Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C01672g8.261ON56956929070.0
YLR088W (GAA1)8.261ON61461718410.0
TDEL0F038808.261ON57958217940.0
Smik_12.1478.261ON61361617930.0
Skud_12.1568.261ON61261517910.0
Suva_10.1728.261ON61461717700.0
SAKL0H17050g8.261ON58458017340.0
Kpol_543.378.261ON57857917180.0
KLTH0G13706g8.261ON58456416660.0
AGR087C8.261ON57758116640.0
Ecym_43098.261ON57758016520.0
NDAI0J013908.261ON58358516330.0
TBLA0F030808.261ON58358216260.0
NCAS0B038608.261ON58358316260.0
KLLA0F19118g8.261ON57858216130.0
Kwal_56.238048.261ON57856315900.0
KNAG0H032508.261ON58558815750.0
CAGL0L12232g8.261ON59157615650.0
KAFR0B055508.261ON55555115090.0
TPHA0A018208.261ON58157514950.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C01672g
         (569 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {...  1124   0.0  
YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subun...   713   0.0  
TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.2...   695   0.0  
Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088...   695   0.0  
Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088...   694   0.0  
Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088...   686   0.0  
SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]...   672   0.0  
Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON} (82589..8...   666   0.0  
KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]...   646   0.0  
AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON} S...   645   0.0  
Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}...   640   0.0  
NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {...   633   0.0  
TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {O...   630   0.0  
NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {O...   630   0.0  
KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} simi...   625   0.0  
Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {...   617   0.0  
KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {O...   611   0.0  
CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON} sim...   607   0.0  
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...   585   0.0  
TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {O...   580   0.0  

>ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 569

 Score = 1124 bits (2907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/569 (97%), Positives = 552/569 (97%)

Query: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60
           MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP
Sbjct: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120
           SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120

Query: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180
           YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN
Sbjct: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180

Query: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240
           PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI
Sbjct: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240

Query: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300
           AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI
Sbjct: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300

Query: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360
           QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL
Sbjct: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360

Query: 361 PATVVLTAGFXXXXXXXXXXXXXXXXXFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420
           PATVVLTAGF                 FYSHYNLKALLFWLVSILVSFVFSQLFLYVPST
Sbjct: 361 PATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420

Query: 421 ILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGIL 480
           ILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGIL
Sbjct: 421 ILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGIL 480

Query: 481 AFPMTAVGTQRSLTFKKYALLIISNPLVSFFIVKPHPQLLQKLISAWQDLGCWTWFVLCL 540
           AFPMTAVGTQRSLTFKKYALLIISNPLVSFFIVKPHPQLLQKLISAWQDLGCWTWFVLCL
Sbjct: 481 AFPMTAVGTQRSLTFKKYALLIISNPLVSFFIVKPHPQLLQKLISAWQDLGCWTWFVLCL 540

Query: 541 GWLPSWTLIALSACSSTNLDPVATSKKEQ 569
           GWLPSWTLIALSACSSTNLDPVATSKKEQ
Sbjct: 541 GWLPSWTLIALSACSSTNLDPVATSKKEQ 569

>YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subunit
           of the GPI (glycosylphosphatidylinositol):protein
           transamidase complex, removes the GPI-anchoring signal
           and attaches GPI to proteins in the ER
          Length = 614

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/617 (57%), Positives = 443/617 (71%), Gaps = 52/617 (8%)

Query: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60
           MAL+E+L RR+V+MGLVP+IIALLP++SM+CA+   + +A LP++GQ+RRTYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120
           SQAYSYFRESEWNILRGYRSQI+    +++ ERN  M  WLQEFG KT+IY NE+YG++L
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180
           YG++HA RGDGTEA++LAVPW+N++ + N+GGA+LG+SL+RFFSRWPVWSKNII+VFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240
           P  ALRSWV+AYHTSLDLTGGSIEAA+VLDY  T D+F+Y EISY GLNGELPNLDLVNI
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300
           A+SITEHEG+ VSLHG+  + + + ++WSRLKIL  GI   A +G++   GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300

Query: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360
           QSVT+KAHG  G  +DITTFGRIPEAMFRSINNLLEKFHQS+FFY+L+APR FVSISSYL
Sbjct: 301 QSVTLKAHGNSG--HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PATVVLTAGFXXXXXXXXXXXXXXXXXFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420
           P+ V L+  F                  +S YNL ALL W VS+++SFV SQ FL +PS+
Sbjct: 359 PSAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSS 418

Query: 421 ILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGIL 480
            LL+   +    LPL   R   I+EPLS+RL+  AFLY SLV TSL+M+NF +A ++G L
Sbjct: 419 GLLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478

Query: 481 AFPMTAVGT-----------------------------------------QRSLTFKKYA 499
           AFPMT V T                                         Q+    K   
Sbjct: 479 AFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNLV 538

Query: 500 LLIISNPLVS------FFIVKPHP-QLLQKLISAWQDLGCWTWFVLCLGWLPSWTLIALS 552
           LLI++NP +S      FF  + H   ++ KL+SAW DL CW+WFVLC+GWLP W LI  S
Sbjct: 539 LLILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILAS 598

Query: 553 ACSSTNLDPVATSKKEQ 569
           +  S ++  V  SK++Q
Sbjct: 599 SFESKSV--VVRSKEKQ 613

>TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.261
           YLR088W
          Length = 579

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/582 (57%), Positives = 434/582 (74%), Gaps = 19/582 (3%)

Query: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60
           M+LI +L RRV+++GLVPKI+A LPL+SM+ A++S  WLA LP+EG++RRTYISENAL+P
Sbjct: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120
           SQAYSYFRE+EWN LRGYR+QIE     ++ ERNE++A WL+EFG KT+IY +E++GD+L
Sbjct: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120

Query: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180
           YG+LHA+RGDGTEA++LA PW NA+G +N+ G S+GI+L+RFFSRWPVWSKNII+V SEN
Sbjct: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180

Query: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240
           P  ++RSWV+AYHTSLDLTGGSIEAA+VLDYPG NDYFD+ EI Y GLNGE PNLDLVNI
Sbjct: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240

Query: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300
           A+SITEHEG+ VSLHG++ + I+D  +WSRL I+L GI   A +GL  + GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300

Query: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360
           Q+VT+KAHG E G +D+TTFGRIPEAMFRSINNLLEKFHQS+FFY+L+APRYFVSISSYL
Sbjct: 301 QAVTLKAHGTE-GRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYL 359

Query: 361 PATVVLTAGFXXXXXXXXXXXXXXXXXFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420
           P  V L+  F                   S YNL +L  W +S+L  F  +QLFL   + 
Sbjct: 360 PCAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAP 419

Query: 421 ILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGIL 480
            +L++F  ++  LPL   +   I EPL++RL+  AFL+ SLV+TSL+MVNF LAF +G+ 
Sbjct: 420 TILISFSALISFLPLLLKK--KIAEPLAYRLKSVAFLFFSLVLTSLLMVNFFLAFAMGLT 477

Query: 481 AFPMTAVGTQR------SLTFKKYALLIISNPLVSFFIVK-------PHPQLLQKLISAW 527
           AFPMT V T         +  K   LL++SNP ++ +I         P   +  +  +AW
Sbjct: 478 AFPMTLVRTSSLNNYSLRIKLKNSILLLLSNPFIASYIFCQCFEPDLPGFTVFTEFATAW 537

Query: 528 QDLGCWTWFVLCLGWLPSWTLIALSACSSTNLDPVATSKKEQ 569
           ++LGCWTWFV+C+GWLPSW ++AL   S+ N  P     +++
Sbjct: 538 KELGCWTWFVICIGWLPSWLMVAL---STLNTQPAQLDDRKK 576

>Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088W
           (REAL)
          Length = 613

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/616 (56%), Positives = 440/616 (71%), Gaps = 51/616 (8%)

Query: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60
           MAL+E+L RR+V+MGLVP+IIA LP+VSM+CA+   + +A LP++GQ+RRTYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120
           SQAYSYFRESEWNILRGYRSQIE    +++ ERN  M  WLQEFG KT+IY NE+YG++L
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180
           YG++HA RGDGTEA++LAVPW+N++   NVGGA+LG+SL+RFFSRWPVWSKNIIIVFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180

Query: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240
           P  ALRSWV+AYHTSLDLTGGSIEAA+V+DY    D+F+Y EISY GLNGELPNLDLVN+
Sbjct: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240

Query: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300
           A+SITEHEG+ VSLHG+  + +   +YWSRLK+L  GI   A AG++   GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300

Query: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360
           QSVT+KAHG  G  +DITTFGRIPEAMFRSINNLLEKFHQS+FFY+L+APR FVSISSYL
Sbjct: 301 QSVTLKAHGNSG--HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PATVVLTAGFXXXXXXXXXXXXXXXXXFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420
           P+ V L+  F                  +S YNL ALL W +S+++SFV SQ+FL +PS 
Sbjct: 359 PSAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSA 418

Query: 421 ILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGIL 480
            LL+A  ++   LPL   +   I+EPLS+RL+  AFLY SLV+TSL+M+NF +A ++G L
Sbjct: 419 GLLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTL 478

Query: 481 AFPMTAVGT------QRSLTFKKY----------------------------------AL 500
           AFPMT V T      +  ++ K Y                                   L
Sbjct: 479 AFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQELKNLLL 538

Query: 501 LIISNPLVSFFIVKPH-------PQLLQKLISAWQDLGCWTWFVLCLGWLPSWTLIALSA 553
           L+++NP +S  I             ++ KL+SAW DL CW+WFVLC+GWLP W L+  S+
Sbjct: 539 LVLTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASS 598

Query: 554 CSSTNLDPVATSKKEQ 569
             S  +  +  SK++Q
Sbjct: 599 FESKRV--MLKSKEKQ 612

>Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088W
           (REAL)
          Length = 612

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/615 (56%), Positives = 438/615 (71%), Gaps = 50/615 (8%)

Query: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60
           MAL+E+L RR+V+MGLVP+IIALLP++S +CA+   + +A LP++GQ+RRTYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120
           SQAYSYFRESEWN+LRGYRSQIE    ++++ERN QM  WLQEFG KT+IY +++YG++L
Sbjct: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120

Query: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180
           YG++HA RGDGTEA++LA+PW+N++ + NVGGA+LG+SL+RFFSRWPVWSKNII+VFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240
           P  ALRSWV+AYHTSLDLTGGSIEAA+VLDY    D+F+Y EISY GLNGELPNLDLVNI
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300
           A+SITEHEG+ VSLHG+  + + +  +WSRLKIL  GI   A +G++   GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360
           QSVT+KAHG   G +DITTFGRIPEAMFRSINNLLEKFHQS+FFY+L+APR FVSISSYL
Sbjct: 301 QSVTLKAHGH--GGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PATVVLTAGFXXXXXXXXXXXXXXXXXFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420
           P+ V  +  F                  +S YNL ALL W +S++VSF+ SQ+FL VPS 
Sbjct: 359 PSAVAFSVAFAISSLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSV 418

Query: 421 ILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGIL 480
            LL+   +    LPL       I+EPLS+RL+  AFLY SLV TSL+M+NF +A ++G L
Sbjct: 419 GLLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSL 478

Query: 481 AFPMTAVGT----------------------QRSLTFKKYALLII--------------- 503
           AFPMT + T                       R   F+ +   ++               
Sbjct: 479 AFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEKAKKRQQLKNLLLL 538

Query: 504 --SNPLVS---FFIVKPHP----QLLQKLISAWQDLGCWTWFVLCLGWLPSWTLIALSAC 554
             +NP +S   F +V  +      ++ KLISAW DL CW WFVLC+GWLP W LI  S+ 
Sbjct: 539 VLTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSF 598

Query: 555 SSTNLDPVATSKKEQ 569
            S ++  V  SK++Q
Sbjct: 599 ESRSV--VVKSKEKQ 611

>Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088W
           (REAL)
          Length = 614

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/617 (56%), Positives = 439/617 (71%), Gaps = 52/617 (8%)

Query: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60
           MAL+E+L RRVV+MGLVP++IALLP++S +CA+   + +A LP++GQ+RRTYISENALMP
Sbjct: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120
           SQAYSYFRE+EWNILRGYRSQIE    +++ ERN  M  WLQEFG KT+IY NE+YG++L
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180
           YG++HA RGDGTEA++LA+PW+N+E + NVGGASLG+SL+RFFSRWPVWSKNII+VFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240
           P+ ALRSWV+AYHTSLDLTGGSIEAA+VLDY    D+F+Y E+SY GLNGELPNLDLVN+
Sbjct: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240

Query: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300
           A+SI EHEG+ VSLHG+  E + D  ++SRLKIL  GI   A +G++   GNEAFSGWRI
Sbjct: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360
           QSVT+KAHG   G +DITTFGRIPEAMFRSINNLLEKFHQS+FFY+L+APR FVSISSYL
Sbjct: 301 QSVTLKAHGH--GGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PATVVLTAGFXXXXXXXXXXXXXXXXXFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420
           P+ V L+  F                  +S YNL A+L W ++++VSFV SQLFL V   
Sbjct: 359 PSAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPA 418

Query: 421 ILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGIL 480
            LL+   + +  LP+A      I+EPLS+RL+  AFLY SLV TSL+M+NF +A ++G L
Sbjct: 419 GLLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478

Query: 481 AFPMTAV-------------GTQRSLTFKK----------------------------YA 499
           AFPMT +             GT+ +++ K                               
Sbjct: 479 AFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTLEKNQQRQKLKNLL 538

Query: 500 LLIISNPLVSFFIVK-------PHPQLLQKLISAWQDLGCWTWFVLCLGWLPSWTLIALS 552
           LLI++NP +S  +             ++ KL+SAW DL CW+WF+LCLGWLP W LI  S
Sbjct: 539 LLILTNPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLILAS 598

Query: 553 ACSSTNLDPVATSKKEQ 569
           +  S ++  V  SK++Q
Sbjct: 599 SFESKSV--VVKSKEKQ 613

>SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/580 (57%), Positives = 428/580 (73%), Gaps = 13/580 (2%)

Query: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLAT-LPIEGQFRRTYISENALM 59
           MAL+E+L RR ++MGL+PK IALLP +S+ CA++   WLA  +P +GQFRRTYISENALM
Sbjct: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDS 119
           PSQAYSYFRE+EWN+LRGYR+QIE F + S +ERNE+++ WLQ+FGAKT+IY NEEYG++
Sbjct: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120

Query: 120 LYGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSE 179
           LYGILHA RGDGTEA++LA PWYN+E   N GG +L +SLSRFFSRWPVWSKNIIIV SE
Sbjct: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180

Query: 180 NPNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVN 239
           +P  ALRSWV+AYHTSLDLTGGSIEAA+V+D+PG+ND+F Y EI + GLNGELPNLDLVN
Sbjct: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240

Query: 240 IAVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWR 299
           +AV ITEHEG+ VSLHG++ E +    ++SR+K ++ G+   A +G++   GNE FSGWR
Sbjct: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300

Query: 300 IQSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSY 359
           I SVT+KA G + G  DITTFGRIPEA+FRS+NNLLEKFHQS+FFY+L+APR FVSI SY
Sbjct: 301 IHSVTLKACGTD-GPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSY 359

Query: 360 LPATVVLTAGFXXXXXXXXXXXXXXXXXFYSHYNLKALLFWLVSILVSFVFSQLFLYVPS 419
           LPA V L+  F                   S YN+ ALL + V++ VSF+ +Q FLY P 
Sbjct: 360 LPAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQ 419

Query: 420 TILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGI 479
             LL++  V++LL+P+   R+  I  P S+RL+ +A+LY S+V+TSL++VNF+LAF +G 
Sbjct: 420 PELLLSLNVLLLLMPIIFTRV-KIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGC 478

Query: 480 LAFPMTAVGTQRS---LTFKKYALLIISNPLVSFFIVK-------PHPQLLQKLISAWQD 529
           LAFPMT V T         K   LL+ISNP ++ ++            Q+   L SAW+D
Sbjct: 479 LAFPMTLVRTTSGNLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKD 538

Query: 530 LGCWTWFVLCLGWLPSWTLIALSACSSTNLDPVATSKKEQ 569
           LGCWTWFV+C+GWLPSW L+A S   S ++      K E 
Sbjct: 539 LGCWTWFVICIGWLPSWLLVAYSGIDSVSIVVPQDEKTES 578

>Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON}
           (82589..84325) [1737 nt, 579 aa]
          Length = 578

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/579 (56%), Positives = 420/579 (72%), Gaps = 13/579 (2%)

Query: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60
           M+++E LQRR+++ GL+PK +A LP +SM+   +S + +  LP++GQFRRTYISENALMP
Sbjct: 1   MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSVMLMLYLPMDGQFRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120
           SQAYSYFRE+EWNILRGYR +IE     S+ ERN  M+ WL+EFG KTS+Y N+EYGDSL
Sbjct: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120

Query: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180
           YG+ +A RGDGTE+++LAVPWYNAE + NV GA+LG+SL+RF SRWPVWSKNII+VFSEN
Sbjct: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180

Query: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240
           P  ALRSWV+AYHTSLDLTGGSIEAA+VLDYPG +DYF+Y E+ Y G NG LPNLDLVNI
Sbjct: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240

Query: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300
           A+SI EHEG+ VSLHG+TP+ + +  YWSRLK++  G    A  G+  + GNEAFSGWRI
Sbjct: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300

Query: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360
           Q++T+KA G    N+D+TTFGR+ EAMFRSINNLLEKFHQS+FFY L+APRYFVSI SYL
Sbjct: 301 QALTLKARGDT--NHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYL 358

Query: 361 PATVVLTAGFXXXXXXXXXXXXXXXXXFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420
           PA VVL+  F                   S+YNL + +FW VS++V F     F Y P  
Sbjct: 359 PAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQP 418

Query: 421 ILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGIL 480
           +LL+   VV+  +PLAA +  +I+EPL++RL+  +F+Y+SLV+TSL++VNF LAF +G+ 
Sbjct: 419 LLLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLF 478

Query: 481 AFPMTAVGTQRS----LTFKKYALLIISNPLVSF--FIVKPHPQL-----LQKLISAWQD 529
           A+PMT V    +    L  +   LL ISNP ++F  FI     +L     +  L+ AW  
Sbjct: 479 AYPMTLVMLNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAWNK 538

Query: 530 LGCWTWFVLCLGWLPSWTLIALSACSSTNLDPVATSKKE 568
           LG WTWF+ C+GW PSW L+A+SA     +     SKK 
Sbjct: 539 LGSWTWFIFCIGWFPSWILVAISALKVEQVQTEPNSKKH 577

>KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/564 (55%), Positives = 418/564 (74%), Gaps = 14/564 (2%)

Query: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATL-PIEGQFRRTYISENALM 59
           MALIE+LQRR++++GL+P+I+  LP +S++C ++   WL  L P+EGQ+R TYISENALM
Sbjct: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDS 119
           PSQAYSYFRE+EWNILRGYR+QI+   E S+ ERNE +A W QEFGAKT+ Y ++ +G++
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120

Query: 120 LYGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSE 179
           +YG+LHA RGDGTEA++LA PWYN +G+ N+GGA+L  +LSRFFSRWPVWSKNIIIVFS+
Sbjct: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180

Query: 180 NPNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVN 239
           +P  +LRSWV AYHTSLDLTGGSIE+A+VLDYPG+ND+F Y EI Y GLNGELPNLDLVN
Sbjct: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 IAVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWR 299
           +AV ITEHEG+ VSL+G++ E +   +Y+S++K ++ G+ + A +G++   GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMMVGVKKMALSGVQSCYGNEAFSGWR 300

Query: 300 IQSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSY 359
           IQ++ ++A G + G  DITTFGRIPEA FRS+NNLLEKFHQS+FFY+L+APRYFVSI+SY
Sbjct: 301 IQAIVLRARGTD-GPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASY 359

Query: 360 LPATVVLTAGFXXXXXXXXXXXXXXXXXFYSHYNLKALLFWLVSILVSFVFSQLFLYVPS 419
           LPA V  +  F                  +S +NL A++ + V++L+SF  S LF +   
Sbjct: 360 LPAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSAVIGFTVALLLSFALSILFSHWQY 419

Query: 420 TILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGI 479
           + LL++   V+ +LP   GR   I    S++ +  AFLY+S+V+TSL+++NF LAF +G+
Sbjct: 420 SSLLISCNAVIAVLPAIFGR-QGIEASHSYQFKSVAFLYLSVVLTSLLVINFALAFGIGL 478

Query: 480 LAFPMTAVG---TQRSLTFKKYALLIISNPLVS--FFIVKPHP-----QLLQKLISAWQD 529
           LAFP+  V    T R    K   LLI+SNP +S   F+    P     QL  +L+ AWQ 
Sbjct: 479 LAFPLILVKAPMTSRQ-RVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQK 537

Query: 530 LGCWTWFVLCLGWLPSWTLIALSA 553
           LGCWTW V+C+GWLPSW L+A S 
Sbjct: 538 LGCWTWSVVCIGWLPSWLLVACSG 561

>AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR088W
           (GAA1)
          Length = 577

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/581 (55%), Positives = 424/581 (72%), Gaps = 17/581 (2%)

Query: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLAT-LPIEGQFRRTYISENALM 59
           MA++E+L R+VV+MGLVPKII  L  +S +  ++S  WL   LP+EGQ+RRTYISENALM
Sbjct: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDS 119
           PSQAYSYFRESEWNILRGYRS+I+    ++ +ERN  +A W++E+GAK ++YN++ +G++
Sbjct: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120

Query: 120 LYGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSE 179
           LY +LHA RGDGTEA++LA PW   EG  N GG +L +++ R+FSRWPVWSKNIIIV SE
Sbjct: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180

Query: 180 NPNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVN 239
           +P+ +LRSWVQAYHT LDLTGGSIEAAIVLDYPGTNDYF + EISY GLNG +PNLDL+N
Sbjct: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240

Query: 240 IAVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWR 299
           +AV ITEHEG+ V+LHG   E +  ++Y+SR+++LL GI   A +G++   GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300

Query: 300 IQSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSY 359
           IQSVT+KA G   G+ DITTFGR+PEAMFRS+NNLLEKFHQS+FFY+L+APRYFVSI SY
Sbjct: 301 IQSVTLKARGTN-GSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSY 359

Query: 360 LPATVVLTAGFXXXXXXXXXXXXXXXXXFYSHYNLKALLFWLVSILVSFVFSQLFLYVPS 419
           LPA V L+  F                   S YN+ ALL + V++LVS + +++F Y+P+
Sbjct: 360 LPAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWALLAFSVALLVSAITAEVFFYLPA 419

Query: 420 TILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGI 479
             LL+AF VV+  +P A  + + I +P SHR +  A+LY S V++SL+++NF LAF+VG+
Sbjct: 420 PALLLAFNVVVSFMPFALVK-YKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGL 478

Query: 480 LAFPMTAVGTQRSLT----FKKYALLIISNPLVSF--FIVKPHPQL-----LQKLISAWQ 528
           LAFPMT V T    +     K   LL++SNP +S   F+    P+L        LI AW 
Sbjct: 479 LAFPMTFVRTTVHASVRQKMKNSLLLLLSNPFISICVFVHLFEPELTGFSVFYSLIDAWN 538

Query: 529 DLGCWTWFVLCLGWLPSWTLIALSACSSTNLDPVATSKKEQ 569
           DLGCWTW+VLCLGW P+W ++A S+  S    P+A   K+ 
Sbjct: 539 DLGCWTWYVLCLGWYPAWIMVAYSSIDSV---PIAAPAKKS 576

>Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}
           similar to Ashbya gossypii AGR087C
          Length = 577

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/580 (54%), Positives = 417/580 (71%), Gaps = 16/580 (2%)

Query: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLAT-LPIEGQFRRTYISENALM 59
           MA++E+L RR+V+MGLVP+IIA LP +S+ CA++S  WL   LP+EGQ+RRTYISENALM
Sbjct: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDS 119
           PSQAYSYFRESEWNILRGYR ++E+  ++  +ERN  +A W++E+GAKTSI  N +YG++
Sbjct: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120

Query: 120 LYGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSE 179
           LYGI+H  RGDGTEA++LA PW   +G  N GGA+L ISL+R+F+RWPVWSKNII+V S 
Sbjct: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180

Query: 180 NPNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVN 239
           +P  +LR+WV+AYHT LDLTGGSIE+A+VLDYPGTNDYF Y EI Y GLNG LPNLDL+N
Sbjct: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIGYNGLNGGLPNLDLIN 240

Query: 240 IAVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWR 299
            AV I+EHEG+ VSLHGM    ++ ++Y  RLK LL GI     AG++   G+EAF+GWR
Sbjct: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300

Query: 300 IQSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSY 359
           IQSVT+KAHG++G   D+TTFGR+PEA+FRS+NNLLEKFHQS+FFY+L++PR FVSI SY
Sbjct: 301 IQSVTLKAHGQDGP-FDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSY 359

Query: 360 LPATVVLTAGFXXXXXXXXXXXXXXXXXFYSHYNLKALLFWLVSILVSFVFSQLFLYVPS 419
           LPA + L+A F                   S YN+ AL  + V++++SFV ++ F Y+P 
Sbjct: 360 LPAAIALSASFAIASADSILNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPL 419

Query: 420 TILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGI 479
             LL+AF V +  +     + + I +P S+R + +A LY S+V+TSL++VNF LA  VG+
Sbjct: 420 PSLLLAFNVALSFISFTVIK-YKIQKPFSYRFKAFAHLYFSIVLTSLLVVNFALALAVGV 478

Query: 480 LAFPMTAVGTQRSLTFKKY----ALLIISNPLVSFFIVK-------PHPQLLQKLISAWQ 528
           LAFPM+   T  + T ++      LL+ SNP ++ +I+            L   LI AW 
Sbjct: 479 LAFPMSLTKTTTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWT 538

Query: 529 DLGCWTWFVLCLGWLPSWTLIALSACSSTNLDPVATSKKE 568
            LGCWTW+VLC+GW PSW L+A S+  S  +  V TSKK 
Sbjct: 539 QLGCWTWYVLCIGWYPSWILVAYSSIDSIPI--VTTSKKS 576

>NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/585 (53%), Positives = 415/585 (70%), Gaps = 19/585 (3%)

Query: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60
           M L+E++QR +V  GL+PKI+A LP +S+I   IS L +A LP++GQ+R TYISENALMP
Sbjct: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120
           SQAYSYFRE+EWNI+RGYR+++ H    ++ ERN+ M  WL EFG KT IY N +  + L
Sbjct: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NEVL 119

Query: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180
           YG+ HA RGDGTEAI+LAVPW+N +G+ N  GA++G++L+R+FSRWPVWSKNII+VFSEN
Sbjct: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179

Query: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240
           P+ ALRSWV+AY+TSLDLTGGSIEAAIVLD PG NDYFDY E+ Y GLNGELPNLDLVNI
Sbjct: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239

Query: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300
            + I EHEG+ VSLHG   + I + +YW+RLKIL+  I   AF+GL    GNEAFSGWRI
Sbjct: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299

Query: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360
           QS+T+K  G  G   DIT FGR+PEAMFRSINNLLEKFHQS+FFY+L+APR FVSISSYL
Sbjct: 300 QSITLKTKGNSGP-LDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PATVVLTAGFXXXXXXXXXXXXXXXXXFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420
           P+ V+L+  F                 F+S+Y L   + W V+++  F+ +QLFL +P  
Sbjct: 359 PSAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQLFLILPIP 418

Query: 421 ILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGIL 480
            LL+   +V+ +  +           +S+RL+ +AFL++SL++TSL+MVNF L+F++G++
Sbjct: 419 SLLLLINIVISISSIIIQNKKLFKPAVSNRLRSFAFLHLSLILTSLLMVNFPLSFMIGLM 478

Query: 481 AFPMTAV-----GTQRSLTFKKYALLIISNPLVSFFIVKPHP-----------QLLQKLI 524
           AFPMT V      T   +  +   LL+ISNP ++  I                +++ +LI
Sbjct: 479 AFPMTKVRSITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRLI 538

Query: 525 SAWQDLGCWTWFVLCLGWLPSWTLIALSACSSTNLDPVATSKKEQ 569
           SAW+D+ CWTWFVLCLGWLPSW ++A+S   +   +P +   K+ 
Sbjct: 539 SAWKDMRCWTWFVLCLGWLPSWIMVAISVIENER-EPTSHDVKKN 582

>TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/582 (54%), Positives = 417/582 (71%), Gaps = 13/582 (2%)

Query: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60
           MAL+  + RRV++MGLVPKI+  LPLVS+  A I  +    LP++GQ+R TYISENALMP
Sbjct: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120
           SQAYSYFRESEWNILRGYR++I+ F  + + +RN  M +WL+EFG KTS+Y+N+EYGD+L
Sbjct: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120

Query: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180
           YGI +A RGDGTEAI+LA+PWYNA+G+ N GGA+LGI+LSRFFSRWP+WSKNII+VFSEN
Sbjct: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180

Query: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240
           P+ ALRSWV AYH SLDLTGGSIEAAIV+DYP ++D+FDY EI Y G+NGELPNLDL+NI
Sbjct: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240

Query: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300
           A+ ITEHEG+ VSLHG+  ES++  +Y+SRL+ LL G      +G++P  GNEAFSG+RI
Sbjct: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300

Query: 301 QSVTIKAH-GKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSY 359
           Q++T+KA    +  ++DIT+FGRI EA FRS+NNLLEKFHQS+FFY+++AP+YFVSISSY
Sbjct: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360

Query: 360 LPATVVLTAGFXXXXXXXXXXXXXXXXXFYSHYNLKALLFWLVSILVSFVFSQLFLYVPS 419
           LP+ V  +  F                  +S YNL A L + +SI  SF  ++L L    
Sbjct: 361 LPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420

Query: 420 TILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGI 479
             LLV   V + +LP   G  +TI EPLS+RL+  AFLY+SLV+TSL+++NF+LAF +GI
Sbjct: 421 PRLLVLGSVFLSVLPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIGI 480

Query: 480 LAFPMTAVGT-----QRSLTFKKYALLIISNPLVSFFIVK-------PHPQLLQKLISAW 527
           L F MTAV T        +  +    L++SNP  S  +            ++  + I +W
Sbjct: 481 LGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHSW 540

Query: 528 QDLGCWTWFVLCLGWLPSWTLIALSACSSTNLDPVATSKKEQ 569
             L CWTWF++C+GWLP W L+++S+  +  +       K+Q
Sbjct: 541 NTLNCWTWFIICVGWLPPWILVSISSIQTNTVMQSPDYGKKQ 582

>NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/583 (54%), Positives = 422/583 (72%), Gaps = 15/583 (2%)

Query: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60
           M L E++QR+V+  GL+PK+I+LLPL+S +C ++  + +  LP EGQ+R TYISENALMP
Sbjct: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIVIIGILPFEGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120
           SQAYSYFRESEWNI+RGYRSQI      S  ERN  M+EWLQ+FG KT IY N E GD+L
Sbjct: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120

Query: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180
           YG+ HA RGDGTE+++LA+PW+NA+G+ NV GA+LG++L+R+FSRWPVWSKNII+VF+EN
Sbjct: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180

Query: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240
           P  ALRSWV+AYHTSLDLTGGSIEAAIVLD+ G  D FDY EI Y GLNGELPNLD+VNI
Sbjct: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240

Query: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300
            V   EHEG+ VSLHG   + I +++ +SRLKIL+  I   A +G++   GNEAFSGWRI
Sbjct: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300

Query: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360
           QSVT++A G + G  D+T+FGR+PEAMFRSINNLLEKFHQS+FFY+++APR+FVSISSYL
Sbjct: 301 QSVTLRARG-QNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYL 359

Query: 361 PATVVLTAGFXXXXXXXXXXXXXXXXXFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420
           P+TV ++ GF                 F+S Y L ++LFW VS++V+F+ S +F+Y P  
Sbjct: 360 PSTVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFP 419

Query: 421 ILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGIL 480
            +L+A  +++ L P        + + LS+RL+  AFL+MSL++TSL+MVNF LAF +G+L
Sbjct: 420 TILLAVNIIICLYPAILKGNAFMKDLLSYRLRSTAFLFMSLLLTSLLMVNFPLAFGMGLL 479

Query: 481 AFPMTAVGTQRSLT-------FKKYALLIISNPLVSFFIVK-------PHPQLLQKLISA 526
           +FPMT V T  S T        K   LL++SNP ++ ++             + ++L+SA
Sbjct: 480 SFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVSA 539

Query: 527 WQDLGCWTWFVLCLGWLPSWTLIALSACSSTNLDPVATSKKEQ 569
            ++LGCWTW VLC+GW   W L+A+SA  +  L   +   K+Q
Sbjct: 540 SRELGCWTWLVLCVGWWTPWLLVAISALDTVKLSNDSEDFKKQ 582

>KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} similar
           to uniprot|P39012 Saccharomyces cerevisiae YLR088W GAA1
           Subunit of the GPI:protein transamidase complex removes
           the GPI-anchoring signal and attaches GPI
           (glycosylphosphatidylinositol) to proteins in the ER
          Length = 578

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/582 (53%), Positives = 416/582 (71%), Gaps = 18/582 (3%)

Query: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLA-TLPIEGQFRRTYISENALM 59
           MAL+E+L RR++ +GL+PK I+ L  +S++C +I   WL   LP +GQFRRTYISENAL+
Sbjct: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60

Query: 60  PSQAYSYFRESEWNILRGYRSQIEHFGEISN-NERNEQMAEWLQEFGAKTSIYNNEEYGD 118
           PSQAYSYFRESEWNILRGYR+Q++ F  +S  ++ N ++++WLQEFG KT+IY++E+YG+
Sbjct: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120

Query: 119 SLYGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFS 178
           +LYGI HA RGDGTEA+++A PWYN   + N GGA+L ISL RFFSRWPVWSKNIIIV S
Sbjct: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180

Query: 179 ENPNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLV 238
           E+P  +LRSWV AYHTSLDLTGGSIE+AIVLDYPGT+D FDY EI Y GLNGE PNLDLV
Sbjct: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240

Query: 239 NIAVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGW 298
           N+AV I EHEG+ VSLHG+    ++   Y SRLK +L GI     +G++   GNEAFSGW
Sbjct: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300

Query: 299 RIQSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISS 358
           RIQS+T+KA G +G  +DITTFGR+PEA+ RS+NNLLEKFHQS+FFY+L+APRYF+SI +
Sbjct: 301 RIQSLTLKAKGIDGP-HDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGT 359

Query: 359 YLPATVVLTAGFXXXXXXXXXXXXXXXXXFYSHYNLKALLFWLVSILVSFVFSQLFLYVP 418
           YL   V ++  F                   S YN+ ++L + +S++ +F  SQLF+Y P
Sbjct: 360 YLATAVAVSVAFVFAALNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFP 419

Query: 419 STILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVG 478
              +L+    +  +LPL +     I EP S+R + +A++YM++V+TSL+++NF+LA V+G
Sbjct: 420 LPRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMG 479

Query: 479 ILAFPMTAVGT----QRSLTFKKYALLIISNPLVSFF----IVKPHP---QLLQKLISAW 527
           +LAFPMT   T       L+ K   LLIISNP ++ +     V+P     ++   LI A 
Sbjct: 480 LLAFPMTRTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIEAS 539

Query: 528 QDLGCWTWFVLCLGWLPSWTLIALSACSSTNLD-PVATSKKE 568
           Q LGCWTW+++CLGW PSW L+  ++  +  +  P+   KKE
Sbjct: 540 QQLGCWTWYIICLGWYPSWLLVTYASIDAIEVQTPI---KKE 578

>Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {ON}
           YLR088W (GAA1) - Possible component of GPI:protein
           transamidase [contig 173] FULL
          Length = 578

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/563 (53%), Positives = 411/563 (73%), Gaps = 12/563 (2%)

Query: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATL-PIEGQFRRTYISENALM 59
           MALIE+LQR+V+++GL+P+I+  LP +S++C +I   W+  L P+EGQ+R TYISENALM
Sbjct: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDS 119
           PSQAYSYFRE+EWNILRGYR+QI+     S+ ERNE +  WLQEFG KT++Y +E  G++
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120

Query: 120 LYGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSE 179
           LYG+LHA RGDGTEA++L+ PW+N +G+ N GG +L ++L+R+FSRWPVWSKNII+VFS+
Sbjct: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180

Query: 180 NPNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVN 239
           +P  +LRSWVQAYHTSLDLTGGSIE+A+VLDYPG ND+F Y EI Y GLNGELPNLDLVN
Sbjct: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 IAVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWR 299
           +A+ +TEHEG+ VSL+G+  + + +  Y++R+K ++ GI + A +G++   GNEAFSGWR
Sbjct: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300

Query: 300 IQSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSY 359
           IQ+V ++A G + G  DITTFGR+PEA+FRS+NNLLEKFHQS+FFY+L+APRYFVSI+SY
Sbjct: 301 IQAVVLRARG-DHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASY 359

Query: 360 LPATVVLTAGFXXXXXXXXXXXXXXXXXFYSHYNLKALLFWLVSILVSFVFSQLFLYVPS 419
           LPA V  +  F                      N+ A++ + V++L SF  S  F     
Sbjct: 360 LPAAVAFSVSFIVAALDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHH 419

Query: 420 TILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGI 479
            ++L+++ V+  L P+   R+  I    +HRL+  A+LY+S+V+TSL++VNF LAF +G+
Sbjct: 420 PVILISWSVMTALAPILLNRV-RIQSSYAHRLKAVAYLYLSVVLTSLLVVNFALAFGIGL 478

Query: 480 LAFPMTAVG---TQRSLTFKKYALL----IISNPLVSFFI--VKPHPQLLQKLISAWQDL 530
           LAFP+  V    T R L      LL     IS  L ++F   + P  Q+L++L+ AW + 
Sbjct: 479 LAFPLILVKNSTTPRLLFKNSLLLLLSNPFISTCLFAYFFEPLLPGLQILEQLVQAWNEF 538

Query: 531 GCWTWFVLCLGWLPSWTLIALSA 553
           GCWTW V+C+GWLPSW LIA S+
Sbjct: 539 GCWTWCVVCIGWLPSWLLIAYSS 561

>KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {ON}
           Anc_8.261 YLR088W
          Length = 585

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/588 (53%), Positives = 417/588 (70%), Gaps = 22/588 (3%)

Query: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60
           M L E LQR+ V++GL+PK++A LPL+S + A++S + +  +P+ GQ+R TYISENALMP
Sbjct: 1   MGLFETLQRKAVKLGLLPKLLAALPLLSALTAVVSVVMILIIPMNGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEHFGE--ISNNERNEQMAEWLQEFGAKTSIYNNEEYGD 118
           SQAYSYFRE+EWNILRGYR++IE      +S ++R + +A WL EFGAKT++Y NEE GD
Sbjct: 61  SQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMGD 120

Query: 119 SLYGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFS 178
           +LYG+LHA RGDGTEA++L  PW N+EG+ N+GG++L I+LSR+FSRWPVWSKNII+VFS
Sbjct: 121 TLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVFS 180

Query: 179 ENPNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLV 238
           +NP+VALRSWV+AYHTSLDLTGGSIEAA++LDYP  NDYF+Y EI + GLNGELPNLDLV
Sbjct: 181 DNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDLV 240

Query: 239 NIAVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGW 298
           N+AV IT+HEG+ VSLHG+    +   +YWSRLK+L  G+     AG++   GNE FSGW
Sbjct: 241 NVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSGW 300

Query: 299 RIQSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISS 358
           RIQ+VT+KA G+  G  DITTFGRIPEAMFRSINNLLEKFHQS+FFY L++P  FVSISS
Sbjct: 301 RIQAVTLKARGE--GQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISS 358

Query: 359 YLPATVVLTAGFXXXXXXXXXXXXXXXXXFYSHYNLKALLFWLVSILVSFVFSQLFLY-V 417
           YLP+ V+L+  F                  +  Y L A L  ++S+LVSF+ +  FLY  
Sbjct: 359 YLPSAVLLSITF-AIAAVDATVNNAYASALHITYTLLAALASVISLLVSFLVAHWFLYST 417

Query: 418 PSTILLVAFIVVMLLLPLAAGRLWT-ITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFV 476
            S + L+   VV+ + PL   R    + EP+ +R++   ++Y SL++TSL+M+NF LAF 
Sbjct: 418 TSPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRTLGYIYYSLILTSLLMLNFPLAFS 477

Query: 477 VGILAFPMTAV-------GTQRSLTFKKYALLIISNPLVSFFIVK--------PHPQLLQ 521
           +G+  +PMT V        +Q SL  +   LL+ISNP V+ +++         P+  +  
Sbjct: 478 IGLFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPFVATWLICTVVENSEFPNLDVFA 537

Query: 522 KLISAWQDLGCWTWFVLCLGWLPSWTLIALSACSSTNLDPVATSKKEQ 569
            L SAW+DL CWTWFVLCLGWLP+W L+  S+ +S         KK  
Sbjct: 538 ALFSAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTSIPAAETTIEKKSN 585

>CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088w required for attachment of GPI anchor onto
           proteins
          Length = 591

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/576 (52%), Positives = 405/576 (70%), Gaps = 21/576 (3%)

Query: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60
           M+L++++ RR+ E G + K++  LP VS +  +++ + LA LP++GQ+RRTYISENALMP
Sbjct: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNLLVVVAIVLLAILPLDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120
           SQAYSYFRE+EWNILRGYRSQIE     S ++RNE +AEWLQE G KT++Y +E++G +L
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120

Query: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180
           YG+LHA RGDGTEA++LA+PW N +   N+GGA+LG+SLS+FF RWPVWSKNII+VFSE+
Sbjct: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180

Query: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240
              ALR+WV AYHTSLDLT GSIEAA+VLDYP  +D+F+Y EISY GLNGELPNLDLVNI
Sbjct: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300
           AVSITEHEG+ VSLHG+ P  + +  Y++RLKI+  GI   A +G++ + GNEAFSGWRI
Sbjct: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300

Query: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360
           QSVT++AHG E G  DIT FGRIPEAMFRS+NNLLEKFHQSYFFY+L+APR FVSIS+YL
Sbjct: 301 QSVTLRAHGNE-GQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYL 359

Query: 361 PATVVLTAGFXXXXXXXXXXXXXXXXXFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420
           P+ V+++  F                 F S   L   +    S+ VSF+ S++ + +P  
Sbjct: 360 PSAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIV 419

Query: 421 ILLVAFIVVMLLLPLAAGR--LWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVG 478
             L+   V +  LPL   +  +  I + +++RL+    +Y SL++TSL+MVNF L F++G
Sbjct: 420 ESLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKSIGSIYYSLILTSLLMVNFALTFMIG 479

Query: 479 ILAFPMTAVGT---------QRSLTFKKYALLIISNPLVSFFIVKPHPQ---------LL 520
           +LAFP+T +            R    K   +L I+NP +S ++               + 
Sbjct: 480 LLAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIY 539

Query: 521 QKLISAWQDLGCWTWFVLCLGWLPSWTLIALSACSS 556
            ++I++W  LGCWTWF++CLGWLP W +  +S+  S
Sbjct: 540 NRMITSWDTLGCWTWFIICLGWLPYWLISVISSIPS 575

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/551 (54%), Positives = 389/551 (70%), Gaps = 22/551 (3%)

Query: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60
           M L+E+++R+V  MGLVPK+   LPL S I A+IS + +A LPI+GQ+R TYISENALMP
Sbjct: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKIIALISLISIAILPIDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120
           SQAYSYFRE+EWNILRGYR+Q+E+  ++   ERN+ M  WL + GAKT  +NN     ++
Sbjct: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNS----TI 116

Query: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180
           YGI H+ RGDGTEAI+LA+PW+N+EG  N GGA+LG+SL+RFF RWP+WSKNII+VFSE+
Sbjct: 117 YGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSED 176

Query: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240
              +LRSWV+AYHTSLDLTGGSIEAA++LDY   +D+FDY EI Y GLNGELPNLDLVNI
Sbjct: 177 TGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNI 236

Query: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300
           AVSITEHEG+ VSLHG+  E + + S WSR K+LL  I   + AG++   GNEAFSGWRI
Sbjct: 237 AVSITEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKDSSLAGIKKPHGNEAFSGWRI 296

Query: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360
           Q++T+KA G+  G  DITTFGRIPEAMFRSINNLLEKFHQS+F+Y+L+APR FVSISSYL
Sbjct: 297 QALTLKACGE--GGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYL 354

Query: 361 PATVVLTAGFXXXXXXXXXXXXXXXXXFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420
           PA V L+  F                 F S Y L+A++ W +SI  SF F+  +L     
Sbjct: 355 PAAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFP 414

Query: 421 ILLVAFIVVMLLLPLAAGRLWTITE---PLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVV 477
           ++L+   ++   +PL + R   + E    ++HR++ +AF Y SLV+TSL+M+NF LA  +
Sbjct: 415 VMLMFICILFSFIPLIS-RGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTI 473

Query: 478 GILAFPMTAVGTQRSL-----TFKKYALLIISNPLVS-------FFIVKPHPQLLQKLIS 525
           G+LAFPMT V    +L       K   LL++SNP +S       F         L +LI 
Sbjct: 474 GVLAFPMTLVKISNTLPTSSQALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLIP 533

Query: 526 AWQDLGCWTWF 536
           AW D+ CWTWF
Sbjct: 534 AWNDMNCWTWF 544

>TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {ON}
           Anc_8.261 YLR088W
          Length = 581

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/575 (51%), Positives = 407/575 (70%), Gaps = 23/575 (4%)

Query: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60
           MALIE L RR  ++GL+PK+I  L +VS I  +IS   +  LP++GQ+RRTYISENAL+P
Sbjct: 1   MALIEVLHRRATKLGLLPKVIGKLSIVSNILVLISIGLILCLPLDGQYRRTYISENALLP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120
           SQAYSYFRESEWNILRGYR+ IE   +     RNE ++ WL +FG K ++Y+N   GD+L
Sbjct: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120

Query: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180
           YG+ +++RGDGTEAI+LAVPWYN + ++N+GGA+LGISLSR+FSRWP+WSKNII+V SEN
Sbjct: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180

Query: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240
           P+ A++SWV AYH SLDLTGGS+EAAIVLD+P  ++YF++ E+ + G+NGELPNLD+VN+
Sbjct: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240

Query: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300
           A+S+ EHEGV VSL G+    +   SY++RLK LL G+   A +G   L GNEAFSG RI
Sbjct: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300

Query: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360
           Q++T+KA G EG  +DITTFGRIPEA+FRS+NNLLEKFHQS+FFY LVAPR+FVSI SYL
Sbjct: 301 QALTLKACGTEG--HDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYL 358

Query: 361 PATVVLTAGFXXXXXXXXXXXXXXXXXFYSHYNLKALLFWLVSILVSFVFSQLF-LYVPS 419
           P+ V L+  F                    + ++ AL+ +  SI +SF+F Q+   ++  
Sbjct: 359 PSAVCLSISFGISAAHSYINNQYITVPLSDNSSILALIIFFGSIAISFIFLQINETFLQP 418

Query: 420 TILLVAFIVVMLLLPLA--AGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVV 477
            ++++AF+++   LPL      L TI   LS+RL+ +AF+Y+SLV+TSL+++NF LAF +
Sbjct: 419 HLMILAFLLIS-FLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGM 477

Query: 478 GILAFPMTAVGT-QRSLTFKKYAL----LIISNPLVSFFIVKP-------HPQLLQKLIS 525
           G+LAFP+T   +    +TFK   +    L ISNP ++ FI          + ++   LIS
Sbjct: 478 GLLAFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDLIS 537

Query: 526 AWQDLGCWTWFVLCLGWLPSWTLIALSACSSTNLD 560
           +++ +G WTW + C+GW  +W ++ ++     NLD
Sbjct: 538 SFKYMGNWTWAITCIGWFTTWQMVYIA-----NLD 567

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,971,322
Number of extensions: 2463754
Number of successful extensions: 6131
Number of sequences better than 10.0: 31
Number of HSP's gapped: 6217
Number of HSP's successfully gapped: 35
Length of query: 569
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 454
Effective length of database: 40,294,809
Effective search space: 18293843286
Effective search space used: 18293843286
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 68 (30.8 bits)