + +E  E WS+ +++ VNS++V+S   T+D++Q+E    Y+  Q    
Sbjct: 1351 LIPTQERPPAITVGVEGFEFWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFF 1410

Query: 1423 RDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVRENRS 1482
             D + S   ++N R ++QK+LI  LT+ASEYYQISHDPYVITKPAFIMRLS GHVREN+S
Sbjct: 1411 LDMLQSYNRIQNNRIESQKELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKS 1470

Query: 1483 WRIITRLRHILTYLPNDWRTADHLVTVQDSENPNV-PQRD-EDIFVSVFSNWRNWDLSDI 1540
            W+IITRLRHILTYLP DW    +L   Q   +    P +D   IF+S+FSNWR+W+ SD+
Sbjct: 1471 WKIITRLRHILTYLPKDW----YLNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDV 1526

Query: 1541 TRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNIIVDVL 1600
             RSYIY K+FL  + +  K+ L+ + K+N  +FF TV  + Y+V  S + +   ++++ L
Sbjct: 1527 ARSYIYGKLFLNDHAEKKKQSLQKLFKLNIGNFFMTVYSTNYDVDHSIVVSNAKLLLE-L 1585

Query: 1601 PPSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLGSIS 1660
             PS     EN  ++E++I ++  +  IKG+   ++ KL++L    +E             
Sbjct: 1586 TPSSTEPKENSLQREELIDISGTVDVIKGKLSTKLLKLQKLIPILTE------------- 1632

Query: 1661 RSASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIINGK 1720
                    GS+   ++  + + P    +  K+ A  +   CD+  V+  T+L   + +G+
Sbjct: 1633 --------GSEKQPVKPPQDTIP----KPFKMNAAFMVNSCDIQLVMDATKLNMNVNDGR 1680

Query: 1721 NSMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQL-GVIPFVS 1779
             S+L EN +++T  A S V F++  E+ LKH  +VLAE  +   +   T       P   
Sbjct: 1681 ISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFYATFTTDTWAQRPTYL 1740

Query: 1780 LNCQATNSFIRAMPSTVVLRNSVEKIKRQVEVLIPQFKSHEVKNSSAVTKKTPRIPIKFD 1839
            ++ ++++   R M  T  L  +++ IK +++ +  Q +         + ++  + P  +D
Sbjct: 1741 IHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLE---------LERRLTQHPTVYD 1791

Query: 1840 IRFN-------FTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQ 1892
               +       F+++S +IM +SPF L    KQ+  + +  ++   ++   + D +L S 
Sbjct: 1792 PNKSNVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKDTDFFLTSD 1851

Query: 1893 LSSEQFFKFSSTDLQFKCXXXXXXXXXXXXQISTSLMKLTLCEPRRALHNLLQDEQTLVE 1952
             + EQ+ + S   LQ +              +ST+L+KLT  EP+  +++ L+DE+   E
Sbjct: 1852 QTKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIVYSFLKDERVASE 1911

Query: 1953 SVDHIQKLWNFLRSASGGNDRSPSRNTR-----WALDANLKYFGLLVPVSSICYIFELHS 2007
            SV  +Q L   L S S   + +P          W+LD+++ YFG+L+P++S  Y+ E HS
Sbjct: 1912 SVHLLQTL-KPLFSISDDKESTPQSYQEKTEYLWSLDSSIDYFGILIPMTSTYYVMEFHS 1970

Query: 2008 LFASLTNANEQYEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNS 2067
              +S++NAN      +   +G + VE+   L+KE SLP  LSKV+D ++   T Q+V ++
Sbjct: 1971 YVSSISNANGA-PSGNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVNVSTLQRVDDN 2029

Query: 2068 LQSYQIESSYFRLCLFPELLVDILWSVHYLQSLLNHFKKHHTP--WLPYSSN-------K 2118
             +S Q+ESS+ R+CL P+ L+ +LW  +    L  H+ K+H+   W  ++ +        
Sbjct: 2030 SRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDDKQQDTN 2089

Query: 2119 TAKSGESTL--DFRSIHILSYNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLI 2176
            + KS E++      SIH LSYN CVGWLFE       GLI GY RLFSAYE   GKLT+I
Sbjct: 2090 SIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCMGKLTVI 2149

Query: 2177 DGYLSVANGNTSDTFYSQKSEKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVR 2236
            D Y + A GNTS TFY + + K+ + R YL NMQI +W K    +KD++VRF GE +DV+
Sbjct: 2150 DSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGETLDVK 2209

Query: 2237 FLSTSFKLVEKTLHSIKRFNEMKKAKIKQTGSSTKSKLNMEAASNTLAPFLAHIRTINSQ 2296
            +LS     +E TLHSIK F ++KK  I +T       +  +   N+    L +I+++N  
Sbjct: 2210 YLSDFMLTIESTLHSIKMFQKLKKELIVETPKREVVHIKEDKPVNSSNNILKNIKSVNCH 2269

Query: 2297 LNFAGGVFKVYSPTELDSKAEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHN 2356
              + GG + V++ ++      P +EIKSP + + + Y+  +   K H IR    I+PTHN
Sbjct: 2270 FKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKHHSIRCLVNIDPTHN 2329

Query: 2357 MLFAKCAPLLSDFNHNIKNMIRNLSSEDKSHPSKPVT-DSIDYKSLLNPYDIAFEIASGK 2415
            +L+A CAPL+ +F  +++++     SE+K   + P +  +IDY+ LL  YD+A  + S K
Sbjct: 2330 VLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPTSVQNIDYEKLLEDYDLAITVTSAK 2389

Query: 2416 QKLSFSCEPKAKVQLDAGFNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSA 2475
            Q+LS SCEPKAKVQ D GF +    +TT+  D  EP   SFS+   ++S++H+FSR++S 
Sbjct: 2390 QQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKASIKHLFSRETST 2449

Query: 2476 AFMLDYIDIVMMFTYP---NVYGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPS 2532
            +F + Y+D+ ++FT+    N YG +L+SD+++Y N+KQ QNL +FLDIW+LS       S
Sbjct: 2450 SFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDIWQLSELLNPVTS 2509

Query: 2533 ENKAEDKSDAKKXXXXXXXXXXXXXRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQV 2592
              +   + D KK                 PW FT+IFTN+ G +DLGPSLG+++L L + 
Sbjct: 2510 SQEQVIRKDKKKSVDKPIHNESQ-----LPWCFTLIFTNVKGDIDLGPSLGLISLRLSRT 2564

Query: 2593 WITTKHQGDQKRTWHTFAHGITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISV 2652
            W+ T H   +++  H F   + + SEGRLSG+  +D AS VSE+ W ++      PL+++
Sbjct: 2565 WLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKRDNIPLVAL 2624

Query: 2653 SMAINRMSIKSAFDYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCXXXX 2712
            S+  +++ IK+AFDYHMFLIG++ ++   LH+E D   + PDLL+VS   E I LC    
Sbjct: 2625 SLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEEIKLCSTAL 2684

Query: 2713 XXXXXXDIYNTIMRMQQDNRISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVK 2772
                  DIYNTI+RM+QD +ISYIETLK+SN+  +  ++AY ++L SL LLRTD++V + 
Sbjct: 2685 VAANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSLQLLRTDLTVSIC 2744

Query: 2773 ELKVHISPMSLFDAEVLVVSVRDVNARSETQSGEKLKTELQLQISDVNAXXXXXXXXXXX 2832
             L++ ISP+SLFD EV+V++V  V+ARSET S  KL T L +++ D              
Sbjct: 2745 SLQLQISPISLFDVEVVVINVVSVSARSETHSEAKLTTSLNMEVYDATLSLSTAKQELDE 2804

Query: 2833 XTVSKIAVDDYMLYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKW 2892
              +SKI V DYM YASK  GGTII++P++ V MTTWQ++ S +LEYL++CKF DK++++W
Sbjct: 2805 DALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFHDKVAVRW 2864

Query: 2893 NLGPVNFIKEMWATHVRSLAVRRTQLGNSS---PELEVANESDKEDTVKSKFIYVPLDEP 2949
            NLGPVNF+KEMW THV+++AVRR+Q+   S    E +V     +E+ + +K  YVP++EP
Sbjct: 2865 NLGPVNFMKEMWTTHVKAIAVRRSQVLTGSFNVSEKDVEKRIKEEENI-TKLNYVPVEEP 2923

Query: 2950 YIEMPQIKDLGDATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKLQQRA 3006
             I+MPQIKDLGDATPP+EWFGV+RK  PA THQTAV+ +Q LV+ A+K+YAK   R+
Sbjct: 2924 QIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTLGRS 2980

>Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..19356)
            [8988 nt, 2996 aa]
          Length = 2995

 Score = 2356 bits (6105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1238/3066 (40%), Positives = 1852/3066 (60%), Gaps = 139/3066 (4%)

Query: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60
            M+  S F  +SL R + FSWVFL  WVLTCI +LTVIFYL R+FG + TFIL W +WK+ 
Sbjct: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60

Query: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQXXXXXX 120
            KVKINIES+R++ LGG +  +N+ II++D+T+S LE  I WRYWL NSR+ +Y+      
Sbjct: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120

Query: 121  XXXXXXGQEPKSNSGRKH---PCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEK 177
                       S +  K+   PC  L+ C+G E+FVYN+ ++YEN++ +F+KEER +F  
Sbjct: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180

Query: 178  FVDDQTMTELFNESEQENKVLSESTPSSVTMETVGXXXXXXXXXXXXXXXAGRNQNDGQA 237
            F+++  + ++ +E    N  + +    SVT E                           +
Sbjct: 181  FLNEHDLGDIVSEDTNVNS-MDKDYFESVTTE-------------------------NSS 214

Query: 238  PNNLENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDL 297
             + + ND  +++    RKS+   FLPIQ+     ++ LGNRFTPS++V S +N  G++D+
Sbjct: 215  ESTVINDRTYKKNKDERKSILFNFLPIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDV 274

Query: 298  CPPKEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIF-LL 356
                EK+DL+K K+  +  DV+ SVK N+ +D + +      +G+LS++W  F  I  ++
Sbjct: 275  SHANEKIDLYKSKVTMKFQDVNISVKPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMI 334

Query: 357  PT----LGPKHLQTQE---DITFRENWKGLSLYRQNMEEDE---LENVDFDFANHEYARV 406
            P     +  KH++ +E   +  F   W+GLSLY+ N+ +     L+   +DF N EYA+ 
Sbjct: 335  PNPFTKIYHKHMKKKEHDVESMFVNKWRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKF 394

Query: 407  ISILKSAKIVFTYEYDIPGLVPKEPEET---LQGPEVGNSGAPPEFGVDIQLYGANICYG 463
             SILK      +Y  D PG+VP    +T     GP++GNSG+PPEF VD+Q+  A+I YG
Sbjct: 395  SSILKCPNFTLSYYLDSPGIVPHGAHQTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYG 454

Query: 464  PWAERQLSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSK 523
            PW  RQ+SYL  +LSPVVS+   PIK L PGS+RI+T+FK S+ I++ES+WRIPTRE SK
Sbjct: 455  PWTNRQVSYLIRMLSPVVSKNQIPIKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSK 514

Query: 524  DQEFLRHYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTS 583
            D+EF++ +V+T ++FRPFGW+D    K +    +  + PT +G  NN + HF +ME+ TS
Sbjct: 515  DKEFIKQFVKTNDDFRPFGWLDFNLNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTS 574

Query: 584  VNHELLLRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSS 643
            VNH++LL++K FD  AD+GYPLGWN QA+W  ++ + QLE F+L+EHI+L SD+F+DF+S
Sbjct: 575  VNHDILLKSKEFDVVADIGYPLGWNSQADWKFDIIAKQLETFLLKEHISLFSDMFSDFAS 634

Query: 644  GDPTPYELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKI 703
             DPTPYELFRPF Y +NW+++GYSIYLNVND NIVNNPLDFNENCYLSLHGD L  D  I
Sbjct: 635  EDPTPYELFRPFTYSLNWDIEGYSIYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLI 694

Query: 704  PRQTVANRCTEITYHISTPMFRXXXXXXXXXXXXEFMKNKEVGRSYNFQVNGLYTVFSEL 763
            P   ++   TEI ++I TPMFR            EFMK+KEVGR+++F + G Y ++S+L
Sbjct: 695  PNLLISQPYTEIAFNIYTPMFRLLLNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDL 754

Query: 764  DIDNVDTISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKN 823
            DIDNVDTI++EC+S  TTL CYG V+RYLMNV+ NYFGDF HF+T+EEY+      +  N
Sbjct: 755  DIDNVDTITMECTSRSTTLFCYGVVIRYLMNVQANYFGDFVHFITSEEYS---EILQKNN 811

Query: 824  ENLGDEHSGFNISSTEDVE---TDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSV 880
            +   DE   F  S+T  V+   +D T    +  +   P  +R+++ RTENE+DIWF F V
Sbjct: 812  KRSNDEQGSFTYSTTSSVQNSSSDDTVLYTKEQDLSKPHVRRADVLRTENELDIWFTFRV 871

Query: 881  WEGALILPETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFE 940
            W+GALILPE +YN + C +L F+EL +  R +NYYMD L  + + ++ R+++  P ++F 
Sbjct: 872  WDGALILPEGLYNGNLCSSLLFSELMISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFR 931

Query: 941  CVRKDNGRQEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFL 1000
             VR  +      HG LS +TIH HRM+GLPP + TYFCQW +D   L I+S++EF   F 
Sbjct: 932  YVRDPDHNLNIVHGTLSDVTIHAHRMFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFF 991

Query: 1001 TCFSKIGFGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFT 1060
              F+K+GFG+ NLEN L+Y+  +  DMT +T+  +++  +++D  +  ++ L   K+   
Sbjct: 992  GLFTKLGFGYSNLENKLVYKVESSDDMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLN 1051

Query: 1061 AIDFENEAYSQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRY 1120
            +IDF+NE YS+R++ K P+ +  IF++  N      LL  KT+++FT+F+  + F +   
Sbjct: 1052 SIDFQNERYSKRINLKIPEFSISIFDV-RNPTIKPILLGFKTKIDFTNFVIKEDFRNSLN 1110

Query: 1121 RQREYITLHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATXXXXXXXXXAETIDYIIE 1180
             QR YITLHDS Y+RC F+LP  +QES LY EL G I+PS +           TID+++E
Sbjct: 1111 GQRTYITLHDSPYHRCFFILPTMYQESFLYNELYGGITPSFSIPILPIPMLPNTIDFLVE 1170

Query: 1181 DCLGEYAPTVKPDDSSSSDTSEGQRTPLTNE---DTRFQANSGFFSPHMPHXXXXXXXXX 1237
            D L EY+  ++    +    +    + L NE   DT     + F +              
Sbjct: 1171 DFLKEYSDLLENPFLNIRSINNLDTSSLFNEYRVDTYISEKAIFKAEEKNTVNYDPKYEY 1230

Query: 1238 XXXVLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVT 1297
               +L+VEY+ +++ P  +  + +   K Y+E+  DIID+ E+ IV++LG+ +      T
Sbjct: 1231 DNYILNVEYIRVDINPLFSDFIDSMSTKLYSENMVDIIDEIEMIIVRRLGSPKKVLLRET 1290

Query: 1298 TSRLHVKDLHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRIS 1357
              +L +  +   +      G+E+ L+  DF++R++  ++ +++ + E+T+ S + +LR S
Sbjct: 1291 NLKLKISYVDIFWGSRNSEGIEIYLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCS 1350

Query: 1358 LLEAHPSSISM-KPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLF 1416
              E     I   +P AL L++E LE+WS T     NS+N+ S   T+D SQ   +  YL 
Sbjct: 1351 FSETQYEEIEYERPPALSLTVEGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLN 1410

Query: 1417 GQIKVLRDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGH 1476
             Q++   +   S   L+      QK LI  LT+ASEYYQI HDPYVITKPA IMRLS  H
Sbjct: 1411 KQVEFFYNLKGSVDLLQKRDVTLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSH 1470

Query: 1477 VRENRSWRIITRLRHILTYLPNDWRT-------ADHLVTVQDSENPNVPQRDEDIFVSVF 1529
            VRENRSWRI+TRLRHIL YLP  W         A H+ +  D +N         +F+SVF
Sbjct: 1471 VRENRSWRIVTRLRHILNYLPEGWEKSSIAFVEARHVYSDSDPKN---------VFLSVF 1521

Query: 1530 SNWRNWDLSDITRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTI 1589
            SNWRNW++SD+ RSYIY+++FLP  E   K  +    KI  +SF+FT+    Y V  + +
Sbjct: 1522 SNWRNWEVSDVARSYIYRRVFLPDIE---KNLINNTTKIGMESFYFTIYSQRYAVDHNIV 1578

Query: 1590 FTRTNIIVDVLPPSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENE 1649
             TR N+I+D +       +    K +K+  +T  +G  KGE G+++ +LK+L+S+     
Sbjct: 1579 VTRINVIIDQMLSDEEPKAATANKNDKIYDITGTVGTFKGELGDQLIRLKKLYSE----- 1633

Query: 1650 LDDLSNLGSISRSASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGD 1709
             D        S   SI  F                      KI   +I E+ +L     +
Sbjct: 1634 -DKAKIRSEKSTDFSIPKF---------------------FKINIVLIVEKGELTLAAAN 1671

Query: 1710 TRLTNRIINGKNSMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAAT 1769
            T+L +RI NGK S   EN+++    + S V++A R E+WLKH+  +L +  L  L ++  
Sbjct: 1672 TKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHLDDLFISVI 1731

Query: 1770 AQLGVI-PFVSLNCQATNSFIRAMPSTVVLRNSVEKIKRQVEVLIPQFKSHEVKNSSAVT 1828
            A+L V  P + +N ++++   +A+P+T  L   + + +R++  +  +    + K     T
Sbjct: 1732 AELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDKDNKKRHTST 1791

Query: 1829 K---KTPRIPIKFDIRFNFTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEY 1885
                 T +I I FDI  N  D+SSEI++LSPF +   +K+L I  +   + + +   L+ 
Sbjct: 1792 SPIFSTKKIDISFDI--NIFDISSEIVILSPFTVKHSMKELKIVFNREGDNDTIFSILDA 1849

Query: 1886 DVYLKSQLSSEQFFKFSSTDLQFKCXXXXXXXXXXXXQISTSLMKLTLCEPRRALHNLLQ 1945
            D+YL S  +  Q+F+ S  D+  +              I TSL+KLTL +P++  ++LLQ
Sbjct: 1850 DLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLTLADPKKITNSLLQ 1909

Query: 1946 DEQTLVESVDHIQKLWNFLRSASGGNDRSPSRNTRWALDANLKYFGLLVPVSSICYIFEL 2005
            DE+T  +S++ I+ L     S       +     ++ ++ +L YFGLL PV +  +I EL
Sbjct: 1910 DEKTFEQSLESIKTLNTLFSSNREVRTSAVDNPYKFMVNFDLTYFGLLFPVDTSYFILEL 1969

Query: 2006 HSLFASLTNANEQYEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVP 2065
            HSL A+ +N     ++     +  + +++   ++K   +   +SKVLDFS+   T  K+ 
Sbjct: 1970 HSLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSKVLDFSVNLSTETKIL 2029

Query: 2066 NSLQSYQIESSYFRLCLFPELLVDILWSVHYLQSLLNHFKKHHTPWLPYSSNKTAKSGES 2125
            NS +S+++ESS+FR+CL PE L+ IL  V    S   ++K+H    +  +  K +   E+
Sbjct: 2030 NSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQIFKTKKKASVVSEN 2089

Query: 2126 TLDF----RSIHILSYNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLS 2181
             +       SIH LSYNFC+GW+FE   +S PGLI+GYDRLFSAYE  +GKLT++DG+ S
Sbjct: 2090 LIGAPLIEYSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGKLTVVDGFFS 2149

Query: 2182 VANGNTSDTFYSQKSEKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTS 2241
            +ANG +SDTFYSQ +EK+ Y R+YL N+QI YWLK  + +K LFVRF+GE IDVRFLS  
Sbjct: 2150 IANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYGETIDVRFLSNF 2209

Query: 2242 FKLVEKTLHSIKRFNEMKKAKIKQTGSSTKSKLNMEAASNTLAPFLAHIRTINSQLNFAG 2301
              ++  T+ S++ F  +KK  +++     + K+  +  S   + F + ++ IN Q  + G
Sbjct: 2210 ATIINLTIESVQHFQMIKKETVREMNVEAEKKVGEDDISTKFSLFFSKVQRINCQCIYDG 2269

Query: 2302 GVFKVYSPTELDSKAEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAK 2361
            GVF VY         E  +EI +P V + ++Y++    +K H IR F  IEPT+N L ++
Sbjct: 2270 GVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKKPHWIRSFINIEPTYNTLLSQ 2329

Query: 2362 CAPLLSDFNHNIKNMIRNLSSEDKSHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFS 2421
             A  L++F  ++  M+   S +++    K V+  IDYK +L  +D++F I++GKQK+S S
Sbjct: 2330 FASFLTEFGESVHEMVAKFSPKEQPPAPKTVSPPIDYKRILEDFDVSFSISAGKQKVSLS 2389

Query: 2422 CEPKAKVQLDAGFNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDY 2481
            CEP AKV  + GF SF+F + T+  D  EP + S +++ I++S+ H FS + +A+F +D+
Sbjct: 2390 CEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKTSINHEFSTEPTASFSVDF 2449

Query: 2482 IDIVMMFTYPNVYGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSD 2541
            +DI  +FT+P++YG  L+SD+++Y N+KQ QNL +FLDIW L    + +P ++    K +
Sbjct: 2450 VDITTLFTHPDIYGTTLISDVSLYFNIKQLQNLMVFLDIWNLKRLIKLRPQKSVPVKKPE 2509

Query: 2542 AKKXXXXXXXXXXXXXRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGD 2601
            ++                + PWSFT+I T++ G + LGPSLG L+L L++ WI+T H  D
Sbjct: 2510 SRV----SSSTKSSSNTTIIPWSFTVIITDINGDIHLGPSLGNLSLKLKKNWISTNHFQD 2565

Query: 2602 QKRTWHTFAHGITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSI 2661
            +++    F   +++ S GRL G+ ++   S +  + + E + L   PL+ +++ +  +++
Sbjct: 2566 RRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYVENEKLDQSPLVDITLNVENVAV 2625

Query: 2662 KSAFDYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCXXXXXXXXXXDIY 2721
            K+AFDYHMFLIG + ++  +L +E D    LPDLL++ L  + I +C          DI 
Sbjct: 2626 KAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCDEIDICSTALVASNILDIS 2685

Query: 2722 NTIMRMQQDNRISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPM 2781
            NTI R +QD+R SYIETL ESN     +S++Y ++L SLNLLRTD+ + + +++V ISP+
Sbjct: 2686 NTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSLNLLRTDVGIEIHKMQVQISPI 2745

Query: 2782 SLFDAEVLVVSVRDVNARSETQSGEKLKTELQLQISDVNAXXXXXXXXXXXXTVSKIAVD 2841
            SLFD EV+V +V +V+ARS TQSGEKL T+LQ++I                  VS+I+VD
Sbjct: 2746 SLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSLSKSNEELDEEAVSEISVD 2805

Query: 2842 DYMLYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIK 2901
            DYM+YA K SGG I+ +P+L V MTTWQ ++S ++EYLF CKF DKIS++WNLGPVNFIK
Sbjct: 2806 DYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDKISVRWNLGPVNFIK 2865

Query: 2902 EMWATHVRSLAVRRTQL-------------GNSSP-----ELEV-------ANESDKEDT 2936
            E+WATHV+SLAVRR QL             G  SP     ELE+       A+  + E +
Sbjct: 2866 EVWATHVKSLAVRRAQLKGDKEPQLVPGIIGEPSPLVSSEELEMLRSESSNADNDNNEYS 2925

Query: 2937 VKSKFIYVPLDEPYIEMPQIKDLGDATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAE 2996
             + KFIYVPL EP IEMP+IKDL DATPPLEWFGV+RK  P  THQTA++LIQK+VH A+
Sbjct: 2926 EEDKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVTHQTAIILIQKIVHVAQ 2985

Query: 2997 KEYAKL 3002
            KEYAK+
Sbjct: 2986 KEYAKV 2991

>SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2997

 Score = 2066 bits (5353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1180/3095 (38%), Positives = 1755/3095 (56%), Gaps = 195/3095 (6%)

Query: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60
            MD  S F+ + + +  NFSWVFLVDWVL  +++L+V+FY GR   + +T +++WV+W+R 
Sbjct: 1    MDAGSQFKAIPISKENNFSWVFLVDWVLVVVLSLSVVFYFGRALAYCITILMKWVLWRRY 60

Query: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQXXXXXX 120
            KVKINI+SL+I+ LGG + F+NL +I +D TIS L+G+  WRYWL NSRK+  +      
Sbjct: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRKTLLEELEK-- 118

Query: 121  XXXXXXGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVD 180
                    E K    R   CRF L  +G E+F+YN+T +Y+ I+   +K+++  F+KF +
Sbjct: 119  ------SGEEKDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAKDDKESFKKFFE 172

Query: 181  DQTMTELFNESEQENKVLSESTPSSVTMETVGXXXXXXXXXXXXXXXAGRNQNDGQAPNN 240
                +   +E + E++ L+  +  S    T                              
Sbjct: 173  GGEDSLHSSEEKLEDETLASDSSVSNVDST------------------------------ 202

Query: 241  LENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPP 300
              ND  F++Q S  +SM ++FLPI +   R +++LGN  TPS++++  ++++G++D+C  
Sbjct: 203  --NDRNFQEQDS--RSMLLQFLPIHLKVNRGAVLLGNTTTPSVMIIGYESAEGVVDVCQS 258

Query: 301  KEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFL----- 355
             EKLDL+KI+ + +  +VD  +K NI F D+          R+S++W+KF +IF      
Sbjct: 259  NEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPIKSYIVHSRMSRVWKKFKKIFFERMSH 318

Query: 356  -LPTLGPKHLQTQEDITFRENWKGLSLYRQ-NMEEDE----------LENVDFDFANHEY 403
             L     + +   +   F E W+GL+LY + N+   +           EN+  D  NHEY
Sbjct: 319  YLAHSDNQKIMFVKHQQFFEKWRGLALYSEYNVTTSDHSVGDEEEEEDENMMSDVGNHEY 378

Query: 404  ARVISILKSAKIVFTYEYDIPGLVPKEPEETLQ---GPEVGNSGAPPEFGVDIQLYGANI 460
            A+   ILKS K+  TY YDIPG+VP     T++   GP+VGNSGAPPEF +D +LYGA I
Sbjct: 379  AKYTQILKSTKVAVTYAYDIPGMVPHGALHTMEQRDGPDVGNSGAPPEFSLDFKLYGATI 438

Query: 461  CYGPWAERQLSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTRE 520
            CYGPWA RQ+ YL+ +L P+VSR   P+K LTPGS+RIYT F  S+ +ME++ WRIPTRE
Sbjct: 439  CYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPGSRRIYTRFNLSVLMMEDALWRIPTRE 498

Query: 521  KSKDQEFLRHYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEI 580
             SKDQ+FL+ Y E+K + RPFGW+D+K  K++   +   +CPT  G  N + FH    EI
Sbjct: 499  SSKDQDFLKQYRESKNKERPFGWLDIKLTKETDLFMTVGMCPTITGFENKLGFHLVKPEI 558

Query: 581  RTSVNHELLLRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFAD 640
            R+SVNH++  +A +    AD+GYPLGWN +A W    +S Q+  F LR+HI L+SD+F D
Sbjct: 559  RSSVNHDIFFKADAQTISADLGYPLGWNSEAQWVFQFNSKQVHTFFLRDHINLLSDIFMD 618

Query: 641  FSSGDPTPYELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFD 700
            F SG PTPYELFRPF+YR  W++D YSIYLNVND NI+NNPLDFNENCYLSLHGD L  D
Sbjct: 619  FGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVNDANIINNPLDFNENCYLSLHGDTLKID 678

Query: 701  VKIPRQTVANRCTEITYHISTPMFRXXXXXXXXXXXXEFMKNKEVGRSYNFQVNGLYTVF 760
              +  +T+    T + Y I TP F             EFMKNKEVGRSY+F +NG Y   
Sbjct: 679  FSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWSTLHEFMKNKEVGRSYDFCMNGSYQFH 738

Query: 761  SELDIDNVDTISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTN------ 814
            S++D+ N+DTI +EC S  TTL C GFV+RYLMN+ MNYFGDF HF T EEYT       
Sbjct: 739  SDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMNINMNYFGDFIHFKTTEEYTRELQEKL 798

Query: 815  ANHTEEPKNENLGDEHSGFNISSTEDVETDRTNPEG--RPANKGIPMPKRSELKRTENEM 872
                 E   +N+ DE S   +SST  V  D+   E      N+  P  KR++LKR ENE 
Sbjct: 799  ETREAEVIADNVSDESS--QMSSTSFVTNDKETTEYDLHEFNED-PKVKRADLKRKENEK 855

Query: 873  DIWFVFSVWEGALILPETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVS 932
            D+WF F V +G L+ PE IY+   CI LHF+ L+VDLR  NYYMDL A+++ T +KR+  
Sbjct: 856  DVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDVDLRYLNYYMDLQASLSPTYIKRHSD 915

Query: 933  RHPHDLFECVRKDNGRQEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSD 992
             +P ++F+ VR   G  +   G+LS L IH HRM+GLP  E TYFC+W   I  L+I+SD
Sbjct: 916  FNPRNIFDVVRACEGLVDGHQGFLSELNIHAHRMFGLPIIEETYFCKWDFQIGSLDIDSD 975

Query: 993  LEFAKGFLTCFSKIGFGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVL 1052
            ++FAKG +  FSKIGFG+K+ EN+L+YE     DMTS+T+    + F + D +T+    L
Sbjct: 976  IDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDMTSLTLVTDSISFKVTDGNTNCVVAL 1035

Query: 1053 HAKKITFTAIDFENEAYSQRVDFKFPDINFLIFEL-DENQKEGRFLLHLKTQLNFTDFIQ 1111
               KI+ + IDFENE YS ++  K P+I  L+ E   +N+ +G F    +T L+   F Q
Sbjct: 1036 DLDKISASMIDFENERYSNKMSAKIPNIKLLVSEKSSKNEVQGLF----ETSLDLAYFGQ 1091

Query: 1112 NQAFADHRYRQREYITLHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATXXXXXXXXX 1171
            N+ F +HR  QR +ITLHDS Y+RC+FLLP  +Q++VLY +L G+I+P  +         
Sbjct: 1092 NRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQYQKTVLYNKLFGAITPGVSIPPLTQPVI 1151

Query: 1172 AETIDYIIEDCLGEYAPTVKPDDSSSSDTSEGQRTPLTNEDTRFQANSG---------FF 1222
              TID I E  LG++      D    SD +  + T +T E++ F   SG          +
Sbjct: 1152 PNTIDSIFESLLGKHY----QDYECCSDANYSKETAITEENSSFIQGSGSTSALKELSSY 1207

Query: 1223 SPHMPHXXXXXXXXXXXXVLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAI 1282
            S + P             ++++    + + PS    LL+   +F      DIID NEI I
Sbjct: 1208 SQNCPSYKLEPKFEYDSFIINLGKTIIAINPSSEKCLLSIYLQFCVGSIDDIIDANEIDI 1267

Query: 1283 VKKLGNLQYGASFVTTSRLHVKDLHFLYDFEEGS-------GVELALNSFDFDLRRKTIE 1335
            V+K        S VT  R+    + F +   +G         + + +N    DL +K I 
Sbjct: 1268 VEKFSKYFVEKSAVTNLRVLAPKICFTFGSPKGKFEVSDYDHLYVEVNHPSLDLCQKKIF 1327

Query: 1336 NEDEKVILEKT--MFSNIHTLRISLL----EAHPSSISMKPAALQLSIEDLELWSSTVDE 1389
             +     LE T  + S++    I+      +  P ++        +  E+LE WS + + 
Sbjct: 1328 GQTNSSKLEYTEEVTSSLKASSINFFINQQQLKPKTLLKARPVFSIVFEELEFWSDSSES 1387

Query: 1390 NVNSVNVTSFGFTLDESQLERISGYLFGQIKVLRDTITSAKELENLRKKTQKDLICDLTS 1449
            + NS+N  +  F ++ SQLE +S YL   I        S  + + L +  QK+LI     
Sbjct: 1388 SKNSLNARAVDFFVNHSQLEWLSDYLRAVILCATKLFASFSKSKTLIQARQKELIFRTAL 1447

Query: 1450 ASEYYQISHDPYVITKPAFIMRLSEGHVRENRSWRIITRLRHILTYLPNDW--RTADHLV 1507
            AS  Y I HD  VITKPA+I RLS+ H+RENRSWRIITRLRHIL YLP  W  RT + L 
Sbjct: 1448 ASVEYNIIHDSPVITKPAYITRLSKNHIRENRSWRIITRLRHILNYLPKSWYKRTEESL- 1506

Query: 1508 TVQDSENPNVPQRDEDIFVSVFSNWRNWDLSDITRSYIYKKIFLPQNEDSFKKELRTV-- 1565
                 E   +P    D F+ +FSNWR+W+ SD+ + YIYK++FL +   S KK   T   
Sbjct: 1507 ---KKEEFKIPDDARDQFLKIFSNWRSWEFSDVQKCYIYKRVFLSR---SMKKNRITGAD 1560

Query: 1566 LKINFQSFFFTVLISGYE------VARSTIFTRTNIIVDVLPPSVNTSSENLFKQEKVIT 1619
             K+N +   F++  S +E      V          +I   LPPS   ++E+    EK+I 
Sbjct: 1561 FKVNLERISFSLSSSTHEDEDFMVVKNLKSVISNELIESSLPPSAK-NTEDSASTEKMI- 1618

Query: 1620 LTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLGSISRSASISGFGSQMDRLESSR 1679
            ++ N+ +I+G+ G+ + KL  ++        D LSNL   +                  +
Sbjct: 1619 ISCNIKSIRGDLGDNIVKLVRMY--------DGLSNLSDTNL-----------------K 1653

Query: 1680 ASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIINGKNSMLLEN--SKENTPPALS 1737
             +      +   I   ++ +R D +  +   RL  R    + S  +E   SK  T  +L+
Sbjct: 1654 TTSVKHDVKPKLIQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSETKVSLA 1713

Query: 1738 AVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQL---GVIPFVSLNCQATNSFIRAMPS 1794
            A       E W++H + VL E  LK   +  +  L    +I  V L     +  + AM S
Sbjct: 1714 AT--CASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRSGGLS--VSAMAS 1769

Query: 1795 TV-------VLRNSVEKIKRQVEVLIPQFKSHEVKNSSAVTKKTPRIPIKFD---IRFNF 1844
            T         ++ SV+ I++++   IP+      KN++ ++   P    + +   +    
Sbjct: 1770 TEQYIHFIWSIKASVDGIRKELASAIPK------KNNTTISTTKPETSSRLNTVTLDATL 1823

Query: 1845 TDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSEQFFKFSST 1904
            +  S  I  L+PF + Q    + ++   H  +   +   + D+ L S  S +++ KFS +
Sbjct: 1824 SGFSLNIQPLTPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQS 1883

Query: 1905 DLQFKCXXX-XXXXXXXXXQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHIQKLWNF 1963
             +                  +++ + KLT+ +PR  +++L++DE   +++   ++ L   
Sbjct: 1884 TVNLVISNTPEQNAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAE- 1942

Query: 1964 LRSASGGNDRSPSR---NTRWALDANLKYFGLLVPVSSICYIFELHSLFASLTN--ANEQ 2018
             +  S   ++S  R   N  W L  N++Y G++V + S  Y+ EL+++  SL+N  +  +
Sbjct: 1943 -KFPSKNQEKSKQRKQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARK 2001

Query: 2019 YEEYDRH-FSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIESSY 2077
            Y E   H   G   +E+  LL+    L   LSK++D ++    SQ+  + LQ+ QIESS+
Sbjct: 2002 YLEQGLHGIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSH 2061

Query: 2078 FRLCLFPELLVDILWSVHYLQSLLNHFKKHHTPWLPYSSNKTAKSGESTLDFRSIHILSY 2137
            FR+ L P  L  +LW+++    +   +K   +  L +         E +  FRSI ILSY
Sbjct: 2062 FRVALCPMSLTKVLWAINEFTRVSEAYKT-RSSLLQHKKTAPTDISELSNKFRSIQILSY 2120

Query: 2138 NFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDTFYSQKSE 2197
            NFC+GW+F+ G  ++PGLI GY+RLF+AY+K +GKLTL+D Y S+A+G +SDTF+S   E
Sbjct: 2121 NFCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFFSNGKE 2180

Query: 2198 KDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKRFNE 2257
            KD + R+YL +MQI YW   E    +LFVR  GE +DV FLS+S  +    + SI+ F E
Sbjct: 2181 KDQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTFQE 2240

Query: 2258 MKKAKIK--QTGSSTKSKLNMEAASNTLAPFLAHIRTINSQLNFAGGVFKVYSPTELDSK 2315
            +KK  +    T  +T+  +N EAA   L P L+ IR  N  + +AGGVFK++S  ++ + 
Sbjct: 2241 LKKTMVDPFATNKTTEKPVNSEAAP--LDPILSKIRAFNCIVKYAGGVFKLFSEEDIQNN 2298

Query: 2316 AEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIKN 2375
            ++P  E++SP V++AI+Y+      KSH IR   T++P++N LF  C P+LS    +++N
Sbjct: 2299 SKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRN 2358

Query: 2376 MIRNLSSEDKSHPSKPVTDS-IDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKVQLDAGF 2434
            M+++ +S+ K   +  ++ S ++YK LL  +DIAF +  GKQ +S SCEPKAKVQ D GF
Sbjct: 2359 MLKSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQADVGF 2418

Query: 2435 NSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVMMFTYPNV- 2493
                 ++ T+ +D+ EP ++S  ++ + ++ RHIFSR+ S +F +D+ID V + T+P + 
Sbjct: 2419 EKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLTHPEII 2478

Query: 2494 --YGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAKKXXXXXXX 2551
              YG  LVSD+ IY NMKQ Q+LN+FLDIW+  ++    P       +S +         
Sbjct: 2479 QTYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMPKGGNTRTRSLSSHDKLPVSK 2538

Query: 2552 XXXXXXRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRTWHTFAH 2611
                     FPW++T+IF+N+ G +DLGPSLGVL++   + W  + H  D ++    F  
Sbjct: 2539 FQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRLSVFLE 2598

Query: 2612 GITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIKSAFDYHMFL 2671
             I ++S+GRL G   +++    SEISWP +      PLIS+S+ +  +++K++FDYHMFL
Sbjct: 2599 NILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSFDYHMFL 2658

Query: 2672 IGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCXXXXXXXXXXDIYNTIMRMQQDN 2731
            I +++ + + L+NE D   IL DLL VS+    I L           DIYNTI+RM+QDN
Sbjct: 2659 IANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTIIRMRQDN 2718

Query: 2732 RISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLFDAEVLVV 2791
            + SYIETLK+SN  ++ +    + VL SL+LLRTD+SV +    + + P +LFD EVLV+
Sbjct: 2719 KNSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDMEVLVL 2778

Query: 2792 SVRDVNARSETQSGEKLKTELQLQISDVNAXXXXXXXXXXXXTVSKIAVDDYMLYASKFS 2851
               D++A ++TQ   K+KT L  Q+ +                VS+I V +Y+ +A+K  
Sbjct: 2779 KAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKHATKVR 2838

Query: 2852 GGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMWATHVRSL 2911
            GGTI+  P +LV MTTWQ+ SS V+E L+T  F  K+ +KWNLGP+NFI+EMWATHVR+L
Sbjct: 2839 GGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWATHVRAL 2898

Query: 2912 AVRRTQ----LGNSSPELEVANESDKEDTVKSKFIYVPLDEPYIEMPQIKDLGDATPPLE 2967
            A+RR         S  E E   E  K+  + +K++Y+PL+EP IEMPQIKDLGDATPP+E
Sbjct: 2899 ALRRVHDMRDKNKSFFEDEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKDLGDATPPVE 2958

Query: 2968 WFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKL 3002
            WFGV+R+  P  THQ+ V+ +QKL H AE+EYA++
Sbjct: 2959 WFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARV 2993

>TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3148

 Score = 2063 bits (5346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1084/2601 (41%), Positives = 1604/2601 (61%), Gaps = 88/2601 (3%)

Query: 442  NSGAPPEFGVDIQLYGANICYGPWAERQLSYLRALLSPVVSRTPKPIKTLTPGSQRIYTI 501
            N  APPE  ++ QL+ A+I YGPWA R +  ++ + SP+VSRTP+      PG  R YT+
Sbjct: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649

Query: 502  FKTSISIMEESTWRIPTREKSKDQEFLRHYVETKEEFRPFGWIDLKFMKDSYGILDTVIC 561
             K S+SIME+S+WR+PTRE SKDQ+FL+ Y++T +  R FGW DL F ++S         
Sbjct: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709

Query: 562  PTEEGSPNNVNFHFSNMEIRTSVNHELLLRAKSFDFEADMGYPLGWNDQANWNINLSSTQ 621
            P   G  N +N  F ++E+R+SVNH++  R+KS+  ++D+GYPLGWND+  W+    S Q
Sbjct: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769

Query: 622  LEIFILREHITLISDVFADFSSGDPTPYELFRPFIYRINWNLDGYSIYLNVNDHNIVNNP 681
            LE F LREH+ LI+D F+DFSSG+PTPYE FRP IY+++WN  GYS YLNVNDHNI+NNP
Sbjct: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829

Query: 682  LDFNENCYLSLHGDHLIFDVKIPRQTVANRCTEITYHISTPMFRXXXXXXXXXXXXEFMK 741
            LDFNENCY+S+HGD     V+IPR  +    T+I + ISTPMFR            EFM+
Sbjct: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRLLLNTPPWNTLNEFMR 889

Query: 742  NKEVGRSYNFQVNGLYTVFSELDIDNVDTISVECSSFGTTLHCYGFVVRYLMNVKMNYFG 801
            NKE+GR Y+F   G Y ++S+LDIDNVD++++ECS+   TL  YGFV+ YL+NV+MNYFG
Sbjct: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949

Query: 802  DFSHFVTAEEYTN-ANHTEEPKNENLGDEHSGFNISSTEDVETDRTNPEGRPANKGI--- 857
            +FSHF+TAEEYT+     +      L D       +S  +V   + NP+    +  I   
Sbjct: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFSVMSETNSVSNVSNSQHNPDNSSKSNIIDPL 1009

Query: 858  --PMPKRSELKRTENEMDIWFVFSVWEGALILPETIYNSDPCIALHFNELEVDLRSTNYY 915
              P  ++ ++KR  NE DIWF FSVWEGAL+LPE +YNSDPCIAL F EL +D R+ +YY
Sbjct: 1010 YNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDYY 1069

Query: 916  MDLLATMNNTELKRYVSRHPHDLFECVRKDNGRQEKSHGYLSSLTIHGHRMYGLPPTEPT 975
            +DLLAT+N T  KR + ++ +D+FE V  +  +  + HG +S+++IHGHRMYG PPT P+
Sbjct: 1070 LDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPS 1129

Query: 976  YFCQWGVDIDRLEINSDLEFAKGFLTCFSKIGFGFKNLENILLYETNTLFDMTSVTVRVK 1035
            YF  W VD++ L INSD+ F +GF++  +K+GF F NL+NILLY+ + L +MTSVTV   
Sbjct: 1130 YFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHGT 1189

Query: 1036 ELKFMMNDADTSSRSVLHAKKITFTAIDFENEAYSQRVDFKFPDINFLIFELDENQKEGR 1095
             +  ++ D  TS++ +L+   ITF  I+F N+ YS R+D + P ++F  F+ + +  +  
Sbjct: 1190 GIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFD-NGSSMDKT 1248

Query: 1096 FLLHLKTQLNFTDFIQNQAFADHRYRQREYITLHDSAYYRCSFLLPCFFQESVLYKELLG 1155
             L   KT++NFT+F Q +    H  +Q+E+I L+DSA++RCSFLL    QES+LY EL G
Sbjct: 1249 CLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELYG 1308

Query: 1156 SISPSATXXXXXXXXXAETIDYIIEDCLGEYAPTVKPDDSSSSDTSEGQRTPLTNEDTRF 1215
             I+PS++         AETI +II+D LG +       +S+    S    TP+ + +   
Sbjct: 1309 GITPSSSVPPLPIPVQAETIAFIIDDFLGPFGI-----NSTELLGSISTSTPIHSSNKPL 1363

Query: 1216 Q-ANSGFFSP---HMPHXXXXXXXXXXXXVLDVEYVNLEVKPSVTGVLLNYLKKFYTEDT 1271
            +  +S    P      H            ++D+ Y+ L++ P       N+L +FY+E+ 
Sbjct: 1364 KPPSSSVIHPIESMQSHLVPSQSVTHGNYIIDISYITLDINPLFFTYASNFLDEFYSENI 1423

Query: 1272 TDIIDKNEIAIVKKLGNLQYGASFVTTSRLHVKDLHFLYDFEEGSGVELALNSFDFDLRR 1331
             + ID  E+AIV +LG        VT  +L +K L F +      G+EL ++  D ++ +
Sbjct: 1424 IETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELYVDQIDLEVSQ 1483

Query: 1332 KTIENEDEKVILEKTMFSNIHTLRISLLEAHP-SSISMKPAALQLSIEDLELWSSTVDEN 1390
            KT + +   V+ E  + S   +LR S+ E         +P AL L++E  E WSST    
Sbjct: 1484 KTFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSSTASSQ 1543

Query: 1391 VNSVNVTSFGFTLDESQLERISGYLFGQIKVLRDTITSAKELENLRKKTQKDLICDLTSA 1450
            VNS+N++S   T+DESQ+E +  YL   +  + + + S   ++      QK L+ DLT A
Sbjct: 1544 VNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQKKLVSDLTLA 1603

Query: 1451 SEYYQISHDPYVITKPAFIMRLSEGHVRENRSWRIITRLRHILTYLPNDWRTADHLVTVQ 1510
            SEYYQISHDPYVITKPA++MR+S+GHVR+NRSWRI+TRLRHI TYLP+DW    H+    
Sbjct: 1604 SEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWEI--HVQEEM 1661

Query: 1511 DSENPNVPQRDEDIFVSVFSNWRNWDLSDITRSYIYKKIFLPQNEDSFKKELRTVLKINF 1570
              ++ N      DIF++VFSNWRNW++SD+ RSYIYKKIFL  +E + +K+L+T +K+N 
Sbjct: 1662 RGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQTTVKLNL 1721

Query: 1571 QSFFFTVLISGYEVARSTIFTRTNIIVD------VLPPSVNTSSENLFKQEKVITLTANM 1624
             S FFT+  +GY +  + I T+  I+++      V PP           ++ ++ +T ++
Sbjct: 1722 NSIFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPPI----------EKSILNMTGSL 1771

Query: 1625 GAIKGEWGEEVFKLKELFSKFSENELDDLSNLGSISRSASISGFGSQMDRLESSRASGPG 1684
            G+IKGE+ ++  +L EL   FS+ E     ++ S++ ++SI    S              
Sbjct: 1772 GSIKGEFSDKFLRLLELIPDFSKEE-----DIKSLTENSSIVSEKSPY------------ 1814

Query: 1685 DRFRNLKIFATMIFERCDLHFVVGDTRLTNRIINGKNSMLLENSKENTPPALSAVFFAQR 1744
                   I   ++FE   L   +GDT L+N + +GK S LLE S  +   + S  ++ ++
Sbjct: 1815 -----FTIHLFLLFENGGLQLTMGDTTLSNNVTDGKISALLEKSSYSKEFSYSGAYYMKK 1869

Query: 1745 HEIWLKHSTNVLAEVLLKQLHVAATA-QLGVIPFVSLNCQATNSFIRAMPSTVVLRNSVE 1803
             E+ LKH+ +++AE  L  L + +T     + P + +N ++ +   +++ ST  +  ++E
Sbjct: 1870 SEMCLKHNKDIIAEFQLHHLGLISTGIYTPICPVILINLRSADLHFKSLASTEKIVKTIE 1929

Query: 1804 KIKRQVEVLIPQFKSHEVKNSSAVTKKTPRIP--IKFDIRF--NFTDMSSEIMLLSPFYL 1859
             I    E  +  +K ++++  +    K  + P  I FD+R   N + +S+E+ L+SPFYL
Sbjct: 1930 DI---TEYSVHLYKHYDLRKYTTKPTKVDQKPEKINFDVRVACNLSKVSAELTLISPFYL 1986

Query: 1860 LQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSEQFFKFSSTDLQFKCXXXXXXXXX 1919
              + KQL +Y + + + E++L   + D+++ S  + EQ+F+FS  D+Q  C         
Sbjct: 1987 RYETKQLDLYFNQNGDGEILLSLWDTDIFVTSHHTKEQYFRFSYDDIQINCNPMSEKNKV 2046

Query: 1920 XXXQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHIQKLWNFLRSASGG----NDRSP 1975
                +S SL+KLT  EPRR   + LQDE+  +ES   ++KL     S +      N+  P
Sbjct: 2047 LVVSLSASLVKLTFSEPRRIFASFLQDERITIESFQELKKLKKIFFSNAKNVKKLNNDVP 2106

Query: 1976 SRN--TRWALDANLKYFGLLVPVSSICYIFELHSLFASLTNANEQYEEYDRHFSGQIVVE 2033
              +  T+WAL+ N+ YFG+L+P++S  ++ ELH L  SLTN  E+ +E +   SGQI +E
Sbjct: 2107 KEDTPTKWALELNINYFGILLPIASTFFVLELHMLLGSLTNTTEEIQEVNNQISGQISLE 2166

Query: 2034 SCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIESSYFRLCLFPELLVDILWS 2093
            +   L+ + SLP  LSK++DFSIR  T QK  +S +S QIESS+FR+C  PE LV +LW 
Sbjct: 2167 NILFLINDRSLPLRLSKLVDFSIRISTLQKTTSSYESLQIESSHFRMCFSPESLVFVLWG 2226

Query: 2094 VHYLQSLLNHFKKHHTP--WLPYSSNKT---AKSGESTLD-FRSIHILSYNFCVGWLFEV 2147
            V  LQ+ L ++K H T   W   SS+KT   + + ES L+ FRSIHILSYNFC+GW+   
Sbjct: 2227 VKQLQNELEYYKDHKTKRQW-NLSSHKTGTKSSTSESPLNYFRSIHILSYNFCIGWMLPE 2285

Query: 2148 GDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDTFYSQKSEKDSYTRTYLS 2207
                 PG + GYDRLFSAYEK++GKLTLI+GY+SV N N+S+ F+SQ  EK+ + R++L 
Sbjct: 2286 NQKDIPGWMFGYDRLFSAYEKNYGKLTLIEGYMSVTNSNSSNDFFSQGEEKNRHNRSFLP 2345

Query: 2208 NMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKRFNEMKKAKIKQTG 2267
            +MQI YWLK  N  KDLF+R HG+ +DV  LS    ++E    S + F + +K+KI Q  
Sbjct: 2346 SMQILYWLKEFNSKKDLFIRLHGDALDVDILSNFVNIIELIFKSYQIFEDFRKSKIVQNI 2405

Query: 2268 SSTK--SKLNMEAASNTLAPFLAHIRTINSQLNFAGGVFKVYSPTELDSKAEPLLEIKSP 2325
               K    +  E A+  +  FL+ I +IN +  + GG  +V+S  +++  + P LE+ +P
Sbjct: 2406 EKQKHHEHIKSENATEFVPTFLSDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAP 2465

Query: 2326 GVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIKNMIRNLSSEDK 2385
             V + +NY+  +   K H +R    I  +HN+L++KCAP + +F  +I+ ++ N   E K
Sbjct: 2466 KVSIYLNYKHFDDSPKPHWLRCVIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEPK 2525

Query: 2386 SHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKVQLDAGFNSFLFRVTTDK 2445
               SK  T +  YK +L P+DIAF I + KQ LSFSCEP AKVQ + G +SFLF ++T  
Sbjct: 2526 QSVSKIATPNRTYKRILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGG 2585

Query: 2446 VDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVMMFTYPNVYGVALVSDMNIY 2505
                +P +++  ++KI +SV+HIFS+++SA+F L++ID+  +FT P +Y V L+SD++I+
Sbjct: 2586 SSVEDPLSLTLCINKISTSVQHIFSKEASASFSLNFIDLTFIFTQPTLYCVGLISDIDIF 2645

Query: 2506 CNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAKKXXXXXXXXXXXXXRKVFPWSF 2565
             NMKQ+QNL +FLDIW LS     +P+  K + K                   K+ PW+F
Sbjct: 2646 FNMKQQQNLLLFLDIWHLSESIGIRPNRKKRKHKKHKGHTQIPETPQPG----KIIPWNF 2701

Query: 2566 TIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRTWHTFAHGITVNSEGRLSGMF 2625
             IIFTN+   + LGP+LG+++  LE+ W  +    D+++    F  G+ + S GRLSGM 
Sbjct: 2702 NIIFTNVNADIHLGPALGIVSAKLEKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGML 2761

Query: 2626 ELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIKSAFDYHMFLIGSMKSVKVHLHNE 2685
            ++  A    E+++ + +L    P++++ + I  +++K+AFDYHMF+I  + ++   LH+E
Sbjct: 2762 DISNAGWRLEVNYADNELNYNSPIVAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSE 2821

Query: 2686 SDTYAILPDLLQVSLEFESIVLCXXXXXXXXXXDIYNTIMRMQQDNRISYIETLKESNIS 2745
             D    LPDLL  +L  E I +C          DIYNTI+R +QD + SY ETL ESN  
Sbjct: 2822 RDPEGKLPDLLLTTLLCEEISICSTTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQ 2881

Query: 2746 ASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLFDAEVLVVSVRDVNARSETQSG 2805
             + T++ Y ++L SLNLLRTD+ + V +L++ ISP+SLFD EVLV+++ +++ARSET S 
Sbjct: 2882 DTRTNIPYSDILKSLNLLRTDVQIDVSKLQLQISPISLFDFEVLVINIDNMSARSETTST 2941

Query: 2806 EKLKTELQLQISDVNAXXXXXXXXXXXXTVSKIAVDDYMLYASKFSGGTIIKLPQLLVSM 2865
            +KLKT L+LQ+ + +             +V+KI+V DYM YASK  GGTI+ +P+LLV M
Sbjct: 2942 DKLKTRLELQVCNASVALSTAKEELDEESVNKISVADYMTYASKIKGGTILIIPKLLVGM 3001

Query: 2866 TTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMWATHVRSLAVRRTQLGNSSPEL 2925
            TTWQ+ +S  +EY FTCKF  K+S++WNLGPVNFIKEMWATHV+SLAVR+ ++       
Sbjct: 3002 TTWQKVTSNTIEYTFTCKFDGKVSVRWNLGPVNFIKEMWATHVKSLAVRQARIEEPVEYS 3061

Query: 2926 EVANESDKE----DTVKSKFIYVPLDEPYIEMPQIKDLGDATPPLEWFGVHRKNLPAATH 2981
                ES  E    +  + KF YV L EP IEMPQIKDL DATPP+EWFG++RK  P+ TH
Sbjct: 3062 SEELESSPESIYLEPAQPKFTYVALVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTH 3121

Query: 2982 QTAVLLIQKLVHTAEKEYAKL 3002
            QTAV+++QKLVH  EKEYAK+
Sbjct: 3122 QTAVIVVQKLVHAVEKEYAKI 3142

 Score =  180 bits (457), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 117/176 (66%), Gaps = 8/176 (4%)

Query: 7   FQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRCKVKINI 66
           F  VSL R + FSWVFLV W+LTCI+ L + FY+ R+F + LTFIL+W++W+  KVKI+ 
Sbjct: 7   FVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIHC 66

Query: 67  ESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQXXXXXXXXXXXX 126
           ES+R++ L   I F+NLCII  + TIS LEG I W+YWL N+R S Y+            
Sbjct: 67  ESIRLSLLSARISFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYIT 126

Query: 127 GQEPKSNSGRKH---PCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFV 179
                  SG K+   PC+FL  CEG EIFVYNKTS+YENII  FS +E+ ++++F+
Sbjct: 127 -----PGSGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFL 177

 Score =  131 bits (330), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 116/193 (60%), Gaps = 19/193 (9%)

Query: 259 MRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPPKE-KLDLFKIKLEKELYD 317
           + F P  +   + S++ GN+FTPS+L++S K+++GI+D+ P    ++DL+K+K++ +  +
Sbjct: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357

Query: 318 VDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIF-LLPTLGPKHLQTQ--------- 367
            +  VK NI ++DD      +    LS+LW KF+ +F ++P    +++            
Sbjct: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417

Query: 368 -----EDITFRENWKGLSLYRQNM--EEDELENVDFDFANHEYARVISILKSAKIVFTYE 420
                ED  F + WKGLSLY+       +  E+++FDF NHEYAR  SI+K+ +++FT E
Sbjct: 418 EDNIFEDEDFEKKWKGLSLYKDAALNRGNPEEHIEFDFLNHEYARYCSIVKAPRLIFTNE 477

Query: 421 YDIPGLVPKEPEE 433
           YDIPG+VP  PE+
Sbjct: 478 YDIPGIVPY-PED 489

>TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3046

 Score = 2005 bits (5195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1092/2921 (37%), Positives = 1704/2921 (58%), Gaps = 110/2921 (3%)

Query: 133  NSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVDDQTMTELFNESE 192
            N  +K    F + C G EIF+YN+  +YE II  FSKEE+ QF  F+    + ++F E  
Sbjct: 179  NKNKKLDSLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVS 238

Query: 193  QENKVLSESTPSSVTMETV--GXXXXXXXXXXXXXXXAGRNQNDGQAPNNLENDELFEQQ 250
             E K  +E         +   G               +G +Q +    +N++N       
Sbjct: 239  SEIKNCNEYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQENDSDRSNIDNRNKISAH 298

Query: 251  CSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPPKEKLDLFKIK 310
                + +++  LP+ I+  + ++ +GN+FT S+LV++   + G++D   P  KLD+FK K
Sbjct: 299  I--MRKLHLDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNK 356

Query: 311  LEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIF-LLPTLGPK----HLQ 365
            +  E+ D+D S+K+NIG++ ++++ F +  G L+++W     +  L+PT   K     L+
Sbjct: 357  VTFEINDIDMSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLR 416

Query: 366  TQEDITFRENWKGLSLYRQNMEEDE---LENVDFDFANHEYARVISILKSAKIVFTYEYD 422
             +ED TF + W GL LY+ +++       ++VDFDFANHEYA+V +  K+ +I+F+ E D
Sbjct: 417  YKEDTTFVKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESD 476

Query: 423  IPGLVPK---EPEETLQGPEVGNSGAPPEFGVDIQLYGANICYGPWAERQLSYLRALLSP 479
            IPG+VP     P     GP++GN  +PP F +D+QL  A+I +G W  R +  LR L+ P
Sbjct: 477  IPGIVPHGSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFP 536

Query: 480  VVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLRHYVETKEEFR 539
            V+S+  KP+  L PG  R++++F  S+S++++S+ R+PTRE SKD +FL+ Y+ETK++FR
Sbjct: 537  VISKDQKPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFR 596

Query: 540  PFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELLLRAKSFDFEA 599
             FGWIDL F K S  +L+  + PT  G  N +   FS +E+ TSVNH LL ++ S +  A
Sbjct: 597  AFGWIDLSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAA 656

Query: 600  DMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPYELFRPFIYRI 659
            ++GYPLGWND  NW  N++S QL+IF+LREHITL+SD+  DFS+ +PTPYELFR F Y +
Sbjct: 657  NIGYPLGWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNL 716

Query: 660  NWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVANRCTEITYHI 719
            N  + GYS Y NVND NI+NNPLDFNENCYLS HGD    ++ IP  ++A +   I+Y I
Sbjct: 717  NLKIGGYSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEI 776

Query: 720  STPMFRXXXXXXXXXXXXEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVDTISVECSSFG 779
             TPMFR            EFM+NKE+GRS++F+V+G Y ++SELDIDNVD+++++  S  
Sbjct: 777  FTPMFRLFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNS 836

Query: 780  TTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENLGDEHSGFNISSTE 839
            T L+C+GFV++Y+MN + NYFG F  F+T EEY+         N+NLG  ++  +++S E
Sbjct: 837  TVLYCFGFVIKYMMNFQANYFGSFIKFITTEEYSEL--IRNNVNDNLGSINTN-DLTSIE 893

Query: 840  DVE-TDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGALILPETIYNSDPCI 898
             ++  D    +    N+     KRS+L RTENE DIW  F V +GALILPE +YN D C+
Sbjct: 894  GLQKMDSITNDVEDINQ--KTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCV 951

Query: 899  ALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDNGRQEKSHGYLSS 958
            +L F EL +++R+ NYYMD+  T+ +  L R+    PH+LFE ++  N R     G +S 
Sbjct: 952  SLSFGELFINMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRN-RSSSVEGNISD 1010

Query: 959  LTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSKIGFGFKNLENILL 1018
            +TIHGHRMYGLPP E TYFCQW ++I    I+SD+ F   F+   +KIGF   N EN LL
Sbjct: 1011 ITIHGHRMYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLL 1070

Query: 1019 YETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFENEAYSQRVDFKFP 1078
            YE++T+ DMT ++V V+ LK +++D    +R+ + A  I    IDFENE Y++R+D    
Sbjct: 1071 YESDTVNDMTLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNAS 1130

Query: 1079 DINFLI--FELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREYITLHDSAYYRC 1136
            +  F +   ++D  +K    +L ++T+LN T+F +     +H   QR++I LHDS Y+RC
Sbjct: 1131 EFYFSLDSLKIDSGKKN---ILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRC 1187

Query: 1137 SFLLPCFFQESVLYKELLGSISPSATXXXXXXXXXAETIDYIIEDCLGEYAPTVKPDD-- 1194
             FLLP  FQES  YKEL GSI+PS +           T ++I+E  L +Y+  +  D   
Sbjct: 1188 FFLLPEKFQESSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHN 1247

Query: 1195 --SSSSDTSEGQRTPLTNE-DTRFQANSGFFSPHMPHXXXXXXXXXXXXVLDVEYVNLEV 1251
              S +++ +    TPL +  D +        +   P+            V++V+Y+ + V
Sbjct: 1248 QMSINAELNSVDTTPLKDSFDMQITNFQNILTTEDPY-------ETDNFVVNVKYLTVTV 1300

Query: 1252 KPSVTGVLLNYLKKFYTE-----DTTDIIDKNEIAIVKKLGNLQYGASFVTTSRLHVKDL 1306
             P +       ++KF TE        + ID  E+AIV +L +L+   S      L+V+ +
Sbjct: 1301 NPDIVFT----IEKFSTEFNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKI 1356

Query: 1307 HFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISLLEAHPSSI 1366
               +   +   +   +N   F+L +++  N +  +  + T+     ++RI +     +S 
Sbjct: 1357 DAAWGHRDVCFIGTYINMLKFELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSF 1416

Query: 1367 S-MKPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQIKVLRDT 1425
            S  +P  L L +E  E WSST  + + ++N+TSF  T+DE Q+  +  Y+  QI +    
Sbjct: 1417 SDDRPPGLSLMLEGFEAWSSTTTKQLTTLNLTSFDITVDEYQIHWLIPYVKSQILLFTKI 1476

Query: 1426 ITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVRENRSWRI 1485
              S K + + +   QK  I  L  A E YQI HDPYVITKPA ++RLS  H+RENRSWRI
Sbjct: 1477 QDSVKLIYDEQASYQKTFITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRI 1536

Query: 1486 ITRLRHILTYLPNDWRTADHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDLSDITRSYI 1545
            +T+LRHILTYLP DW   D L      +   + +     F++VFSNWRNW++SDI +SYI
Sbjct: 1537 VTKLRHILTYLPEDWE--DRLDEEDLIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYI 1594

Query: 1546 YKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNIIVDVLPPSVN 1605
            Y+ IF+   E+  K+ L+  +K+  ++F+FT+    Y   ++ + T+ NI+++     VN
Sbjct: 1595 YRMIFV---EEVSKRILQNSIKVFLETFYFTIYSRNYSADQNFLITKANILINNEADQVN 1651

Query: 1606 TSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLGSISRSASI 1665
               + + KQE+++ +   +G+IK E+ E + KLK    +  +  +D              
Sbjct: 1652 -EVDLIRKQEEIVDVVTKIGSIKFEFTEAILKLKRDIEQIIKTSVDS------------- 1697

Query: 1666 SGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIINGKNSMLL 1725
                S+ D+L  ++           K+  + IF+  D +    ++ L +R+ N       
Sbjct: 1698 ---KSEGDKLSITKF---------FKVNLSFIFDHIDFNGQFYNSSLKSRMSNVNILSYF 1745

Query: 1726 ENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQL-GVIPFVSLNCQA 1784
            EN+ E++ P+ S V++A R  I LKH  N+L +  ++ L  + TA+L   +  + +N + 
Sbjct: 1746 ENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLFASTTAELHSAVNSLMINFRC 1805

Query: 1785 TNSFIRAMPSTVVLRNSVEKIKRQVEVLIPQFKSHEVKNSSAVTKKTPRIPIK------- 1837
            +N   +++P T +  N+++ I+R VE L  +    +    +  T+ TP +  K       
Sbjct: 1806 SNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNINTEHTPSVHEKNKMQKAK 1865

Query: 1838 ------FDIRFNFTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKS 1891
                    +   FT++SSEI LL P YL  +   ++I  +     EL++  L+ D+YL S
Sbjct: 1866 PNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISYNTINIDELLVQVLDTDLYLNS 1925

Query: 1892 QLSSEQFFKFSSTDLQFKCXXXXXXXXXXXXQISTSLMKLTLCEPRRALHNLLQDEQTLV 1951
              + EQ+ + S   L+               +IS+S++KLT  +PRR L + LQDE+ L 
Sbjct: 1926 SHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSILKLTTSDPRRMLFSFLQDEKELK 1985

Query: 1952 ESVDHIQKLWNFLRSASGGNDRSPSRNTRWALDANLKYFGLLVPVSSICYIFELHSLFAS 2011
             S+  ++ L +  R A+  +  +   +  W ++   KY G+L+P+ +  Y+FELH   ++
Sbjct: 1986 NSLTFLRSLESLNRKANSEDSETLFSSYEWIVNFKSKYMGVLLPIQATYYVFELHDALST 2045

Query: 2012 LTNANEQYEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSY 2071
            ++N  E      + F G +  +    L+K+ S+P   SK+LDFSI+  T + V N  +S+
Sbjct: 2046 VSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKILDFSIKLSTHRTVNNFDRSF 2105

Query: 2072 QIESSYFRLCLFPELLVDILWSVHYLQSLLNHFKKHHT-PWLPYSSNK----TAKSGEST 2126
            +IESS+FR+CL P  L+  +W  + L  LLN +    T  +  ++ N     T    E+ 
Sbjct: 2106 EIESSFFRVCLTPFSLIQTMWGYYQLLYLLNSYYDQSTVNFFVFNDNNIDGATNSEKENV 2165

Query: 2127 LDFRSIHILSYNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGN 2186
               RS HILSYNF +GWL++  DN+ PGLILGY+RLFS YE + GKLTL+DG+ S+ANG+
Sbjct: 2166 FSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLFSTYEDNHGKLTLVDGFFSLANGS 2225

Query: 2187 TSDTFYSQKSEKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVE 2246
            + DTFYS   E   + R+YL N+QI YW+K    +K LF++FHGE +DV F      ++E
Sbjct: 2226 SGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHLFIKFHGETLDVNFFENFVNIIE 2285

Query: 2247 KTLHSIKRFNEMKKAKIKQ--TGSSTKSKLNMEAASNTLAPFLAHIRTINSQLNFAGGVF 2304
             T+ SI  F  +K+ KI         + + +  A +N   P    ++ +N +  + GG+F
Sbjct: 2286 STVRSIDLFQTLKREKINPLVKAKPERDEKSNSALTNIKGPIFGKLKQVNCEFIYDGGLF 2345

Query: 2305 KVYSPTELDSKAEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAP 2364
            +++S   + +K EP L IKSP V++ ++Y++ E   K H I     IEPT N+L + C P
Sbjct: 2346 RLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKELKKHWINCLIDIEPTQNVLKSGCVP 2405

Query: 2365 LLSDFNHNIKNMIRNLSSEDKSHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSCEP 2424
             LSDF   IK+++       + +    V D I+  SLL  +DI F++ SG Q ++  CEP
Sbjct: 2406 FLSDFISQIKDIVELQDVNMEENMDNNVKDPINITSLLENFDICFKLISGTQHVTLDCEP 2465

Query: 2425 KAKVQLDAGFNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDI 2484
            KAK+  D GF SF F + T  ++ ++P ++S  ++ I++SV+H FS ++SA+F +  +D+
Sbjct: 2466 KAKINTDVGFGSFEFSILTPHLNPIDPLDISLKINDIKTSVKHQFSNEASASFEVSKLDV 2525

Query: 2485 VMMFTYPNVYGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAKK 2544
            +++FT+P V+G  LV D+ ++ N+KQ QN++IFLDIW +S     K  +  +    DAK 
Sbjct: 2526 ILIFTHPEVFGTGLVDDVKLHFNLKQFQNISIFLDIWDVSKSTEKKLFKKDSNTLVDAKS 2585

Query: 2545 XXXXXXXXXXXXXRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKR 2604
                             PWSF  I TN+ G +++G +LG L L L++ WI+T H  ++++
Sbjct: 2586 ----SPIAQTIVNSSTLPWSFVFIATNINGDINMGSTLGNLALNLQRTWISTDHFHNKRQ 2641

Query: 2605 TWHTFAHGITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIKSA 2664
              H F   + ++SEGRL G  E+D  +   ++++ ++    V PL+ +   + ++S+K A
Sbjct: 2642 LLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYVDKYKFVVSPLVDLLFDVGKVSMKVA 2701

Query: 2665 FDYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCXXXXXXXXXXDIYNTI 2724
            FDYHMFLI ++K +K H+ +E D   ILPDLL V+L  + I +C          DIYNTI
Sbjct: 2702 FDYHMFLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCDEIKVCTTALVASNILDIYNTI 2761

Query: 2725 MRMQQDNRISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLF 2784
            MR +QDN+ SYIETL ESN +       YE++L SLNLL+T +S  + EL + ISP SL+
Sbjct: 2762 MRTRQDNKNSYIETLLESNNNVLKRKPLYEDILKSLNLLQTSLSANIHELNLQISPSSLY 2821

Query: 2785 DAEVLVVSVRDVNARSETQSGEKLKTELQLQISDVNAXXXXXXXXXXXXTVSKIAVDDYM 2844
            DAEV+++ V+DV + +ET++GEK+KT+L++++ +                +++++ + Y+
Sbjct: 2822 DAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNATLSLTSFGKELTEEDIAEMSAETYI 2881

Query: 2845 LYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMW 2904
             YAS  + G I ++PQL ++MTT+Q   + +L+Y ++C F  K+ + WNLGP+NFIKE+W
Sbjct: 2882 SYASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYSCSFDGKVDVTWNLGPINFIKEVW 2941

Query: 2905 ATHVRSLAVRRTQ-LGNSSPELEVANESDKEDTVK--SKFIYVPLDEPYIEMPQIKDLGD 2961
            ATHVRSL VR  Q +GN    LE  NE D +++VK  S   Y+ L+EPYIEMPQIKDL D
Sbjct: 2942 ATHVRSLEVRTVQFMGNHDISLE--NEGDTDESVKVLSNIEYIALEEPYIEMPQIKDLKD 2999

Query: 2962 ATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKL 3002
            ATPPLEWFG++RK  P+ATHQ+ ++ IQKLV+ A+KEYAK+
Sbjct: 3000 ATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYAKV 3040

 Score =  133 bits (334), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 80/110 (72%)

Query: 5   SPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRCKVKI 64
           + F  VSL + R FSWVFLV W+L  + T T +FY+ +++GF LTF  EW++WK   +K+
Sbjct: 6   TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65

Query: 65  NIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQ 114
            IES+R++ L G I F+N+C+I +D TIS LE ++ WRYWL N+RKS+Y+
Sbjct: 66  TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYE 115

>KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2966

 Score = 1779 bits (4608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1059/3087 (34%), Positives = 1651/3087 (53%), Gaps = 208/3087 (6%)

Query: 5    SPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRCKVKI 64
            S F++VSL    +FSWVFLVDWVL   V+L   FY GR+FG+ LTF+LEW+ WKR KVKI
Sbjct: 3    SQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVKI 62

Query: 65   NIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQXXXXXXXXXX 124
            +I+SL+I+ LGG I F+NL ++ ++ T S L+G+I WRYWL NSRK+ +           
Sbjct: 63   SIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAF----------- 111

Query: 125  XXGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVDDQTM 184
                E    S  K PCRF + C+GLE F+YNKT +++NI++   +E+  +F+ F  D + 
Sbjct: 112  AKASENIDKSVEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNS- 170

Query: 185  TELFNESEQENKVLSESTPSSVTMETVGXXXXXXXXXXXXXXXAGRNQNDGQAPNNLEND 244
                +++  E  V  +S      +ET                                ND
Sbjct: 171  ----DKNTDECSVDEDSAGQRSHLETSTSSPSSKSKSL--------------------ND 206

Query: 245  ELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPPKEKL 304
              F  Q  +    +++ LP++ S ++ ++V+GN+ + S++V+S +   G++D C P  K+
Sbjct: 207  RSF--QSPDSTPPFLKLLPLEYSVQKGAVVIGNKTSSSVMVLSYEKLDGVLDTCLPDSKI 264

Query: 305  DLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFLLPTLGPKH- 363
            DL+KIK+  E      S+K N+  + +        R +LSKLW +  ++F   T  P   
Sbjct: 265  DLYKIKVRNEFRKFHISLKPNLSLESENPLKSFVKRSKLSKLWHRSYQLFF-KTDSPSSK 323

Query: 364  --LQTQEDITFR--ENWKGLSLYRQNMEEDELENVDFDFANHEYARVISILKSAKIVFTY 419
                + +D T    + W+GL LY +  +    +   FD + HEYAR   ++K   ++  Y
Sbjct: 324  NPANSAKDGTRNPLKRWRGLGLYWKEEDAAWDDRFQFDLSKHEYARYTKVMKCDNMLLEY 383

Query: 420  EYDIPGLVPKEPEETLQ---GPEVGNSGAPPEFGVDIQLYGANICYGPWAERQLSYLRAL 476
             +D PG+VP     T Q   GP+VGNSG PP++ +DIQ+ GA++ YGPW+  ++  L+ L
Sbjct: 384  AFDAPGIVPHGALPTFQTVDGPDVGNSGPPPDYSIDIQISGASLYYGPWSHHEIMPLQKL 443

Query: 477  LSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLRHYVETKE 536
             SPVVSR  +P++ LTPGS+RIYT  + SI I+ ES WRIPTRE SKD EFL+ + ET++
Sbjct: 444  FSPVVSRDSQPVEQLTPGSKRIYTRLRLSILIVGESVWRIPTREASKDLEFLKRFRETED 503

Query: 537  EFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELLLRAKSFD 596
            E RPFGW+++   + S    +  +CPT  G  N ++ HF   EIRTSVNH++LL A++  
Sbjct: 504  ETRPFGWLEVSLSEGSEVRFNIAMCPTATGFDNTLDLHFVKPEIRTSVNHDILLSAQTHS 563

Query: 597  FEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPYELFRPFI 656
              A MGYPLGWN +A W  +  S Q +IFIL++HITL+ D+ +DF SG+PTPYELFRPF 
Sbjct: 564  MHATMGYPLGWNKKAEWVFDSVSNQCQIFILKDHITLLGDIISDFGSGEPTPYELFRPFS 623

Query: 657  YRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVANRCTEIT 716
            Y  NWN  GYSIYLNVND NIVNNP++FNENCYLS HGD L  + ++P++ +A   T+I 
Sbjct: 624  YTFNWNFTGYSIYLNVNDANIVNNPVNFNENCYLSFHGDDLRLNFEVPQENIAGNSTKIN 683

Query: 717  YHISTPMFRXXXXXXXXXXXXEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVDTISVECS 776
            Y + TP+FR            EFMK+KEVGRS NF ++G Y   S+LD+DN+DTI +EC 
Sbjct: 684  YELFTPLFRLNMNTPSWNTLHEFMKDKEVGRSANFSLSGSYLFHSKLDVDNIDTIIIECC 743

Query: 777  SFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENLGDEHSGFNIS 836
            S  TTL CYG+V+RY + VKMNYFGDF HF T EEY      EE +  N   +       
Sbjct: 744  SKSTTLKCYGYVLRYFLGVKMNYFGDFVHFKTTEEY-----MEELRGTNAVTK------- 791

Query: 837  STEDVETD------RTNPEGRPANKGIPMP---KRSELKRTENEMDIWFVFSVWEGALIL 887
            +T D ET+      + + +     + I  P   K++ LKR  NE D+WF F V +G  IL
Sbjct: 792  TTHDSETEIQEAPKQMDEDSSQREQHIKDPLTAKKTSLKRMVNEKDVWFTFVVEDGCFIL 851

Query: 888  PETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDNG 947
            PE +Y+ D C AL F+ L++DLR  NYYMD+ A ++   ++R +     ++FE      G
Sbjct: 852  PENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPLRIRRLIDCGCEEVFE----QKG 907

Query: 948  RQ---EKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFS 1004
            R    E   G LS L IH HRM+GLPP E TYFC+W   +  L+++SDL F  GF+  + 
Sbjct: 908  RALCGELVAGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLGTLDLSSDLPFTLGFINAWK 967

Query: 1005 KIGFGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDF 1064
            K+GFGF++ ENI+ Y+   + DMTSVT+ +  + F  +     +   L+A+ I+    D 
Sbjct: 968  KLGFGFRDYENIMNYKVAPILDMTSVTLAIDAIVFCTDKIKDETAIQLNAQDISAKFADL 1027

Query: 1065 ENEAYSQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQRE 1124
            EN  YS RVD    D+  L   + +  K  + +    T +  ++F Q Q    H  +Q+ 
Sbjct: 1028 ENSLYSSRVDL---DVANLTASIIDKNKSNKAIASFMTSIKISNFCQLQDLLAHSQQQKV 1084

Query: 1125 YITLHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATXXXXXXXXXAETIDYIIE---- 1180
            +I  +D+ ++RC FL+P   Q S  YK L G I P  +          E +  + +    
Sbjct: 1085 HIASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIPPGVSIPSLAVPLQTENVKAVFQGYLK 1144

Query: 1181 ------DCLGEYAPT--VKPDDSSSSDTSEGQRTPLTNEDTRFQANSGFFSPHMPHXXXX 1232
                  D +  + P   VK  +SSS    +GQ  P+ +++T    +S F  P   H    
Sbjct: 1145 AENASKDFVDRWFPVNEVKNKNSSSLKDFKGQLQPILDDNTSL--SSSFSDPTFEH---- 1198

Query: 1233 XXXXXXXXVLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYG 1292
                    V+++E   L + P    V+ N +++ + +     ID  E+ +V     +   
Sbjct: 1199 -----NTLVVNLENSRLSISPECYEVIGNAVEQCHKKLIEQFIDNIELDVVLHFIKMASR 1253

Query: 1293 ASFVTTSRLHVKDLHFL---------YDFEEGSGVELALNSFDFDLRRKTIENEDEKVIL 1343
                   R+ +  L  L         YD E    V     S D+ L++       +    
Sbjct: 1254 QKNYKNIRVLMPTLDVLFETYNKENTYDVEGQVKVTANQVSLDWSLKKGLKLPGSDNDPE 1313

Query: 1344 EKTMFSNIHTLRISL---LEAHPSSISM-KPAALQLSIEDLELWSSTVDENVNSVNVTSF 1399
            + T    I +L + +   L+       M +  A   S+++LE WS       +S+ + S 
Sbjct: 1314 DTTSLLKIESLDLEVFNKLDKKTKFAEMDENIAFGCSVKELEAWSYLNGIADSSLYLKSI 1373

Query: 1400 GFTLDESQLERISGYLFGQIKVLRDTITSAKELENLR-------KKTQKDLICDLTSASE 1452
              ++   +   +       I  +R     +K+L N         +K +++    ++ AS+
Sbjct: 1374 NASVALDKFNWL-------IDFMRKAFNDSKQLINRLSYCTGQFRKAEQEFFYRISKASD 1426

Query: 1453 YYQISHDPYVITKPAFIMRLSEGHVRENRSWRIITRLRHILTYLPNDWRTADHLVTVQDS 1512
             YQI+HDP VITKPA+I RL   HVRE+RSW+I+TRLRHIL YLP     +D    +++S
Sbjct: 1427 EYQITHDPPVITKPAYITRLPSQHVRESRSWKIVTRLRHILNYLPTTL-ISDIFNDLKNS 1485

Query: 1513 ENPNVPQRD-EDIFVSVFSNWRNWDLSDITRSYIYKKIFLPQNEDSFKKELRTVLKINFQ 1571
            E P  P+   E+ F+ +FSNW NWD SD+ + Y+Y+++F    +D+   E  T  KI   
Sbjct: 1486 EYP--PRSTAEETFLEIFSNWGNWDYSDVEKCYMYRRVFTNTLDDTVAHESST--KIETG 1541

Query: 1572 SFFFTVLISGYEVARSTIFTRTNIIVDVLPPSVNTSSENLFKQEKVITLTANMGAIKGEW 1631
            +F                             S+NT S+++    K +     + A K E 
Sbjct: 1542 TFMLNFF-----------------------DSINTGSDSVIL--KNLKAQRTLEACKDEA 1576

Query: 1632 GEEVFKLKELFSKFSENELDDLSNLGSISRSASISGFGSQMDRLESSR----------AS 1681
             E+        S  S  E D    L  I   A IS     + +L S R          A 
Sbjct: 1577 AEKR-------SNMSNAEDDLEERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAAV 1629

Query: 1682 GPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIINGKNSMLLENSKENTPPALSAVFF 1741
               ++    + +  ++ +RCD+  + G  R   +      +++ EN  E+   A S  F 
Sbjct: 1630 KENEKLPAFQQYTALV-DRCDIQLLCGANRANLKSFGNTLTIVRENKSEDA-DAFSTAFA 1687

Query: 1742 AQRHEIWLKHSTNVLAEVLLKQLHVAATAQLGVIPFVSLNCQATNSFIRAMPST----VV 1797
                E  ++H   +L +   +   V A    G      L+ +A   F   +PS       
Sbjct: 1688 WSWFEFGIRHRNTILLDAFSRSSAVGAHGFSGKNSRRKLDLRA-KKFRLKLPSESKHYCT 1746

Query: 1798 LRNSVEKIKRQVEV-LIPQFKSHEVKNSSAVTKKTPRIPIKFDIRFNFTDMSSEIMLLSP 1856
              +S+E+    + + L P     E  +S+A  K  P+  +  DI    +D++++I LLS 
Sbjct: 1747 FIDSLEESWNNLRLALGPNTGFLEKPHSAATEKVAPQFALNIDI----SDLTTDISLLSS 1802

Query: 1857 FYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSEQFFKFSSTDLQFKCXX-XXX 1915
              + ++ K+L +      +  L L F   D+ + S  +++Q+ K S +++ F        
Sbjct: 1803 LAITKNFKKLTLAYEQSASSALKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHRPKKN 1862

Query: 1916 XXXXXXXQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHIQKLWNFLRSASGGNDRSP 1975
                   ++ +++ KL L +PR     L +D       +  ++  +  L + +  +  S 
Sbjct: 1863 NASPPTVKLDSNITKLKLYDPRDITLPLGKDIAQAKACLASLKSCFGKLNTKNDKDIMSQ 1922

Query: 1976 SRNTR------WALDANLKYFGLLVPVSSICYIFELHSLFASLTN---ANEQYEEYDRHF 2026
              NT+      W     L Y GLL+P+ S  YI EL+ + A +T     N+  E      
Sbjct: 1923 G-NTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGAL 1981

Query: 2027 SGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIESSYFRLCLFPEL 2086
             G +   S   L+ +  LP  LS+V+DF++    +++    ++S QIES YFR+ L P  
Sbjct: 1982 RGDLSAASIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPFS 2041

Query: 2087 LVDILWSVHYLQSLLNHFKKHHTPWLPYSSNKTAKSGESTLDFRSIHILSYNFCVGWLFE 2146
            LV IL+ V+ L  L    K+     LP  S +  ++      FRS+ +LSYNFC+GW+F+
Sbjct: 2042 LVRILFLVNELSRLSELQKRQTVGKLP-ESVEVRETFRFRRAFRSVQVLSYNFCLGWIFD 2100

Query: 2147 VGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDTFYSQKSEKDSYTRTYL 2206
            V D+ EPGLI GY RLF+A+EK +GKLTL+D Y S+A G+TSD FY+ K+  ++  R++L
Sbjct: 2101 VNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFL 2160

Query: 2207 SNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKRFNEMKKAKIKQT 2266
             +MQI YW++ + L  +LF+R +GE +DVRFLS S  +    + S+  F+E+KK  +   
Sbjct: 2161 PSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVDPF 2220

Query: 2267 GSSTKSKLNMEAASNTLAPFLAHIRTINSQLNFAGGVFKVYSPTELDSKAEPLLEIKSPG 2326
             S    K     ++ +  P L+ I+ ++ ++ +AGGVF++YS  ++ ++A P  +++SP 
Sbjct: 2221 KSVANPKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQLESPS 2280

Query: 2327 VQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIKNMIR--NLSSED 2384
            V++  +Y      + SH +R +  +  +HN +F  C P+L++   +I+ +++  N S ++
Sbjct: 2281 VEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLKGFNRSPQE 2340

Query: 2385 KSHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKVQLDAGFNSFLFRVTTD 2444
             SH S    +S+DY+S L   DI+F I  GKQ++SFSCEPKAKVQ D GF     +V T+
Sbjct: 2341 ASHKSVS-QESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFTN 2399

Query: 2445 KVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVMMFTYPN---VYGVALVSD 2501
             +D  EP ++S  + +I +  RHIFSR+ S +  +D +  + + T+P+    YG+  + +
Sbjct: 2400 DLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIPN 2459

Query: 2502 MNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAKKXXXXXXXXXXXXXRKVF 2561
            +++Y N+KQ Q+LNIF++IW+  +   T+P  +    ++   +                F
Sbjct: 2460 IDVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSEEKPLVAKFKKVSSTTSF 2519

Query: 2562 PWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRTWHTFAHGITVNSEGRL 2621
            PW+F +I + + G +DLG SLGVL+L  +++W  T H  D  +        I ++S+GRL
Sbjct: 2520 PWNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDGRL 2579

Query: 2622 SGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIKSAFDYHMFLIGSMKSVKVH 2681
             G   L   S +S I WP  + +   PL+++ + ++   +K +FDYH+ LI S++ +K+ 
Sbjct: 2580 GGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLKLK 2639

Query: 2682 LHNESDTYAILPDLLQVSLEFESIVLCXXXXXXXXXXDIYNTIMRMQQDNRISYIETLKE 2741
            L N+ D   I  +LL V++   S  L           D+YNTI+RM++DNR SY ETL +
Sbjct: 2640 LFNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKSYFETLGD 2699

Query: 2742 SNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLFDAEVLVVSVRDVNARSE 2801
            SN   + ++   +++LNSL+ LRT++ V +K + + I P  LFD EVL    +D   +S+
Sbjct: 2700 SNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQSQ 2759

Query: 2802 TQSGEKLKTELQLQISDVNAXXXXXXXXXXXXTVSKIAVDDYMLYASKFSGGTIIKLPQL 2861
             +  EKLKT L+ QI  V                S+I V +Y+ +A K  GGTI+ +P +
Sbjct: 2760 IEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGTILVIPAI 2819

Query: 2862 LVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMWATHVRSLAVRRTQLGNS 2921
            L+ MTTW   ++  +E L++  F  KI ++WNLG +NF++EMWATHVR++A+RR+  G  
Sbjct: 2820 LIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALRRSHNGQP 2879

Query: 2922 SP--ELEVANESDKEDTVKSKFIYVPLDEPYIEMPQIKDLGDATPPLEWFGVHRKNLPAA 2979
                E E   E  ++  +  ++ YVPL+EP+IE+PQ KDLG+ATPP+EWFGV+RK  P  
Sbjct: 2880 RGFFEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGL 2939

Query: 2980 THQTAVLLIQKLVHTAEKEYAKLQQRA 3006
            THQ  ++ +QKL H AE E+A++  RA
Sbjct: 2940 THQAMIVPLQKLAHIAETEWARILGRA 2966

>Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp, 2941
            aa] {ON} ANNOTATED BY YGOB -
          Length = 2941

 Score = 1686 bits (4367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1043/3094 (33%), Positives = 1619/3094 (52%), Gaps = 247/3094 (7%)

Query: 5    SPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRCKVKI 64
            S F++V +   ++FSWVFL DWVL   V+L   FY GR+ G+ +T ILE++ WKR  VK+
Sbjct: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

Query: 65   NIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQXXXXXXXXXX 124
                       G + F+NL +I +D T S L G+I WRYWL +SRK+             
Sbjct: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSL----------- 100

Query: 125  XXGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVDD--- 181
                E +S    K PCRF + C+GLE F+YN+T +++NI+    +E++   +KF  D   
Sbjct: 101  ----ESQSEKAAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSDPSP 156

Query: 182  ----QTMTELFNESEQENKVLSESTPSSVTMETVGXXXXXXXXXXXXXXXAGRNQNDGQA 237
                +T TE  + +++ +   S S+PS+ T                       N    Q 
Sbjct: 157  RATEETSTENDSAAQKSHLETSMSSPSAST--------------------ESLNDRTYQL 196

Query: 238  PNNLENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDL 297
            PN++ +              ++R LP++ S ++ +L++GN+ T S++V S +  KG +D 
Sbjct: 197  PNSMPS--------------FLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDA 242

Query: 298  CPPKEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFL-- 355
            C P  K+DL+KIKL+ ++     S++ N+ +D+D          RL KL  K+   FL  
Sbjct: 243  CAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRV 302

Query: 356  ---LPTLGPKHLQTQEDI-TFRENWKGLSLYRQNMEEDELENVDFDFANHEYARVISILK 411
                 + G K   T++D+    E W+GL LY +  +    +   F+   HEYAR   ++K
Sbjct: 303  RKRYLSRGSKTESTRKDLRNPLERWRGLGLYWKENDPAWDDVFHFELPKHEYARYSKVMK 362

Query: 412  SAKIVFTYEYDIPGLVPKEPEETLQ---GPEVGNSGAPPEFGVDIQLYGANICYGPWAER 468
               ++  Y +D PG+VP     TL+   GP+VGN GAPP+F +DIQ++GANI YGPWA  
Sbjct: 363  CEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHH 422

Query: 469  QLSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFL 528
            ++  ++ + SPVVSR   P + L+ GS R++T  + SI IM +S WRIPTRE SKD +FL
Sbjct: 423  EIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFL 482

Query: 529  RHYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHEL 588
            + Y ET+++ RPFGW++L   + S   L+  +CPT  G  N ++ HF   EIRTSVNH++
Sbjct: 483  KRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDI 542

Query: 589  LLRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTP 648
            LL A++ D EA +GYPLGWN +A WN +L S Q  +FIL++HITL+ D+ +DF +GDPTP
Sbjct: 543  LLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTP 602

Query: 649  YELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTV 708
            Y+LFRPFIY  NW L GYS+YLNVND NIVNNP+DFNENCYLS HGD L    ++P+ ++
Sbjct: 603  YDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSI 662

Query: 709  ANRCTEITYHISTPMFRXXXXXXXXXXXXEFMKNKEVGRSYNFQVNGLYTVFSELDIDNV 768
            A   T I Y++ TP+FR            EFMK+KEVGR+ +F + G Y   S+LD++N+
Sbjct: 663  AGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENI 722

Query: 769  DTISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNA--NHTEEPKNENL 826
            DTI +EC S  TTL CYG+VVR+L+ VKMNYFGDF HF T EEY     +   EPK  + 
Sbjct: 723  DTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKANS- 781

Query: 827  GDEHSGFNISSTEDVETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGALI 886
              E S  +  +T   E +      +       M K+  LKR  NE D+WF F V +G LI
Sbjct: 782  --EQSANSTETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLI 839

Query: 887  LPETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDN 946
            LP+ +Y+ + C A  F+ L++DLR  NYYMDL A ++   ++      P  LF       
Sbjct: 840  LPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFS---GSE 896

Query: 947  GR--QEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFS 1004
            GR     + G +S L IH HRM+GLPP E TYFC+W   +  L+I+SDL     F   +S
Sbjct: 897  GRCPSRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWS 956

Query: 1005 KIGFGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDF 1064
            K+ F FK+ ENI+ Y+   + DMTS+     E++  +ND       ++  + +T   +DF
Sbjct: 957  KLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDF 1016

Query: 1065 ENEAYSQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQRE 1124
            ENE YS R D    DI+ +  ++ E  K+G  +    + L  T F Q + F  H  +Q+ 
Sbjct: 1017 ENERYSSRADV---DIHSITVQVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKS 1073

Query: 1125 YITLHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATXXXXXXXXXAETIDYIIEDCLG 1184
            +I  +D+ ++RCSFLLP   Q S  Y++LLGSI P  +          E +  I+++ L 
Sbjct: 1074 HIATNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFL- 1132

Query: 1185 EYAPTVKPDDSSSSDTSEGQRTPLTNEDTRFQANSGFFSPHMPHXXXXXXXXXXXXVLDV 1244
                  K + +S    +E   +    +   F   SG  S                 V   
Sbjct: 1133 ------KGEKNSLQMGNEHFCSKKEEDGYAFNFASGLMS----------STENDSNVESE 1176

Query: 1245 EYVNLEVKP--SVTGVLLNYLKKF----YTEDTTDIIDKNEIAIV----------KKLGN 1288
              V   +KP  S++   +   + F    Y+     +ID NEI +V          K+  N
Sbjct: 1177 SLVVKLIKPQASISACCIKPFRSFSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKN 1236

Query: 1289 LQYGASFVTTSRLHVKDLHFLYDFEEGSGVELALN--SFDFDLRRKTIENEDEKVILEK- 1345
            ++    F  T  + + +       +    V++ +   S D  +R +   N  EK  ++  
Sbjct: 1237 VKV---FSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDI 1293

Query: 1346 TMFSNIHTLRISLLEAH---PSSISMKPAALQLSIEDLELWSSTVDENVNSVNVTSFGFT 1402
            T    + +L + +       P     +      SI+DLE W ++ D   +S N TS    
Sbjct: 1294 TALVKVESLALCVSNTSRNGPLENIHEDQLCSTSIKDLEFWMTSEDIRKSSFNATSIDTW 1353

Query: 1403 LDESQLERISGYLFGQIKVLRDTITSAKELENLR-KKTQKDLICDLTSASEYYQISHDPY 1461
            +   + E    +L      + DTIT    +   R +K Q+D    +++AS+ YQI HDP 
Sbjct: 1354 VHSDKTELCCIFLKNTAANI-DTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPP 1412

Query: 1462 VITKPAFIMRLSEGHVRENRSWRIITRLRHILTYLPNDWRTADHLVTVQDSENPNVPQRD 1521
            VITKPA+I RL   HVREN+SW+IITRLRHIL YLP        +     S +   P   
Sbjct: 1413 VITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLA--EIYGALKSASFEAPTNA 1470

Query: 1522 EDIFVSVFSNWRNWDLSDITRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISG 1581
             +IF+++FS WR+W+ SD+ + Y+Y+K F  Q E          L++   S   TV  S 
Sbjct: 1471 GEIFLNIFSKWRSWESSDVEQCYMYRKAFYSQYEGQAGP---LNLRVEVDSCSATVSDST 1527

Query: 1582 YE----------VARSTIFTRTNIIVDVLPPSVNTSSENLFKQEKVITLTANMGAIKGEW 1631
            ++                  ++ ++  +L     T+++         +L+ ++ A+K   
Sbjct: 1528 HKEGDMIAVKGLKLLKKFILKSEMVGSILAIDDGTATDG-------NSLSCSLKAVKASI 1580

Query: 1632 GEEVFKL---KELFSKFSENELDDLSNLGSISRSASISGFGSQMDRLESSRASGPGDRFR 1688
             E   KL   +ELF   S+N  D LSN   +                       P  +  
Sbjct: 1581 SETAIKLLAFRELFE--SQNSQDILSNTQVL-----------------------PSGKIL 1615

Query: 1689 NLKIFATMIFERCDLHFVVGDTRLTNRIINGKNSMLLENSKENTPPALSAVFFAQRHEIW 1748
             L   A +I +RC++   +       +      S  L +++       S        E  
Sbjct: 1616 KLMELALLI-DRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFD 1674

Query: 1749 LKHSTNVLAEVLLKQLHVA---ATAQLGVIPFVSLNCQATNSFIRAMPSTVVLRNSVEKI 1805
            ++H+  ++ +   ++  +    + ++   +  V L  Q     ++   ST    N +  +
Sbjct: 1675 VRHNNAIIVDAFARRGSLGSFISQSESTTLHRVHLGSQKLR--LKVPSSTKDYCNFINSL 1732

Query: 1806 KRQVEVLIPQFK--------SHEVKNSSAVTKKTPRIPIKFDIRFNFTDMSSEIMLLSPF 1857
                  L P+ K        S E+KN S V               +  D +SEI  LSP 
Sbjct: 1733 SESWSSLAPKLKFNTRSKDLSPEMKNFSKVA-----------FEAHVDDFTSEISALSPL 1781

Query: 1858 YLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSEQFFKFSSTDLQFKCXXX-XXX 1916
             + +  K L +      N  L L    +D+ L S+++++Q+ K S + ++          
Sbjct: 1782 SISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIE 1841

Query: 1917 XXXXXXQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHIQKLWNFLRSASG--GNDRS 1974
                  Q+ ++L K  LC+PR  +  L QD   LV +  ++++L   L +     G D +
Sbjct: 1842 KVASKMQLESALTKFKLCDPREIIETLTQD---LVNAKQNLEQLKIHLLALGALFGTDST 1898

Query: 1975 PS---------RNTRWALDANLKYFGLLVPVSSICYIFELHSLFASLTNANEQYEEYDRH 2025
                       R   W LD  +KY GLLVP+ +  YI E++ L +SL+  +E  E     
Sbjct: 1899 DEEVFAGALWPREWLWQLD--MKYVGLLVPLGTTSYISEINELSSSLS-CDEAAEFSFPL 1955

Query: 2026 FSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIESSYFRLCLFPE 2085
              G++ V     L+ +  LP +LSKVL+F+ R   ++   NS++S QIES++FR+ L P 
Sbjct: 1956 VHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPF 2015

Query: 2086 LLVDILWSVHYLQSLLNHFKKHHTPWLPYSSNKTAKSGESTLD-------FRSIHILSYN 2138
             L+ IL S+ Y  + L+  +           N   KS +   D       F SI ILSY+
Sbjct: 2016 SLIRIL-SLAYEATHLSGLQA-------LKDNAGVKSSDDAKDFFNISQTFHSIQILSYD 2067

Query: 2139 FCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDTFYSQKSEK 2198
            FC+GW+F     S  GL  GY RLF+A+EK +GKLTL+D Y  +A G+TS+ FY Q  E 
Sbjct: 2068 FCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEV 2127

Query: 2199 DSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKRFNEM 2258
            D   R+ L +MQI YW +      +LFVR +GE +DV FLS S  +      S+  F E+
Sbjct: 2128 DRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQEL 2187

Query: 2259 KKAKIKQTGSSTKSKLNMEAASNTLAPFLAHIRTINSQLNFAGGVFKVYSPTELDSKAEP 2318
            K+  +         K     ++ +  P L+ I  +N ++ +AGGVFK+YS  ++  K  P
Sbjct: 2188 KRQYLDPFKPEEPVKRVPAGSAFSKLPILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGP 2247

Query: 2319 LLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIKNMIR 2378
              +++SP V +   Y    T ++ H +R   +++ +HN LF  C P++S+   +I+ +++
Sbjct: 2248 SFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLK 2307

Query: 2379 NLSSEDKSHP-SKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKVQLDAGFNSF 2437
            +L+      P +  + + I+Y+SLL   DI+F +   KQ++S SCEPKAKVQ D GF  F
Sbjct: 2308 DLNKSSVETPRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKF 2367

Query: 2438 LFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVMMFTYPN---VY 2494
              ++ T+  D +EP ++S  +  I ++ RHIFSR+ S +  ++ +  V M T+P+    Y
Sbjct: 2368 AMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTY 2427

Query: 2495 GVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAKKXXXXXXXXXX 2554
            G+A +  +++Y N+KQ Q+LN+F++IW+L ++  ++P  +                    
Sbjct: 2428 GIANIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVIGPTNLEKPLTSKYKK 2487

Query: 2555 XXXRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRTWHTFAHGIT 2614
                  FPW+F +I + + G +DLG SLGVL+L  E++W  T H  D  +T       ++
Sbjct: 2488 VISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLS 2547

Query: 2615 VNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIKSAFDYHMFLIGS 2674
            ++S+GRL G F L     +S+I WP  +     PL+ +++ ++  ++K  FDYH+ LI S
Sbjct: 2548 LSSDGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIAS 2607

Query: 2675 MKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCXXXXXXXXXXDIYNTIMRMQQDNRIS 2734
            ++ + + L N+ D   ++ +LL VSL  +S  +           D+YNTI+RM++DNR S
Sbjct: 2608 VEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKS 2667

Query: 2735 YIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLFDAEVLVVSVR 2794
            Y+ETL +SN   +  S +  E+L+SL+ LRT++SV++K + + + P +LFD EV+    R
Sbjct: 2668 YLETLGDSNTRDTKGSSSSHEILSSLSFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKAR 2727

Query: 2795 DVNARSETQSGEKLKTELQLQISDVNAXXXXXXXXXXXXTVSKIAVDDYMLYASKFSGGT 2854
            D +  S+T+  +KLKT+L+L++ +V                S+I V +Y+ +ASK  GGT
Sbjct: 2728 DFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGT 2787

Query: 2855 IIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMWATHVRSLAVR 2914
            I+  P +L+ MTTW   ++  +E L++  F  KI ++WNLG +NF++EMWATH R++A+R
Sbjct: 2788 ILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALR 2847

Query: 2915 RTQLGNSSPELEVANESDKEDTVK--SKFIYVPLDEPYIEMPQIKDLGDATPPLEWFGVH 2972
            R+  G S    E  +  DK   V    ++ Y+PL+EP+IE+PQ KDLG+ATPP+EWFGV+
Sbjct: 2848 RSHNGQSKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVN 2907

Query: 2973 RKNLPAATHQTAVLLIQKLVHTAEKEYAKLQQRA 3006
            RK  P  THQ  ++ +QKL H AE E+A++  RA
Sbjct: 2908 RKQFPGLTHQGVIVPLQKLAHLAESEWARILGRA 2941

>Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR087C
            (CSF1) -  [contig 172] PARTIAL
          Length = 2763

 Score = 1560 bits (4040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 964/2842 (33%), Positives = 1497/2842 (52%), Gaps = 180/2842 (6%)

Query: 250  QCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPPKEKLDLFKI 309
            Q  N    ++R LP++ S ++ +L++GN+ T S++V S +  KG +D C P  K+DL+KI
Sbjct: 17   QLPNSMPSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKI 76

Query: 310  KLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFL-----LPTLGPKHL 364
            KL+ ++     S++ N+ +D+D          RL KL  K+   FL       + G K  
Sbjct: 77   KLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRVRKRYLSRGSKTE 136

Query: 365  QTQEDI-TFRENWKGLSLYRQNMEEDELENVDFDFANHEYARVISILKSAKIVFTYEYDI 423
             T++D+    E W+GL LY +  +    +   F+   HEYAR   ++K   ++  Y +D 
Sbjct: 137  STRKDLRNPLERWRGLGLYWKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDT 196

Query: 424  PGLVPKEPEETLQ---GPEVGNSGAPPEFGVDIQLYGANICYGPWAERQLSYLRALLSPV 480
            PG+VP     TL+   GP+VGN GAPP+F +DIQ++GANI YGPWA  ++  ++ + SPV
Sbjct: 197  PGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPV 256

Query: 481  VSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLRHYVETKEEFRP 540
            VSR   P + L+ GS R++T  + SI IM +S WRIPTRE SKD +FL+ Y ET+++ RP
Sbjct: 257  VSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRP 316

Query: 541  FGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELLLRAKSFDFEAD 600
            FGW++L   + S   L+  +CPT  G  N ++ HF   EIRTSVNH++LL A++ D EA 
Sbjct: 317  FGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQ 376

Query: 601  MGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPYELFRPFIYRIN 660
            +GYPLGWN +A WN +L S Q  +FIL++HITL+ D+ +DF +GDPTPY+LFRPFIY  N
Sbjct: 377  IGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFN 436

Query: 661  WNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVANRCTEITYHIS 720
            W L GYS+YLNVND NIVNNP+DFNENCYLS HGD L    ++P+ ++A   T I Y++ 
Sbjct: 437  WELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLY 496

Query: 721  TPMFRXXXXXXXXXXXXEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVDTISVECSSFGT 780
            TP+FR            EFMK+KEVGR+ +F + G Y   S+LD++N+DTI +EC S  T
Sbjct: 497  TPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMT 556

Query: 781  TLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNA--NHTEEPKNENLGDEHSGFNISST 838
            TL CYG+VVR+L+ VKMNYFGDF HF T EEY     +   EPK  +   E S  +  +T
Sbjct: 557  TLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKANS---EQSANSTETT 613

Query: 839  EDVETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGALILPETIYNSDPCI 898
               E +      +       M K+  LKR  NE D+WF F V +G LILP+ +Y+ + C 
Sbjct: 614  TAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACF 673

Query: 899  ALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDNGR--QEKSHGYL 956
            A  F+ L++DLR  NYYMDL A ++   ++      P  LF       GR     + G +
Sbjct: 674  AFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFS---GSEGRCPSRANFGSI 730

Query: 957  SSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSKIGFGFKNLENI 1016
            S L IH HRM+GLPP E TYFC+W   +  L+I+SDL     F   +SK+ F FK+ ENI
Sbjct: 731  SDLHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWSKLAFSFKDYENI 790

Query: 1017 LLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFENEAYSQRVDFK 1076
            + Y+   + DMTS+     E++  +ND       ++  + +T   +DFENE YS R D  
Sbjct: 791  MNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADV- 849

Query: 1077 FPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREYITLHDSAYYRC 1136
              DI+ +  ++ E  K+G  +    + L  T F Q + F  H  +Q+ +I  +D+ ++RC
Sbjct: 850  --DIHSITVQVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRC 907

Query: 1137 SFLLPCFFQESVLYKELLGSISPSATXXXXXXXXXAETIDYIIEDCLGEYAPTVKPDDSS 1196
            SFLLP   Q S  Y++LLGSI P  +          E +  I+++ L       K + +S
Sbjct: 908  SFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFL-------KGEKNS 960

Query: 1197 SSDTSEGQRTPLTNEDTRFQANSGFFSPHMPHXXXXXXXXXXXXVLDVEYVNLEVKP--S 1254
                +E   +    +   F   SG  S                 V     V   +KP  S
Sbjct: 961  LQMGNEHFCSKKEEDGYAFNFASGLMS----------STENDSNVESESLVVKLIKPQAS 1010

Query: 1255 VTGVLLNYLKKF----YTEDTTDIIDKNEIAIV----------KKLGNLQYGASFVTTSR 1300
            ++   +   + F    Y+     +ID NEI +V          K+  N++    F  T  
Sbjct: 1011 ISACCIKPFRSFSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKNVKV---FSPTFE 1067

Query: 1301 LHVKDLHFLYDFEEGSGVELALN--SFDFDLRRKTIENEDEKVILEK-TMFSNIHTLRIS 1357
            + + +       +    V++ +   S D  +R +   N  EK  ++  T    + +L + 
Sbjct: 1068 MTLSNFGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDITALVKVESLALC 1127

Query: 1358 LLEAH---PSSISMKPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGY 1414
            +       P     +      SI+DLE W ++ D   +S N TS    +   + E    +
Sbjct: 1128 VSNTSRNGPLENIHEDQLCSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIF 1187

Query: 1415 LFGQIKVLRDTITSAKELENLR-KKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLS 1473
            L      + DTIT    +   R +K Q+D    +++AS+ YQI HDP VITKPA+I RL 
Sbjct: 1188 LKNTAANI-DTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLP 1246

Query: 1474 EGHVRENRSWRIITRLRHILTYLPNDWRTADHLVTVQDSENPNVPQRDEDIFVSVFSNWR 1533
              HVREN+SW+IITRLRHIL YLP        +     S +   P    +IF+++FS WR
Sbjct: 1247 NQHVRENKSWKIITRLRHILNYLPPSLLA--EIYGALKSASFEAPTNAGEIFLNIFSKWR 1304

Query: 1534 NWDLSDITRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYE---------- 1583
            +W+ SD+ + Y+Y+K F  Q E          L++   S   TV  S ++          
Sbjct: 1305 SWESSDVEQCYMYRKAFYSQYEGQAGP---LNLRVEVDSCSATVSDSTHKEGDMIAVKGL 1361

Query: 1584 VARSTIFTRTNIIVDVLPPSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKL---KE 1640
                    ++ ++  +L     T+++         +L+ ++ A+K    E   KL   +E
Sbjct: 1362 KLLKKFILKSEMVGSILAIDDGTATDG-------NSLSCSLKAVKASISETAIKLLAFRE 1414

Query: 1641 LFSKFSENELDDLSNLGSISRSASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFER 1700
            LF   S+N  D LSN   +                       P  +   L   A +I +R
Sbjct: 1415 LFE--SQNSQDILSNTQVL-----------------------PSGKILKLMELALLI-DR 1448

Query: 1701 CDLHFVVGDTRLTNRIINGKNSMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVL 1760
            C++   +       +      S  L +++       S        E  ++H+  ++ +  
Sbjct: 1449 CEIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNAIIVDAF 1508

Query: 1761 LKQLHVA---ATAQLGVIPFVSLNCQATNSFIRAMPSTVVLRNSVEKIKRQVEVLIPQFK 1817
             ++  +    + ++   +  V L  Q     ++   ST    N +  +      L P+ K
Sbjct: 1509 ARRGSLGSFISQSESTTLHRVHLGSQKLR--LKVPSSTKDYCNFINSLSESWSSLAPKLK 1566

Query: 1818 --------SHEVKNSSAVTKKTPRIPIKFDIRFNFTDMSSEIMLLSPFYLLQDVKQLHIY 1869
                    S E+KN S V               +  D +SEI  LSP  + +  K L + 
Sbjct: 1567 FNTRSKDLSPEMKNFSKVA-----------FEAHVDDFTSEISALSPLSISKRFKGLTVQ 1615

Query: 1870 ASGHENMELVLGFLEYDVYLKSQLSSEQFFKFSSTDLQFKCXXX-XXXXXXXXXQISTSL 1928
                 N  L L    +D+ L S+++++Q+ K S + ++                Q+ ++L
Sbjct: 1616 FEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESAL 1675

Query: 1929 MKLTLCEPRRALHNLLQDEQTLVESVDHIQKLWNFLRSASG--GNDRSPS---------R 1977
             K  LC+PR  +  L QD   LV +  ++++L   L +     G D +           R
Sbjct: 1676 TKFKLCDPREIIETLTQD---LVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPR 1732

Query: 1978 NTRWALDANLKYFGLLVPVSSICYIFELHSLFASLTNANEQYEEYDRHFSGQIVVESCYL 2037
               W LD  +KY GLLVP+ +  YI E++ L +SL+  +E  E       G++ V     
Sbjct: 1733 EWLWQLD--MKYVGLLVPLGTTSYISEINELSSSLS-CDEAAEFSFPLVHGELSVAGISF 1789

Query: 2038 LVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIESSYFRLCLFPELLVDILWSVHYL 2097
            L+ +  LP +LSKVL+F+ R   ++   NS++S QIES++FR+ L P  L+ IL S+ Y 
Sbjct: 1790 LINDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRIL-SLAYE 1848

Query: 2098 QSLLNHFKKHHTPWLPYSSNKTAKSGESTLD-------FRSIHILSYNFCVGWLFEVGDN 2150
             + L+  +           N   KS +   D       F SI ILSY+FC+GW+F     
Sbjct: 1849 ATHLSGLQA-------LKDNAGVKSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGA 1901

Query: 2151 SEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDTFYSQKSEKDSYTRTYLSNMQ 2210
            S  GL  GY RLF+A+EK +GKLTL+D Y  +A G+TS+ FY Q  E D   R+ L +MQ
Sbjct: 1902 SNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQ 1961

Query: 2211 IFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKRFNEMKKAKIKQTGSST 2270
            I YW +      +LFVR +GE +DV FLS S  +      S+  F E+K+  +       
Sbjct: 1962 ICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPFKPEE 2021

Query: 2271 KSKLNMEAASNTLAPFLAHIRTINSQLNFAGGVFKVYSPTELDSKAEPLLEIKSPGVQMA 2330
              K     ++ +  P L+ I  +N ++ +AGGVFK+YS  ++  K  P  +++SP V + 
Sbjct: 2022 PVKRVPAGSAFSKLPILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVI 2081

Query: 2331 INYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIKNMIRNLSSEDKSHP-S 2389
              Y    T ++ H +R   +++ +HN LF  C P++S+   +I+ ++++L+      P +
Sbjct: 2082 FEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVETPRT 2141

Query: 2390 KPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKVQLDAGFNSFLFRVTTDKVDSV 2449
              + + I+Y+SLL   DI+F +   KQ++S SCEPKAKVQ D GF  F  ++ T+  D +
Sbjct: 2142 SNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVL 2201

Query: 2450 EPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVMMFTYPN---VYGVALVSDMNIYC 2506
            EP ++S  +  I ++ RHIFSR+ S +  ++ +  V M T+P+    YG+A +  +++Y 
Sbjct: 2202 EPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYF 2261

Query: 2507 NMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAKKXXXXXXXXXXXXXRKVFPWSFT 2566
            N+KQ Q+LN+F++IW+L ++  ++P  +                          FPW+F 
Sbjct: 2262 NIKQLQDLNVFINIWKLDSKILSQPELDNKFVIGPTNLEKPLTSKYKKVISNSSFPWNFV 2321

Query: 2567 IIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRTWHTFAHGITVNSEGRLSGMFE 2626
            +I + + G +DLG SLGVL+L  E++W  T H  D  +T       ++++S+GRL G F 
Sbjct: 2322 VILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLSLSSDGRLGGTFL 2381

Query: 2627 LDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIKSAFDYHMFLIGSMKSVKVHLHNES 2686
            L     +S+I WP  +     PL+ +++ ++  ++K  FDYH+ LI S++ + + L N+ 
Sbjct: 2382 LQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKR 2441

Query: 2687 DTYAILPDLLQVSLEFESIVLCXXXXXXXXXXDIYNTIMRMQQDNRISYIETLKESNISA 2746
            D   ++ +LL VSL  +S  +           D+YNTI+RM++DNR SY+ETL +SN   
Sbjct: 2442 DPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRD 2501

Query: 2747 SSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLFDAEVLVVSVRDVNARSETQSGE 2806
            +  S +  E+L+SL+ LRT++SV++K + + + P +LFD EV+    RD +  S+T+  +
Sbjct: 2502 TKGSSSSHEILSSLSFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSK 2561

Query: 2807 KLKTELQLQISDVNAXXXXXXXXXXXXTVSKIAVDDYMLYASKFSGGTIIKLPQLLVSMT 2866
            KLKT+L+L++ +V                S+I V +Y+ +ASK  GGTI+  P +L+ MT
Sbjct: 2562 KLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMT 2621

Query: 2867 TWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMWATHVRSLAVRRTQLGNSSPELE 2926
            TW   ++  +E L++  F  KI ++WNLG +NF++EMWATH R++A+RR+  G S    E
Sbjct: 2622 TWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSHNGQSKSFFE 2681

Query: 2927 VANESDKEDTVK--SKFIYVPLDEPYIEMPQIKDLGDATPPLEWFGVHRKNLPAATHQTA 2984
              +  DK   V    ++ Y+PL+EP+IE+PQ KDLG+ATPP+EWFGV+RK  P  THQ  
Sbjct: 2682 DEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGV 2741

Query: 2985 VLLIQKLVHTAEKEYAKLQQRA 3006
            ++ +QKL H AE E+A++  RA
Sbjct: 2742 IVPLQKLAHLAESEWARILGRA 2763

>Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar to
            Ashbya gossypii AGR088W
          Length = 2943

 Score =  888 bits (2294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/1606 (33%), Positives = 805/1606 (50%), Gaps = 127/1606 (7%)

Query: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60
            MD ++ F+ + +   R F WVFLV+W    ++ +   FYL R  G+++T IL WV+WKR 
Sbjct: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60

Query: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQXXXXXX 120
            KV INI+SL  + +GG + F+N+ I  RD TIS L+GT  WRYWL N R +Q +      
Sbjct: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLKNSNI-- 118

Query: 121  XXXXXXGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVD 180
                         +     CRF L C+G+E+F+YNK + YE+I++  +K ++    KF  
Sbjct: 119  -------------NDENSKCRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFAT 165

Query: 181  DQTMTELFNESEQENKVLSESTPSSVTMETVGXXXXXXXXXXXXXXXAGRNQNDGQAPNN 240
            D     +F   + ++ V+ +    S     VG                    N    P  
Sbjct: 166  DDE--SIFGRVKTDSSVMFDPLDESSEQSKVGQTILNSV------------SNQSAVP-- 209

Query: 241  LENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPP 300
                            +Y+ FLP ++     ++V+GN+ TPS+ ++     +GIID+  P
Sbjct: 210  ----------------LYLDFLPAEVILSSGAVVVGNKHTPSVAIIQYARIEGIIDVAGP 253

Query: 301  KEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFLLP--- 357
               LD +K++ E EL     SVK NI F +  S+      G+   LWQK     L     
Sbjct: 254  TSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSSKKHKIDGKPFNLWQKLKDCLLFTISH 313

Query: 358  ----TLGPKHLQTQEDITFRENWKGLSLYRQNMEEDELENVDFDFANHEYARVISILKSA 413
                T   K L  QE+  F  +WKGL++Y     +   + + FD  NHEYA+  +IL + 
Sbjct: 314  ILAFTGNKKGLTGQEE--FLTSWKGLAMYDVATSDTFSDEIPFDLQNHEYAKYTTILNAD 371

Query: 414  KIVFTYEYDIPGLVPKEPEETLQGPEVGNSGAPPEFGVDIQLYGANICYGPWAERQLSYL 473
            +I   Y YD PG++    E  ++G E G+    PE+ +D+QLY AN  YGPWA RQL Y 
Sbjct: 372  RIKLLYSYDTPGVIT---ETLIKGYENGDIPPSPEYSIDVQLYDANFYYGPWAHRQLQYF 428

Query: 474  RALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLRHYVE 533
              + SP VSR     +    G  R +  F+  I IME+S WRIPT+E SKD  FL  Y  
Sbjct: 429  IKMFSPAVSRDFSAHRKPVLGKSREHANFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKS 488

Query: 534  TKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELLLRAK 593
            T +E R FGWID+K  KD+   ++  +  +E G  N  + +  N  I TSVNH++L  AK
Sbjct: 489  TNDESRAFGWIDIKLNKDTNISIELGLQASECGFENTFHANLVNPVIITSVNHDVLFNAK 548

Query: 594  SFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPYELFR 653
            +    A   YP  WN    W ++  S+ LE+FILR+H  L+ D+F DF+SGD  PYELFR
Sbjct: 549  AHQIIARQSYPHQWNSAITWALHFISSDLELFILRDHFNLLVDLFTDFASGDAVPYELFR 608

Query: 654  PFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVANRCT 713
            P +Y+ +W++  YS+YLN ND NIVNNPLDFNENCY+S+HG+     VK+P +T++    
Sbjct: 609  PVLYQFSWDISNYSLYLNANDANIVNNPLDFNENCYISIHGNSARIGVKLPIETISEESI 668

Query: 714  EITYHISTPMFRXXXXXXXXXXXXEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVDTISV 773
             I+Y I TP F             EFM  + VGRS+ F  +G Y  ++++DIDNVDTI++
Sbjct: 669  TISYEIYTPKFDIQLKTPPWHTLHEFMAQRFVGRSHEFSASGSYLSYNDVDIDNVDTINL 728

Query: 774  ECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNA-----NHTEEPKNENLGD 828
            EC +   T   YGF++RY+MN+K+NYFG+F+ F T EEY+       +   +  N N  D
Sbjct: 729  ECKTNHATFLAYGFLLRYVMNLKLNYFGEFAQFRTTEEYSEELAQRNDVATDIFNNNDDD 788

Query: 829  EHSGFNISSTEDVETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGALILP 888
            +       +TE VE +     G     G  + K S LKRT NE DIW  F   +G  +LP
Sbjct: 789  Q-------TTELVEPNSYGESGFDILHGKKIDKAS-LKRTVNEKDIWVTFFFEDGCFVLP 840

Query: 889  ETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDNGR 948
            E+ Y+   C  LHF+ +  D+R  +YY DL  +MN+T +KRY     + +F+    +   
Sbjct: 841  ESFYDFKSCFGLHFDNITFDMRYLSYYADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFI 900

Query: 949  QEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSKIGF 1008
                 GYLS   IH HRM+GLPP E TY  +  V +  L   SD+E  KGF+   +K  F
Sbjct: 901  TSNYDGYLSEFNIHIHRMFGLPPAEETYLFKIDVSLGYLSFESDIEALKGFIQFITKFSF 960

Query: 1009 GFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFENEA 1068
            GF N E++L YE    FD++ ++    ++   +N+ DT+    L    ++   +DF    
Sbjct: 961  GFDNFEDVLHYEMARSFDISCLSFFADDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSK 1020

Query: 1069 YSQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREYITL 1128
            YS R +   P+ +FL+  +D++      L  + T ++F  F +N  F      Q ++I L
Sbjct: 1021 YSLRANIDIPNFDFLVSSMDDHNI---VLGTISTSISFAIFSRNPDFKTTNNLQTQHILL 1077

Query: 1129 HDSAYYRCSFLLPCFFQESVLYKELLGSISPSATXXXXXXXXXAETIDYIIEDCLGEYAP 1188
             D+ + RCSFL P  +Q S LYK L  SI PS++             D I E+ LG    
Sbjct: 1078 SDAPFCRCSFLHPQEYQTSDLYKLLYASIPPSSSIPLLPEPIGPNNFDTIFENLLG---- 1133

Query: 1189 TVKPDDSSSSDTSEGQRTPLTNEDTRFQANSGFFSPHMPHXXXXXXXXXXXX-------- 1240
                 D      SEG  T   + DT+ Q N   F  H  +                    
Sbjct: 1134 -----DIYQDYISEG--TFDISNDTKLQLNIDEFKKHSENSFSKHKTKNLTIDIVDELHE 1186

Query: 1241 ----VLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFV 1296
                V ++ ++N+++   V  V  +  ++  T   +D ID   + IV       +GAS V
Sbjct: 1187 VRSFVFELPHINIDIHIDVLEVFADLYRQLTTFTISDTIDGLGVDIVNNFSKTFFGASSV 1246

Query: 1297 TTSRLHVKDLHFLYDFEEGSGVELA-------LNSFDFDLRRKT----------IENEDE 1339
            T +++    + F     E   +E         +N  D +LR +           + ++++
Sbjct: 1247 TEAKVVCPRIDFRLRMYEYYALEDVKHYFVSDINKLDLNLRLRQEYDKESANSEMNSKNK 1306

Query: 1340 KVILEKTMFSNIHTLRIS--LLEAHPSSISMKPAALQLSIEDLELWSSTVDENVNSVNVT 1397
              +  KT   N   L     +  +  S  S K      + E+LE ++   D+ V   N+ 
Sbjct: 1307 LSVYYKTALINGKMLSKENFIYPSESSEFSYKS-----TFEELEGYAFYDDDLVTDANLQ 1361

Query: 1398 SFGFTLDESQLERISGYLFGQIKVLRDTITSAKELENLRKKTQKDLICDLTSASEYYQIS 1457
                 +++   + IS ++          I S    +N  K  +++L+  +  A + Y I 
Sbjct: 1362 RGCVFINQEHSDSISEFIKTLYLKFNTFIKSVTISKNFNKSMKRELLIRIAQAGQDYGIQ 1421

Query: 1458 HDPYVITKPAFIMRLSEGHVRENRSWRIITRLRHILTYLPNDWRTADHLVTVQDSENPNV 1517
            HDP VITKPA I RLS  HVRE+RSWRI+TRLRH+L YLP  W       +++  +    
Sbjct: 1422 HDPPVITKPAVITRLSRHHVRESRSWRIVTRLRHVLNYLPQYWYET---TSLELQKGKFR 1478

Query: 1518 PQRDEDI-FVSVFSNWRNWDLSDITRSYIYKKIFLPQNEDSFKKEL 1562
             + D  + F+ +F+ WR+W+ +D+ R ++YKK ++P  E +F K +
Sbjct: 1479 SEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTYIPA-EVTFAKTI 1523

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/1183 (33%), Positives = 633/1183 (53%), Gaps = 33/1183 (2%)

Query: 1840 IRFNFTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSEQFF 1899
            ++ N   ++ ++ LL PF L    K+  I       ++  L   +  V L S    E + 
Sbjct: 1770 VKMNIAAINIQLQLLLPFILRYSCKEFEINVDFGRILQSSLSLQDTSVELLSLEFQEPYM 1829

Query: 1900 KFSSTDLQFKCXXXXXXXXXXXXQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHIQK 1959
            K+S + L+                + +S  KL++ EP++ +   L D +  V++++ ++ 
Sbjct: 1830 KYSHSYLKLIGMDLGNTDNLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRS 1889

Query: 1960 LWNFLRSASGGNDRSPSRNTRWALDANLKYFGLLVPVSSICYIFELHSLFASLTNANEQY 2019
                 +S++  N+   SR     L+ N++Y GLL+   +  Y+ E ++L  S +      
Sbjct: 1890 TMLETKSSTVQNEFPFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSS 1949

Query: 2020 EEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIESSYFR 2079
                  FS     ES   L+K+  +   LSKVLDFS+R    +    ++QS QIESSY  
Sbjct: 1950 NPVVPTFSSDYSSESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLH 2009

Query: 2080 LCLFPELLVDILWSVHYLQSLLNHF---KKHHTPWLPYSSNKTAKSGESTLDFRSIHILS 2136
              L P  LV +L       S +N F   K  +    P S++  +      +  +S HILS
Sbjct: 2010 AVLSPMSLVRLL-------SFVNEFSIMKSIYHDIKPRSTSSNSTLSILPISIKSAHILS 2062

Query: 2137 YNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDTFYSQKS 2196
            YN C+GWLF++G N+  GLI GY+RLF+ Y+K +GKLTL+D Y SVA+G +S T+Y   +
Sbjct: 2063 YNLCIGWLFDLGYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGN 2122

Query: 2197 EKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKRFN 2256
            EK +  R+YL +MQI YWL+ EN  KDLF+R +GE +DV  L+  F +V++   S+ +F 
Sbjct: 2123 EKGAMNRSYLPSMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFK 2182

Query: 2257 EMKKAKIKQTGSSTKSKLNMEAASNTL-APFLAHIRTINSQLNFAGGVFKVYSPTELDSK 2315
            ++K+  +     ++   +  E   N L  P  + +R+IN  +N+AG   K+YS  ++   
Sbjct: 2183 KLKETILDPLKVTSNDPILGEW--NYLDNPLASSVRSINCIINYAGSSMKLYSRDDI-QH 2239

Query: 2316 AEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIKN 2375
                 EI+SP   + I+Y++  +++KSH IR   T+  THN LF  C PLL++       
Sbjct: 2240 GTCSFEIRSPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNT 2299

Query: 2376 MIRNLSSE-DKSHPSKPVTDS-IDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKVQLDAG 2433
            M++N  S+     P+     + I+Y+ LL  +DIA  I  GKQ++S +CEP AK+Q   G
Sbjct: 2300 MLKNSCSQFSNGAPNLASAKAEINYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIG 2359

Query: 2434 FNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVMMFT---Y 2490
            F  F  ++ T+ +   EP  +S  +  + +S RH+FSR+ S++  L  I +V   T   Y
Sbjct: 2360 FEKFDIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREISSSLSLQQISMVFSLTHSEY 2419

Query: 2491 PNVYGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAKKXXXXXX 2550
             + YG  L+S    Y N+KQ ++LN+FL+IW +  + ++      A   + + +      
Sbjct: 2420 IHTYGSTLISKPLFYFNVKQIEDLNLFLEIWSIE-KQKSVNDIILAPVTASSFESVPSMP 2478

Query: 2551 XXXXXXXRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRTWHTFA 2610
                      F W + +I + +G  +DLGPSLG++ +  + +W  + H  D  +      
Sbjct: 2479 KLQRVPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISM 2538

Query: 2611 HGITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIKSAFDYHMF 2670
              I ++S GRL G   +      S+I+WP  +     PL+ +S+A+   + K +FDYHMF
Sbjct: 2539 KEICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHMF 2598

Query: 2671 LIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCXXXXXXXXXXDIYNTIMRMQQD 2730
             I ++++  + L N+ D    L DLL VS+  ++I +           DIY+TI RM+ D
Sbjct: 2599 FISTIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRND 2658

Query: 2731 NRISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLFDAEVLV 2790
            +  + ++ L ESN     +S    ++L SL  LRT++SV  + L +HI   +L   EV+V
Sbjct: 2659 SGRTNLDLL-ESNELKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVV 2717

Query: 2791 VSVRDV------NARSETQSGEKLKTELQLQISDVNAXXXXXXXXXXXXTVSKIAVDDYM 2844
            +  R V       A S+T S  K++TEL  Q+ D++              + KI V DY+
Sbjct: 2718 LRTRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYV 2777

Query: 2845 LYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMW 2904
              AS   GG I++ P + V+M TWQ Q S V+E L++  F + +S+ WNL P+NFIK+MW
Sbjct: 2778 KLASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDMW 2837

Query: 2905 ATHVRSLAVRRTQLGNSSPELEVANESDKEDTVK-----SKFIYVPLDEPYIEMPQIKDL 2959
            + H+ ++ +R  Q GNSS E+ +  + D E  +      +K+IY PL+EP IEMP+IKDL
Sbjct: 2838 SIHINAMKLRHMQKGNSS-EIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDL 2896

Query: 2960 GDATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKL 3002
            GDATPP+EWFG++R   P  THQ  V+ +QKL   AEKEY ++
Sbjct: 2897 GDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRI 2939

>KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087C CSF1 Protein required for fermentation at low
            temperature
          Length = 2923

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/1596 (31%), Positives = 786/1596 (49%), Gaps = 131/1596 (8%)

Query: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60
            MD  S F+ +S+   ++ S  FLVDW+L  I+ +   FYLGRI  ++LT  L++ VW++ 
Sbjct: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60

Query: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQXXXXXX 120
            K+KIN++S++++ LGG I F+NL ++  D+TIS LEG+  WRYWL ++R           
Sbjct: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTR----------I 110

Query: 121  XXXXXXGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVD 180
                   ++  ++   K PCRFLL C+GLE+FVYNK   YE+++       R  F     
Sbjct: 111  RGIDFESEDGDASENAKLPCRFLLQCDGLEVFVYNKIDVYESVL-------RDHFTNVTK 163

Query: 181  DQTMTELFNESEQENKVLSESTPSSVTMETVGXXXXXXXXXXXXXXXAGRNQNDGQAPNN 240
            D   T    ES  +  + +E   ++  +                            AP  
Sbjct: 164  DGQET----ESNDDITINTEKAAANSKLSNS------------SRYSYSGRSKSTDAP-- 205

Query: 241  LENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPP 300
                         + S   +  PIQ+   R ++VLGNR T  + V   + +KG+ D+   
Sbjct: 206  -------------KLSAKTKLFPIQLEANRAAIVLGNRNTRHVGVFKFEQAKGVYDIFSS 252

Query: 301  KEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFAR------IF 354
               LD ++ K+  +LYD    ++ N+G+ +D           + K+WQ   +        
Sbjct: 253  ISDLDYYRTKISLDLYDALFELRTNLGYQNDNPIKTFVVEKTMDKIWQTVKKQCISISKL 312

Query: 355  LLPTLGPKHLQTQEDITFRENWKGLSLYRQNMEEDELENVDFDFAN-HEYARVISILKSA 413
            LLP  G K +  Q+   + ++WKGL LY       E ENVD    +  EYAR   ++K+ 
Sbjct: 313  LLPNQG-KTINNQQ--AYIDSWKGLDLYHHTKAVQE-ENVDTTVLHEQEYARYSRVMKAE 368

Query: 414  KIVFTYEYDIPGLVP---------KEPEETLQGPEVGNSGAPPEFGVDIQLYGANICYGP 464
            ++  TY +DIPG+VP          + +E+L   +  ++   P FG DI +Y A + YGP
Sbjct: 369  RVSLTYYFDIPGIVPANSSSINSQSDRDESLNCNQDDDT---PAFGTDIHIYTAAVYYGP 425

Query: 465  WAERQLSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKD 524
            WA + +  +  L SP+VSR         PGS RIY  FK S+   ++S   IPTRE SKD
Sbjct: 426  WAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIYENFKLSVDFRDKSVLHIPTRESSKD 485

Query: 525  QEFLRHYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSV 584
            +EF++ Y  T +  R FGW+++   +    + +  +C   +  PN +     N EI++SV
Sbjct: 486  EEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLALCSQADRLPNELYVLLLNPEIKSSV 545

Query: 585  NHELLLRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSG 644
            NHE+L R  +   +A++GYP GWN QA+W   L S   E+F+LR+HI+LISD+F DFS+ 
Sbjct: 546  NHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDSRTAELFLLRDHISLISDLFTDFSAN 605

Query: 645  DPTPYELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIP 704
            D   YELFRPF Y I W    Y ++LNVND NI+NN LD NENC+LSL GD L   + +P
Sbjct: 606  DALRYELFRPFTYEIKWVFTEYKLFLNVNDANIINNLLDLNENCFLSLSGDILNTSINLP 665

Query: 705  RQTVANRCTEITYHISTPMFRXXXXXXXXXXXXEFMKNKEVGRSYNFQVNGLYTVFSELD 764
              ++     E T+ + +P+ +            EF+     G   +F + G Y  F  +D
Sbjct: 666  FTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEFLSETTFGECPDFSMTGTYISFPSVD 725

Query: 765  IDNVDTISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNE 824
            +DN DTI ++  S  T    +GFV+RYLMN+K+NYFGDF+HF T EEY+N    E    E
Sbjct: 726  VDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNYFGDFNHFKTTEEYSNDLSME----E 781

Query: 825  NLGDEHSGFNISSTEDVETDRTNPEGRPANKGIPMPK----RSELKRTENEMDIWFVFSV 880
            +   +   F    T DVE+  ++           + +    +S L RT+NE D+W  F V
Sbjct: 782  DTKTKTKNFQEQPTNDVESLTSSSSDGSYQVADTINENTIHKSSLLRTKNETDVWITFFV 841

Query: 881  WEGALILPETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFE 940
             +G +I+PE +Y+      L F  LE D+R TNY+MDL A  +    + Y++      F 
Sbjct: 842  NDGCIIIPENLYDCQRSFLLSFRRLEFDMRYTNYFMDLTAFFS----RIYLNHSNEFSFN 897

Query: 941  CVRKDNGRQEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFL 1000
             V        ++ GYL  L +HGHRM+G+PP E TY C+W + I  L  +SD +F   FL
Sbjct: 898  RVVAIEESHSENTGYLDDLNLHGHRMFGVPPVEETYLCKWDISIGSLSTDSDGQFLFSFL 957

Query: 1001 TCFSKIGFGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFT 1060
                K+GF +K+ ENIL+Y  +   D+TS+T+ +  +  ++   +    + L    IT  
Sbjct: 958  EAIQKVGFTYKDAENILIYSIHKPEDVTSLTISIGRVSSIVR-TNHGGSATLSLNDITIN 1016

Query: 1061 AIDFENEAYSQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRY 1120
            + D  N  YS+RVD     I+  +  +DE +     L    T +  T F+      +HR 
Sbjct: 1017 SWDLSNSRYSKRVDLLVAAIS--VCAIDEKKT---VLFTCDTAVELTKFVVRSNMKNHRV 1071

Query: 1121 RQREYITLHDSAYYRCSFLLPCFFQ--ESVLYKELLGSISPSATXXXXXXXXXAETIDYI 1178
             Q+  + L+DS ++RC FLL  F Q   S LY +LLGSI+PS +          +T D I
Sbjct: 1072 TQQNCVLLNDSPFHRCKFLL-AFDQLNHSTLYDDLLGSITPSISLPTLSEPLTFQTFDNI 1130

Query: 1179 IEDCLGEYAPTVKPDDSSSSDTSEGQRTPLTNEDTRFQANSGFFSPHMPHXXXXXXXXXX 1238
             E  LG Y   +  D       +     P   +D R    S   S  +            
Sbjct: 1131 YERLLGSYINLINFDTDIIDTKNLTDDRP---DDKRLLPLSNTVSNDLSGQLAEEFESEN 1187

Query: 1239 XXVLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVK--KLGNLQYGASF- 1295
              V ++  +++ V P       N      T  T  I+D  E+ IV    +G++  G  F 
Sbjct: 1188 TTV-NISTLSVFVTPKAFTFAENAAHFMLTMSTESIMDYFEMNIVNIFSVGHITNGKFFN 1246

Query: 1296 ----VTTSRLHVKDLHFLYDFEEGSGVELALNSFDFDLRRKTIE--------NEDEKVIL 1343
                +   ++++ D   L   +  +   L L+  +  +  K ++        NE   +  
Sbjct: 1247 SSVMLKNVKVNISDETALDKTQLEALDRLELSVSNISVISKILKYPQNLEQSNESTGITD 1306

Query: 1344 EKTMFSNIHTLRISLLEAHPSSISMKPAALQLSIEDLELWSSTVDENVNSVNVTSFG--- 1400
            + T+  N  +L+ ++ ++  + ++     L ++  ++ ++++ +  +V  V+   FG   
Sbjct: 1307 DSTISCNFDSLQFNIFKSSKNRLT---KVLPIAWFEILMFNTVLFSDVGKVSKLIFGSIK 1363

Query: 1401 FTLDESQLERISGYLFGQIKVLRDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDP 1460
              + ++ +E    YL    K       S  EL  LR    K+ I  +    +   I   P
Sbjct: 1364 SAILDADVEWTVEYLLKLAKAFCKEGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVP 1423

Query: 1461 YVITKPAFIMRLSEGHVRENRSWRIITRLRHILTYLPNDWRTADHLVTVQDSENPNVPQ- 1519
            Y+ITKPA+I RLS+ HVR+  SW+IITRLRH+  +  +        V+   S+  ++P+ 
Sbjct: 1424 YIITKPAYITRLSKFHVRDTASWKIITRLRHVSKHTSH--------VSETTSQCDDIPEE 1475

Query: 1520 -----RDEDIFVSVFSNWRNWDLSDITRSYIYKKIF 1550
                 +D+  F+ +F +W+NWD+ ++ +S ++  +F
Sbjct: 1476 VRNICKDKSQFLDIFVDWKNWDVYEVEQSSLFTLLF 1511

 Score =  619 bits (1595), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 368/1098 (33%), Positives = 597/1098 (54%), Gaps = 45/1098 (4%)

Query: 1924 ISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHIQKLWNFLRSASGGNDRSPSRNTRWAL 1983
            + T ++KLTL + R  +  L     +L  +V  + K++   ++ +  N+ +  +    + 
Sbjct: 1842 LDTDIVKLTLSDNRVYIEEL---TDSLNGTVSELIKIF---KNKNADNEPAAPKFKPCSF 1895

Query: 1984 DANLKYFGLLVPVSSICYIFELHSLFASLTNANEQYEEY---DRHFSGQIVVESCYLLVK 2040
              N  Y GLL  + +  Y+ E +    S  +  E  EE    D      +V+++  +LV 
Sbjct: 1896 KMNAIYIGLLTDLKTTNYVLEFNETAFSCASRAEALEETHANDNLREMSLVIQNVCILVL 1955

Query: 2041 ELSLPANLSKVLDFSIRF-LTSQKVPNSLQSYQIESSYFRLCLFPELLVDILWSVHYLQS 2099
               +   LSK+ D      L    +  +LQ   IE+ + R+ L P  L+ +++ +   + 
Sbjct: 1956 NPEVLPTLSKIFDIGFALKLIEDDIKKTLQ---IETPHSRVMLAPSTLIAVIFFIQEAKV 2012

Query: 2100 LLNHFKKHHTPWLPYSSNKTAKSGESTLDFRSIHILSYNFCVGWLFEVGDNSEPGLILGY 2159
             L   K+       ++S+  A       +  S++ILS   C+GW+FE  D  E G+++GY
Sbjct: 2013 SLQKVKQKG----KFNSSSNAIEIPPYFETLSVNILSNKLCLGWIFE-EDTDENGIVIGY 2067

Query: 2160 DRLFSAYEKHFGKLTLIDGYLSVANGNTSDTFYSQKSEKDSYTRTYLSNMQIFYWLKGEN 2219
            + LF+AYEK +GKLT++DGY++ A G  S+ F+      +   R++LS+MQI +W  G+ 
Sbjct: 2068 ESLFAAYEKPYGKLTIVDGYVATAQGKESNNFFFANGVPE-LNRSHLSSMQINFWFSGQF 2126

Query: 2220 LLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKRFNEMKKAKIKQTGSSTKSKLNMEAA 2279
            + KDLFVR + + +DVR L+TS ++V     SI+ F + K AKI     S+ S  N+   
Sbjct: 2127 IEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIESF-QKKLAKISNIKKSSISTHNVAEN 2185

Query: 2280 SNTLAPFLAHIRTINSQLNFAGGVFKVYSPTELDSKA-EPLLEIKSPGVQMAINYEFNET 2338
             +     L+ IR+IN    + GG+  +Y+P ++   + +  LE+ SP ++++++Y  N  
Sbjct: 2186 LSDKVSILS-IRSINCIAKYGGGIINLYTPDDIAQDSPKSSLELTSPSIEVSLDYMHNFP 2244

Query: 2339 REKSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIKNMIRNLSSEDKS--HPSKPVTD-- 2394
             +K H IR    +E THN+LF+ C P+L +    I+  +   +SE K   H ++  T   
Sbjct: 2245 SQKQHWIRSLVNVESTHNILFSSCVPVLVNLTTEIQKQMERFNSEKKQLVHKTQEQTTNT 2304

Query: 2395 ---SIDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKVQLDAGFNSFLFRVTTDKVDSVEP 2451
               S DYK+L    D A  I  G Q ++ +CEP+AK+Q D GF++F   + TD  D  EP
Sbjct: 2305 QRISFDYKNLFKKIDTAIVINVGAQNITLTCEPRAKIQADLGFSNFRISMFTDSPDHSEP 2364

Query: 2452 FNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVMMFTYPNV---YGVALVSDMNIYCNM 2508
             ++S    +IE S RHIFSR+ S++  ++ + +  M T+ N    YG  L+SDM  Y NM
Sbjct: 2365 LSLSLQWSEIEISTRHIFSREISSSAGINEVYLDFMLTHENTIKTYGNTLISDMKFYVNM 2424

Query: 2509 KQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAKKXXXXXXXXXXXXXRKVFPWSFTII 2568
            KQ Q + +FLDIW      +TK ++         +K                 PW + II
Sbjct: 2425 KQLQEITLFLDIWS----PKTKKAQKLGSGPHSGQKCQPQALTEFTTPK---IPWIYQII 2477

Query: 2569 FTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRTWHTFAHGITVNSEGRLSGMFELD 2628
            F N   V+D+ PSLG +   +   WI++ H+ D   +   +   +   S+GRL G+FE+ 
Sbjct: 2478 FKNTSAVIDMDPSLGSINFKVPTFWISSHHRVDWSHSVSFYLDELNSKSDGRLGGLFEIK 2537

Query: 2629 QASSVSEISWPEEDLLRVGPLISVSMAINRMSIKSAFDYHMFLIGSMKSVKVHLHNESDT 2688
                 S ISWP +D     PLI+++  ++ +S K  FDYH FLI  +  +++ + NE D 
Sbjct: 2538 NIFFDSSISWPVKDNKFEAPLINLAFKMSHLSSKIGFDYHSFLIARVSDLQLAIRNERDE 2597

Query: 2689 YAILPDLLQVSLEFESIVLCXXXXXXXXXXDIYNTIMRMQQDNRISYIETLKESNI-SAS 2747
              +L DLL VS+ F S+ +           DIY T  RM+ +N+ SY++TLKESN  S+ 
Sbjct: 2598 SGLLKDLLIVSMSFGSVNIFLTALASANLYDIYATFARMRIENKKSYVQTLKESNPESSG 2657

Query: 2748 STSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLFDAEVLVVSVRDVNARSETQSGEK 2807
                +  E+L  L  LRT+++  +   ++++ P +LFD+EVLV+    +N  + TQ+ +K
Sbjct: 2658 KIHFSNNELLAPLR-LRTNLTAEIGSFRLYVFPSTLFDSEVLVLKANKMNVEAATQTEQK 2716

Query: 2808 LKTELQLQISDVNAXXXXXXXXXXXXTVSKIAVDDYMLYASKFSGGTIIKLPQLLVSMTT 2867
             KT+L  QI D+N               ++++V++Y   A+   G  I+  P + V +TT
Sbjct: 2717 TKTDLTWQIRDINISLAQFKNELTEEQFAELSVEEYNRQAALLEGDIILAAPSVFVGITT 2776

Query: 2868 WQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMWATHVRSLAVRR--TQLGNSSPEL 2925
            WQ+     +E+L++  F DK+ +KWNL P+NFI+EMWATHVR+L+VRR  T+   S P  
Sbjct: 2777 WQKIPDTDIEFLYSSSFGDKVDIKWNLDPINFIREMWATHVRALSVRRGHTEPSPSKPFF 2836

Query: 2926 EVANESDKEDTVK--SKFIYVPLDEPYIEMPQIKDLGDATPPLEWFGVHRKNLPAATHQT 2983
            E  N ++K   V   +K+ Y+PL+EP+IEMP ++DLG+ATPP+EWFGV+RK  P   HQ 
Sbjct: 2837 EDENIAEKIKIVNLGTKYKYIPLEEPHIEMPLLRDLGNATPPIEWFGVNRKRFPGMAHQL 2896

Query: 2984 AVLLIQKLVHTAEKEYAK 3001
             V+ +QKL++ AE +Y +
Sbjct: 2897 IVVPLQKLIYVAEDQYNR 2914

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/1558 (31%), Positives = 766/1558 (49%), Gaps = 145/1558 (9%)

Query: 36   VIFYLGRIFGFLLTFILEWVVWKRCKVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCL 95
             IFY+GR+ G++++     V+WK+ +V ++I+SL  +PL G + F+N+ +  +D  IS L
Sbjct: 5    AIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLISVL 64

Query: 96   EGTINWRYWLFNSRKSQYQXXXXXXXXXXXXGQEPKSNSGRKHPCRFLLACEGLEIFVYN 155
            +GTI WRYWL    +                 +   ++  R+  CRF L  EG E FVYN
Sbjct: 65   KGTITWRYWLIGRYR-----------------RSGTADGARR--CRFALKFEGFEYFVYN 105

Query: 156  KTSSYENIIHMFSKEERAQFEKFVDDQTMTELFNESEQENKVLSESTPSSVTMETVGXXX 215
            +   Y                    D+   EL  E       +S  +   V  E      
Sbjct: 106  RNGVY--------------------DRIARELDGEDTSAEPTVSVPSVEEVIAE------ 139

Query: 216  XXXXXXXXXXXXAGRNQNDGQAPNNLENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVL 275
                                     L++D L             RFLP++    + ++VL
Sbjct: 140  -------------------------LQDDPLIR-----------RFLPVEFLHNKGAIVL 163

Query: 276  GNRFTPSILVVSAKNSKGIIDLCPPKEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTS 335
            GN+ T S+ +++ +   G + +  P +       + E ++ +   ++K NI ++ D    
Sbjct: 164  GNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEAKISNCTVAIKPNISYEVDNPVK 223

Query: 336  FKWTRGRLSKLWQKFARIF---LLPTLGPKHLQTQEDI-TFRENWKGLSLYRQNMEEDEL 391
                  R ++LW+K+  +    L  TL  K  + Q     + +NW+GLS+Y  N++E+  
Sbjct: 224  IYVEPKRTARLWKKYKTLLGTVLEATLHAKRKKEQHQTPKWYDNWRGLSMYDVNLDEELD 283

Query: 392  ENVDFDFANHEYARVISILKSAKIVFTYEYDIPGLVPKEPEETLQGPEVGNSGAPPEF-- 449
            E V FD  +HEYA+  ++LK+ ++  TY Y +PG       +  + P +      PE   
Sbjct: 284  EEVKFDIEHHEYAKCTTVLKADQMDVTYSYGMPGTARVTDSDNAENPLLER----PELDH 339

Query: 450  GVDIQLYGANICYGPWAERQLSYLRALLSPVVSR-----TPKPIKTLTPGSQRIYTIFKT 504
             VDI +Y AN  YGPWA RQ+     + SP V R     TP+ I   T  +      FK 
Sbjct: 340  SVDILVYDANCTYGPWANRQVQQCLRVFSPTVCRNFKLRTPEEIAQQTEPAA-----FKL 394

Query: 505  SISIMEESTWRIPTREKSKDQEFLRHYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTE 564
            S++IME+S  R+P +E SKD  FL  Y +T++E RPFGWID++  K+S   +     PTE
Sbjct: 395  SVTIMEDSVLRVPMKESSKDAAFLEKYKQTRDETRPFGWIDIRIAKESNITVRMAAYPTE 454

Query: 565  EGSPNNVNFHFSNMEIRTSVNHELLLRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEI 624
             G  N ++ +  +  I TSVNH+ LL+AKS D   D  YP GW D+A WN N+ STQ E+
Sbjct: 455  NGFENILHANLVDTTISTSVNHDTLLKAKSHDITVDFSYPYGWQDKAEWNFNVCSTQAEL 514

Query: 625  FILREHITLISDVFADFSSGDPTPYELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDF 684
            F+LR+H+ LISD+  DFS G+   YE FRPF YR  W++ GYS YLNVND NI+NNP+DF
Sbjct: 515  FVLRDHVYLISDLVTDFSGGEEVLYEQFRPFDYRFRWDIRGYSAYLNVNDANIINNPIDF 574

Query: 685  NENCYLSLHGDHLIFDVKIPRQTVANRCTEITYHISTPMFRXXXXXXXXXXXXEFMKNKE 744
             ENCYLS+HGD       +P  ++  +   + ++I TP F             E +  KE
Sbjct: 575  GENCYLSVHGDDAEITFSLPITSIIQKYVTVDFNIFTPHFSLFLNAPPWHTFSELLHYKE 634

Query: 745  VGRSYNFQVNGLYTVFSELDIDNVDTISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFS 804
            +GRS NF + G YT +SE+D+DNVD +++ C +    + CYG +++ ++NVK+NYFG+  
Sbjct: 635  IGRSKNFNIKGSYTSYSEVDVDNVDALNIACETDYIVVLCYGVILKCMLNVKVNYFGEMV 694

Query: 805  HFVTAEEYTNANHTEEPKNENLGDE-HSGFNISSTEDVETDRTN--PEGRPANKGIPMPK 861
            HF T EEY         +N +     +S  N+  ++ V T+          A  G P  K
Sbjct: 695  HFRTTEEYVEELQRRNKQNPSTCRPFNSDGNVHDSDVVATESNEIIDASFDAFGGPPTIK 754

Query: 862  RSELKRTENEMDIWFVFSVWEGALILPETIYNSDPCIALHFNELEVDLRSTNYYMDLLAT 921
            +S LKR+ NE+D+WF F    G    PE IY  D C+  +F+ LE  LR  NYY+D   +
Sbjct: 755  KSALKRSINELDVWFTFISKGGCFFFPENIYKFDACLGFYFDNLEASLRFLNYYVDAAVS 814

Query: 922  MNNTELKRYVSRHPHDLFECVRKDNGRQEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWG 981
            +++   KR+       LF+ +       + S  YLS  +   H+M G+ P+E +Y C++ 
Sbjct: 815  LDSIYFKRHTDIDARTLFKVIEDIGIPIDASDAYLSQFSFRLHKMLGIMPSEESYACEFD 874

Query: 982  VDIDRLEINSDLEFAKGFLTCFSKIGFGFKNLENILLYETNTLFDMTSVTVRVKE--LKF 1039
            V +D L+++ DL   K F+     + FGFK++EN L YE   +FD+  ++  ++   +K 
Sbjct: 875  VRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVENSLQYEREQVFDLNKISCVIENVTVKL 934

Query: 1040 MMNDADTSSRSVLHAKKITFTAIDFENEAYSQRVDFKFPDINFLIFELDENQKEGRFLLH 1099
               D D      L+    T T+ D  NE YS+R D   P++ F I+  D    E   L  
Sbjct: 935  QNVDKDEDIWLSLNLPVTTLTSFDLANERYSRRSDLSIPELLFGIYRGD---SESTCLGA 991

Query: 1100 LKTQLNFTDFIQNQAFADHRYRQREYITLHDSAYYRCSFLLPCFFQESVLYKELLGSISP 1159
              T +  T F + + FA  R  QR++I ++D+ ++RCSF+LP  +++  +Y+ L G I P
Sbjct: 992  FSTGVTVTLFERFEQFARCRVLQRKHILVNDAPFHRCSFMLPPEYKKMPIYRSLYGCIPP 1051

Query: 1160 SATXXXXXXXXXAETIDYIIEDCLGEYAPTVKPD------DSSSSDTSEGQRTPLTNEDT 1213
            S++         A+  + I E  LGE       D      D S S T         N   
Sbjct: 1052 SSSLPLFPEPISADNFEVIFEKLLGEIYQEYASDSSYQITDDSISSTEHDYHNQTVN--A 1109

Query: 1214 RFQANSGFFSPHMPHXXXXXXXXXXXXVLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTD 1273
                +S  F     H             +D  Y++L    S T  +L  + K+ TE + D
Sbjct: 1110 AIGTSSSLFIRSQNHQQTLSSFIVEFDPID-GYLDL----SATEFMLE-IYKYLTEVSLD 1163

Query: 1274 -IIDKNEIAIVKKLGNLQYGASFVTTSRLHVKDLHFLYDFEEGSGVELALNS----FDFD 1328
              ID  EI I+ +        + ++  R+   ++      ++       L+S     D  
Sbjct: 1164 EAIDSLEIGIINQFIQTFGEDNGISEVRVLCPNISLSATNKQSKFSMFKLSSKIKNLDIT 1223

Query: 1329 LRRKTIENEDEKVILEKTMFSNIHTLRISLLEAHPSSISMKPAAL-QLSIEDLELW---- 1383
             R K+ +   +    + T+   I  +R ++++        +P+ L   SIE LE +    
Sbjct: 1224 SRIKSSDPNLKPDPEKTTLCYKIDYIRANIVQDGIVVPPKQPSQLFSCSIELLEGYLSYD 1283

Query: 1384 -SSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQIKVLRDTITSAKELENLRKKTQKD 1442
              S +D NV S +VT    T D+   E ++ ++     +L+  ++S    E+    ++++
Sbjct: 1284 KLSLLDNNVQSCSVTLSPGT-DKLLFEFLNPFI-STFDLLQRELSS---FEDTLLASKRE 1338

Query: 1443 LICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVRENRSWRIITRLRHILTYLPNDWRT 1502
             + ++      Y+I HDP VITKPA I R S  H+R   SWRII RLRHIL YLP +W  
Sbjct: 1339 FLLNILRGGRDYEIQHDPPVITKPANITRFSNRHIRSAESWRIIMRLRHILNYLPQEWHQ 1398

Query: 1503 A--DHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDLSDITRSYIYKKIFLPQNEDSF 1558
            +   HL T QD  +P    ++   F+S+FS+WR+W+ +D+  S++++K+F  +    F
Sbjct: 1399 SFTRHLGT-QDFTSPEEAGKE---FLSIFSDWRSWEPTDVQGSFVHEKVFTKKRSRPF 1452

 Score =  563 bits (1451), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 386/1244 (31%), Positives = 625/1244 (50%), Gaps = 70/1244 (5%)

Query: 1803 EKIKRQVEVLIPQ-FKSHEVKNSSAVTKKTPRIPIKFDIRFNFTDMSSEIMLLSPFYLLQ 1861
            ++IK  VE L+P+ F    ++  S+  K    +      +    +++ ++ +LSPF +L 
Sbjct: 1673 DEIKYLVEALVPELFAEPPIERESSGNKIHAVL-----FQGQVANITLKLQILSPFIILY 1727

Query: 1862 DVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSEQFFKFSSTDLQFKCXXXXXXXXXXX 1921
              +   + A   +++   L   E  + + S      +FK++ T L+              
Sbjct: 1728 CAENFELQAESTDSVIFDLNSGESYMEISSAKQKLDYFKYTHTCLKLS-GTSSSARLFEH 1786

Query: 1922 XQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHIQKLWNFLRSASGGNDRSPSRNTRW 1981
                  ++KL++ + +  + +LLQD +  + S+  +  + N  +S+      + S    W
Sbjct: 1787 ISCDIGILKLSVFDLKTRITDLLQDIKAALFSMKSLSDILNISQSSP-----TASAFGSW 1841

Query: 1982 ------ALDANLKYFGLLVPVSSICYIFELHSLFASLTNANEQYEEYDRH-FSGQIVVES 2034
                   L     Y GLL+      YI E ++  A  T          R  F     +ES
Sbjct: 1842 FSILPDNLSLQATYAGLLLGFGHTLYILEFNNFEAKHTRDGLPDAITPRPCFKVDHSIES 1901

Query: 2035 CYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIESSYFRLCLFPELLVDILWSV 2094
               L+K+  +   L+KV+DF++ F         +QS QIES++ ++ L P  +V +L   
Sbjct: 1902 ASFLIKDRRIDDRLAKVVDFAVNFNMVHDTDLCIQSVQIESTHLKITLAPMTVVRLL--- 1958

Query: 2095 HYLQSLLNHF---KKHHTP---WLPYSSNKTAKSGES------TLDFRSIHILSYNFCVG 2142
                SL+N F   +K  T    + P S++  + + E        L  +S HILS++F + 
Sbjct: 1959 ----SLINEFGIIRKQFTEESIYTPSSAHNNSTATECLEPSVWRLIIKSGHILSHDFSIV 2014

Query: 2143 WLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDT-FYSQKSEKDSY 2201
            WLF++ ++S  GLI GYDRLFS YEK +GKLTL++ Y S A    S+  FYS    K   
Sbjct: 2015 WLFDIPNSSADGLICGYDRLFSVYEKPYGKLTLLNAYFSAAKILASEADFYSSVVRKQRI 2074

Query: 2202 TRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKRFNEMKKA 2261
              +YLS+MQ+ YW   ++   DLF+R HG  + V   +    L+E+T+ SI+ FN +KKA
Sbjct: 2075 NTSYLSDMQLRYWFTEDSENTDLFIRIHGAKLAVDISAEIVTLLEETIQSIQTFNNLKKA 2134

Query: 2262 KI------KQTGSSTKSKLNMEAASNTLAPFLAHIRTINSQLNFAGGVFKVYSPTELDSK 2315
             +      KQ    +K   N    +N LA     +R++N  +N+AG   K++S  +    
Sbjct: 2135 LVDPFRTKKQDSDISKEPYNW---NNQLA---TGVRSLNCIINYAGVTLKLHS-HDGRGD 2187

Query: 2316 AEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIKN 2375
            A P LE+ SP  ++AI+Y++    EK+H  R   T  PTHN  ++  A L+ D  +    
Sbjct: 2188 ASP-LELTSPSYKVAIDYKYFPNLEKTHRFRTLITATPTHNTFYSTSAFLIHDLCYRFSK 2246

Query: 2376 MIRNLSSEDKSHPSKPV----TDSIDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKVQLD 2431
            +++  S+E+KS  +        +  D  +LL   D+   +  GKQ+++FSCEPKAKVQ  
Sbjct: 2247 LLKTSSTENKSSSASTSSSIKVEGSDNSTLLGSIDLVIILNVGKQEVTFSCEPKAKVQAT 2306

Query: 2432 AGFNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIV---MMF 2488
             GF  F  ++  + ++  E   ++  ++ + ++ RHI+SR+  A+  L +I +V   M  
Sbjct: 2307 VGFEKFDIKIFNNNINDEESLCLAIEIENLMTNSRHIYSREVCASLKLRHISMVFDIMGS 2366

Query: 2489 TYPNVYGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAKKXXXX 2548
                +YG  L+S    Y NMKQ Q+L +F+D W          S  +     D  +    
Sbjct: 2367 QVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQWFPQKTPMNTGSYPEGVLVDDISRSIGS 2426

Query: 2549 XXXXXXXXXRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRTWHT 2608
                        F W +++I       ++LGPSLGVL +  E VW  +K Q D  +    
Sbjct: 2427 KFYKGSSSSS--FTWGYSVIVAGSCAEIELGPSLGVLNVTSEDVWAISKQQVDWSQQLDL 2484

Query: 2609 FAHGITVNSEGRLSGMFELDQASSVSEISWPE-EDLLRVGPLISVSMAINRMSIKSAFDY 2667
                + V S GRL G F +  A    E+ WP  +D  +V PL+ V +  + +  K +FDY
Sbjct: 2485 NMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDFFQV-PLVCVKLGSDTVDTKLSFDY 2543

Query: 2668 HMFLIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCXXXXXXXXXXDIYNTIMRM 2727
            H F I S+K     L NE D    L DLL V++ FES+ +           DI N+I R+
Sbjct: 2544 HTFFISSLKQGYASLFNERDEDGSLADLLSVTVSFESVNIFLTALAAANISDIKNSITRL 2603

Query: 2728 QQDNRISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLFDAE 2787
            ++DN +SY+ +   S+   S        + ++L+LLRT +S+ +   ++ ISP SLFD++
Sbjct: 2604 KKDNELSYLSSFLASD-QPSDEPEEDGGIFDTLSLLRTQLSLNLGVFRLQISPTSLFDSD 2662

Query: 2788 VLVVSVRDVNARSETQSGEKLKTELQLQISDVNAXXXXXXXXXXXXTVSKIAVDDYMLYA 2847
            VL+++   + A +  Q+  K+KT+L  Q+ DV+              ++ + V  Y+  +
Sbjct: 2663 VLILTATKMMANTGIQADIKIKTDLHWQLDDVSLALLPFNNSLDESYLATMEVGKYIELS 2722

Query: 2848 SKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMWATH 2907
            S   GG I   P ++V+MTTWQ+  S V+E L++  F   + ++WNLGP++FIK+MW  H
Sbjct: 2723 STIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFGGTVKIRWNLGPISFIKDMWQAH 2782

Query: 2908 VRSLAVRRTQL-GNSSPELEVANESDK----EDTVKSKFIYVPLDEPYIEMPQIKDLGDA 2962
            + ++ +R     G +   + V   + K    E  + S + Y+PL EP IEMP+IKDLGDA
Sbjct: 2783 MNAMQLREGYYHGLAESGVAVTPLNSKAVPLEMHLGSDYQYLPLQEPDIEMPRIKDLGDA 2842

Query: 2963 TPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKLQQRA 3006
            TPP+EWFGV+R   P  THQ  ++ +QKL  TAEKEY K+  RA
Sbjct: 2843 TPPIEWFGVNRTKFPGFTHQFVIVPLQKLARTAEKEYEKILGRA 2886

>Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C
          (CSF1) -  [contig 173] PARTIAL
          Length = 62

 Score = 68.2 bits (165), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 41/60 (68%)

Query: 5  SPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRCKVKI 64
          S F++V +   ++FSWVFL DWVL   V+L   FY GR+ G+ +T ILE++ WKR  VK+
Sbjct: 3  SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 314,477,796
Number of extensions: 14148210
Number of successful extensions: 42421
Number of sequences better than 10.0: 35
Number of HSP's gapped: 42745
Number of HSP's successfully gapped: 54
Length of query: 3006
Length of database: 53,481,399
Length adjustment: 128
Effective length of query: 2878
Effective length of database: 38,804,151
Effective search space: 111678346578
Effective search space used: 111678346578
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 75 (33.5 bits)